Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14960g5.477ON77577540810.0
Kwal_55.212505.477ON77577534900.0
SAKL0G03608g5.477ON79478325400.0
AFR135W5.477ON79178622070.0
Ecym_23115.477ON77578421950.0
Kpol_543.105.477ON87674519150.0
TDEL0A034105.477ON83775419080.0
KLLA0E03213g5.477ON78875018980.0
Suva_8.1925.477ON87976418760.0
Smik_15.3205.477ON87376018750.0
YOR141C (ARP8)5.477ON88176018720.0
ZYRO0D11308g5.477ON86875818660.0
NCAS0H022905.477ON86377218420.0
Skud_15.3045.477ON88376518340.0
TPHA0J027905.477ON88282018250.0
TBLA0A025305.477ON85474917500.0
CAGL0I07161g5.477ON83774917430.0
KAFR0E025305.477ON84284417390.0
KNAG0B040205.477ON93482416320.0
NDAI0C013705.477ON97464215780.0
Kpol_181.22.593ON4631811154e-05
TDEL0C031207.448ON4381301144e-05
ZYRO0F01122g2.593ON4621011055e-04
NDAI0A013007.448ON565861057e-04
YPR034W (ARP7)7.448ON4771111048e-04
Suva_16.3647.448ON4801021030.001
TPHA0B014607.448ON4851351030.001
Smik_16.2787.448ON4761021020.001
CAGL0K05335g7.448ON5291091010.002
Kpol_520.117.448ON4881251010.002
TBLA0H028002.593ON48483980.004
Kpol_479.253.161ON391163970.004
AFR051W2.117ON405161960.006
ADR316W3.161ON391166930.013
Ecym_52373.161ON391207930.015
Skud_4.2223.161ON391183930.016
Skud_16.3217.448ON479102930.017
KLTH0F06490g3.161ON391158920.018
KAFR0C01040na 1ON337166920.019
Kwal_33.141773.161ON337167920.019
CAGL0H09042g2.117ON387260920.021
ZYRO0B04928g3.161ON391166920.021
KNAG0K01130na 1ON393163910.022
CAGL0K01595g3.161ON391163910.022
TDEL0D046103.161ON391175910.024
Suva_4.2203.161ON391180910.027
SAKL0F13772g7.448ON42294910.028
ACR184C7.448ON40195900.029
NCAS0C035503.161ON392180900.035
ZYRO0G17182g7.448ON46598900.037
NCAS0A147207.448ON48587900.039
NDAI0G029003.161ON391163890.041
YDL029W (ARP2)3.161ON391180890.041
TBLA0F008703.161ON391166890.044
KAFR0K021507.448ON49087890.045
Smik_4.2063.161ON391180890.047
SAKL0C07370g3.161ON391163890.047
KNAG0H036502.117ON387126880.057
Suva_13.2022.593ON467103870.084
TPHA0A009203.161ON391105860.11
ABR084W2.593ON464103850.16
KLLA0C03850g3.161ON391163840.18
Ecym_23062.593ON40799840.18
Ecym_63852.117ON377161810.34
ZYRO0F02772g8.23ON37536810.40
TBLA0C004408.23ON37536810.40
Skud_6.318.23ON36036810.41
ABR222W8.23ON37636810.41
SAKL0B00968g8.23ON37536810.41
TPHA0D002508.23ON37536810.41
NCAS0C037008.23ON37536810.41
Ecym_15208.23ON37636810.41
TDEL0C004708.23ON37536810.42
CAGL0K12694g8.23ON37536810.42
Suva_6.188.23ON37536810.42
Smik_6.398.23ON37536810.42
YFL039C (ACT1)8.23ON37536810.42
KLTH0D08624g2.593ON432104810.42
Kpol_1058.158.23ON37536810.42
NDAI0G030408.23ON37536810.43
KNAG0L002508.23ON37536810.43
KAFR0D009408.23ON37536810.43
NDAI0C005802.593ON501104800.50
NCAS0B060601.287ON49776800.57
NCAS0B071302.117ON38193790.60
KLLA0D05357g8.23ON375161780.95
Suva_15.3262.117ON38472780.98
KLTH0G18832g8.23ON37536781.0
Kwal_14.11098.23ON36036771.0
Skud_8.1902.117ON384160771.2
YMR033W (ARP9)2.593ON467103771.3
ZYRO0G05676g2.117ON381100761.4
Smik_8.2102.117ON38472761.5
KLLA0E22925g2.117ON380226761.6
Smik_13.2032.593ON467103761.6
TDEL0B068602.593ON46199752.2
NDAI0B044602.117ON38158752.3
TBLA0F004507.448ON48274752.4
Skud_13.1892.593ON467103752.4
KLLA0F24310g2.140ON242111732.5
TDEL0B048102.117ON37372742.7
KLTH0C05324g7.448ON39978742.7
KLTH0B05940g2.117ON383155742.9
Kpol_1023.188.23ON319165733.3
SAKL0E11814g2.117ON37979724.3
YHR129C (ARP1)2.117ON38472724.8
NDAI0B019608.258ON439147725.4
TBLA0B010702.117ON38372716.2
ZYRO0D05302g7.78ON85771717.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14960g
         (775 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...  1576   0.0  
Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141...  1348   0.0  
SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {...   983   0.0  
AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic ho...   854   0.0  
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...   850   0.0  
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...   742   0.0  
TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {O...   739   0.0  
KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {...   735   0.0  
Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON...   727   0.0  
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...   726   0.0  
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...   725   0.0  
ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {...   723   0.0  
NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {O...   714   0.0  
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...   711   0.0  
TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {...   707   0.0  
TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.4...   678   0.0  
CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} simila...   676   0.0  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...   674   0.0  
KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.4...   633   0.0  
NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.4...   612   0.0  
Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON} co...    49   4e-05
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    49   4e-05
ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp...    45   5e-04
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    45   7e-04
YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}  ARP7Compo...    45   8e-04
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    44   0.001
TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {O...    44   0.001
Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034...    44   0.001
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    44   0.002
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    44   0.002
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    42   0.004
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    42   0.004
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    42   0.006
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    40   0.013
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    40   0.015
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    40   0.016
Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034...    40   0.017
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    40   0.018
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    40   0.019
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    40   0.019
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    40   0.021
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    40   0.021
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    40   0.022
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    40   0.022
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    40   0.024
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    40   0.027
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    40   0.028
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    39   0.029
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    39   0.035
ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} simi...    39   0.037
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    39   0.039
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    39   0.041
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    39   0.041
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    39   0.044
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    39   0.045
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    39   0.047
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    39   0.047
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    39   0.057
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    38   0.084
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    38   0.11 
ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {...    37   0.16 
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    37   0.18 
Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}...    37   0.18 
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    36   0.34 
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    36   0.40 
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...    36   0.40 
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    36   0.41 
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    36   0.41 
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    36   0.41 
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    36   0.41 
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    36   0.41 
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    36   0.41 
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    36   0.42 
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    36   0.42 
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    36   0.42 
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    36   0.42 
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    36   0.42 
KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} simila...    36   0.42 
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    36   0.42 
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    36   0.43 
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    36   0.43 
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    36   0.43 
NDAI0C00580 Chr3 complement(110741..112246) [1506 bp, 501 aa] {O...    35   0.50 
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    35   0.57 
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    35   0.60 
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    35   0.95 
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    35   0.98 
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    35   1.0  
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    34   1.0  
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    34   1.2  
YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa] ...    34   1.3  
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    34   1.4  
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    34   1.5  
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    34   1.6  
Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 ...    34   1.6  
TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 4...    33   2.2  
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    33   2.3  
TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.4...    33   2.4  
Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 ...    33   2.4  
KLLA0F24310g Chr6 complement(2267285..2268013) [729 bp, 242 aa] ...    33   2.5  
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    33   2.7  
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    33   2.7  
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    33   2.9  
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    33   3.3  
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    32   4.3  
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    32   4.8  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...    32   5.4  
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    32   6.2  
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    32   7.8  

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score = 1576 bits (4081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 760/775 (98%), Positives = 760/775 (98%)

Query: 1   MTSSQALEPPSEDVPMGDAEDAEMEHEGDYSTADQTPLSMTPALSSNPNASKVKKPDPHA 60
           MTSSQALEPPSEDVPMGDAEDAEMEHEGDYSTADQTPLSMTPALSSNPNASKVKKPDPHA
Sbjct: 1   MTSSQALEPPSEDVPMGDAEDAEMEHEGDYSTADQTPLSMTPALSSNPNASKVKKPDPHA 60

Query: 61  KQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYS 120
           KQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYS
Sbjct: 61  KQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYS 120

Query: 121 SDYLKRDDQIFAMRERKSLRNANANQATPDMPEDDDQESVDGESDAQTIVIHPGSRNLKI 180
           SDYLKRDDQIFAMRERKSLRNANANQATPDMPEDDDQESVDGESDAQTIVIHPGSRNLKI
Sbjct: 121 SDYLKRDDQIFAMRERKSLRNANANQATPDMPEDDDQESVDGESDAQTIVIHPGSRNLKI 180

Query: 181 GLATEVLPQSIPCCVAVPKRPRTSDSTPEPQVDEEEYISAKESIQQDFKERMRYYKRKVI 240
           GLATEVLPQSIPCCVAVPKRPRTSDSTPEPQVDEEEYISAKESIQQDFKERMRYYKRKVI
Sbjct: 181 GLATEVLPQSIPCCVAVPKRPRTSDSTPEPQVDEEEYISAKESIQQDFKERMRYYKRKVI 240

Query: 241 PNSHDIAVNFNARVTPEAIPEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKG 300
           PNSHDIAVNFNARVTPEAIPEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKG
Sbjct: 241 PNSHDIAVNFNARVTPEAIPEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKG 300

Query: 301 RFNIESPDYGSLQELLVDVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETF 360
           RFNIESPDYGSLQELLVDVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETF
Sbjct: 301 RFNIESPDYGSLQELLVDVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETF 360

Query: 361 IRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITL 420
           IRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITL
Sbjct: 361 IRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITL 420

Query: 421 DYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIK 480
           DYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIK
Sbjct: 421 DYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIK 480

Query: 481 RIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCK 540
           RIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCK
Sbjct: 481 RIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCK 540

Query: 541 DNNPKSVSQLACQKKTTYCDMHRDLDILQKLLNLPSEIEEYQSSTCANLEPAYTPLEKAI 600
           DNNPKSVSQLACQKKTTYCDMHRDLDILQKLLNLPSEIEEYQSSTCANLEPAYTPLEKAI
Sbjct: 541 DNNPKSVSQLACQKKTTYCDMHRDLDILQKLLNLPSEIEEYQSSTCANLEPAYTPLEKAI 600

Query: 601 VESITNACVSLDNNHSKAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPT 660
           VESITNACVSLDNNHSKAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPT
Sbjct: 601 VESITNACVSLDNNHSKAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPT 660

Query: 661 FQNQVSKQVKEFEQTQKLSEIXXXXXXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFP 720
           FQNQVSKQVKEFEQTQKLSEI               TIKVELQSYWEGVDALGGNESVFP
Sbjct: 661 FQNQVSKQVKEFEQTQKLSEIKDEEELAAQKKKLAKTIKVELQSYWEGVDALGGNESVFP 720

Query: 721 ANVLPAPREMDPALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775
           ANVLPAPREMDPALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY
Sbjct: 721 ANVLPAPREMDPALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775

>Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141C
           (ARP8) - actin-related protein [contig 130] FULL
          Length = 775

 Score = 1348 bits (3490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/775 (84%), Positives = 698/775 (90%)

Query: 1   MTSSQALEPPSEDVPMGDAEDAEMEHEGDYSTADQTPLSMTPALSSNPNASKVKKPDPHA 60
           MTSS A EP SED+PMGD E+ E+EHEGDYSTADQTP+SMTPALSS+ NASKVKKPDP  
Sbjct: 1   MTSSLAQEPASEDMPMGDVEEEEIEHEGDYSTADQTPMSMTPALSSHSNASKVKKPDPQV 60

Query: 61  KQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYS 120
           KQ TKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYS
Sbjct: 61  KQNTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYS 120

Query: 121 SDYLKRDDQIFAMRERKSLRNANANQATPDMPEDDDQESVDGESDAQTIVIHPGSRNLKI 180
           SDYLKRDDQIFAMRERKSLRNA A+Q+TPDMP+DDDQESVDG+S+  TIVIHPGS++LKI
Sbjct: 121 SDYLKRDDQIFAMRERKSLRNATASQSTPDMPDDDDQESVDGDSELNTIVIHPGSKSLKI 180

Query: 181 GLATEVLPQSIPCCVAVPKRPRTSDSTPEPQVDEEEYISAKESIQQDFKERMRYYKRKVI 240
           G AT+VLPQSIP CVAVPKR ++     +   D EEY   K+SIQQDFKERMRYYKRK+I
Sbjct: 181 GFATDVLPQSIPSCVAVPKRSQSLQGETKQPHDTEEYQETKDSIQQDFKERMRYYKRKII 240

Query: 241 PNSHDIAVNFNARVTPEAIPEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKG 300
           PNSHDI VNFN+RV+PE IPEHNDLHR+DWI   S+ YYGK+ATRCLPSHFTVRHPFWKG
Sbjct: 241 PNSHDIVVNFNSRVSPEIIPEHNDLHRIDWIDQPSRPYYGKEATRCLPSHFTVRHPFWKG 300

Query: 301 RFNIESPDYGSLQELLVDVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETF 360
           RFNIESPDY SLQELL DV ELLKFALSQPKIDV+PSQI NYKVVIVVPD +DKAYVETF
Sbjct: 301 RFNIESPDYSSLQELLNDVCELLKFALSQPKIDVKPSQISNYKVVIVVPDLYDKAYVETF 360

Query: 361 IRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITL 420
           IRLL+ DL FQAVA+IQESLASCYGAGIG+STCVVDIGATTTKIACVDEGLV +NS+I L
Sbjct: 361 IRLLLVDLNFQAVAIIQESLASCYGAGIGESTCVVDIGATTTKIACVDEGLVNENSIINL 420

Query: 421 DYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIK 480
           DYGGDDIT+LFA+FLLESNFPYQDLDL+SP+GWSL+EQLKEKY TFQDADVTIQLYNFIK
Sbjct: 421 DYGGDDITRLFARFLLESNFPYQDLDLDSPQGWSLVEQLKEKYTTFQDADVTIQLYNFIK 480

Query: 481 RIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCK 540
           RIP KPGAEKFEFKVFDEVMTAPMGLFFPH+  LLK++N P N+YV SQLPRSKDMFTCK
Sbjct: 481 RIPGKPGAEKFEFKVFDEVMTAPMGLFFPHVFPLLKEQNNPTNEYVKSQLPRSKDMFTCK 540

Query: 541 DNNPKSVSQLACQKKTTYCDMHRDLDILQKLLNLPSEIEEYQSSTCANLEPAYTPLEKAI 600
           DNN KSVSQLACQKK TYCDM RDLDILQKLLNLPSEIEEYQS+  AN+EPAYT LEKAI
Sbjct: 541 DNNLKSVSQLACQKKNTYCDMGRDLDILQKLLNLPSEIEEYQSAASANVEPAYTALEKAI 600

Query: 601 VESITNACVSLDNNHSKAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPT 660
           +ESITNACVSLDNNH+KAA FYSNILVVGGSSKF SLDFILTDRINIWRPRLLSVNTLPT
Sbjct: 601 IESITNACVSLDNNHAKAAQFYSNILVVGGSSKFPSLDFILTDRINIWRPRLLSVNTLPT 660

Query: 661 FQNQVSKQVKEFEQTQKLSEIXXXXXXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFP 720
           F NQVSKQVKEFEQT KLSEI               TIK+ELQSYWEGVDALGGNESVFP
Sbjct: 661 FHNQVSKQVKEFEQTNKLSEIKEEEELLSQKKKLAKTIKMELQSYWEGVDALGGNESVFP 720

Query: 721 ANVLPAPREMDPALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775
            NVLPAPREMDPALLTWKGGSVFARLKLIEELYVS +DWD+L SRILQYKCIFDY
Sbjct: 721 INVLPAPREMDPALLTWKGGSVFARLKLIEELYVSANDWDVLNSRILQYKCIFDY 775

>SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 794

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/783 (62%), Positives = 591/783 (75%), Gaps = 23/783 (2%)

Query: 12  EDVPMGDAEDAEMEHEGDYSTADQTPLSMTPALSSNPNASKVKKPDPHAKQQTKVPGHLL 71
           ED  +  A D   E  G  +  + TPLSMTP   +   + KVKKPD H     KVP HLL
Sbjct: 16  EDPALPGALDEYDEEVGVSTGENGTPLSMTPVPPAT--SGKVKKPDTHIPPGKKVPMHLL 73

Query: 72  EKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYLKRDDQIF 131
           EKRRLGR KAAE++A+K+KTIGIEKRDN  L Q GLFKPL LINQKNYSSDYLK+DDQIF
Sbjct: 74  EKRRLGRIKAAEEFAKKLKTIGIEKRDNSALQQTGLFKPLLLINQKNYSSDYLKKDDQIF 133

Query: 132 AMRERKSLRN---------------ANAN-QATPDMPEDDDQESVDGESDAQTIVIHPGS 175
           AMRERKSLRN               +NA  +  P+  ++DD +  +G  D  TIVIHPGS
Sbjct: 134 AMRERKSLRNPNSGNGNGNTGNNAVSNATPEVIPEEEDNDDNDDAEGTDDLNTIVIHPGS 193

Query: 176 RNLKIGLATEVLPQSIPCCVAVPKRPRTSDSTPEPQVDE-EEYISAKESIQQDFKERMRY 234
           + LKIG AT+VLPQS+P C+A+P+   T +S   PQ+ E  E+   K +IQQDFKERMRY
Sbjct: 194 KFLKIGFATDVLPQSVPSCIAIPRA--TKNSVRSPQIREPSEFDGLKSAIQQDFKERMRY 251

Query: 235 YKRKVIPNSHDIAVNFNARVTPEAIPEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTVR 294
           YKRKVIPN+HD  +NFN++V PE I EHNDLHRV+WIQ+ S  +YG++ATRCLPSHFT+R
Sbjct: 252 YKRKVIPNAHDAVINFNSKVEPELIHEHNDLHRVEWIQNGSNQFYGEEATRCLPSHFTLR 311

Query: 295 HPFWKGRFNIESPDYGSLQELLVDVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDK 354
           +PF +G FN+ESP Y S QELL DV  LL++ L Q KIDV   Q  NYK+V+V+PD +DK
Sbjct: 312 YPFARGSFNVESPYYMSFQELLGDVQSLLEYCLKQEKIDVTKQQFANYKIVLVIPDLYDK 371

Query: 355 AYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVID 414
            YVETFI LL+  + FQAVA+IQESLA+ YGAGI +STCVVDIGAT+TKIACVDEG V+ 
Sbjct: 372 NYVETFIHLLLVQMGFQAVAIIQESLATTYGAGISNSTCVVDIGATSTKIACVDEGTVLG 431

Query: 415 NSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQ 474
           NS +TLDYGGDDIT+LF++FLL+S FPY D DL++P GW L E LK+++ TFQDA+V +Q
Sbjct: 432 NSAVTLDYGGDDITRLFSQFLLQSKFPYDDWDLSTPHGWMLAESLKKEFTTFQDANVAVQ 491

Query: 475 LYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSK 534
           LYNFIKR P +  A+K+EFKVFDEVM APM +FFP IL LL  +      YVT+Q PRSK
Sbjct: 492 LYNFIKRTPGEANAQKYEFKVFDEVMLAPMAMFFPKILSLLNPQKTQQEHYVTNQFPRSK 551

Query: 535 DMFTCKDNNPKSVSQLACQKKTTYCDMHRDLDILQKLLNLPSEIEEYQSSTCA--NLEPA 592
           D++T +DNNP+S+SQ  C +  TYCDM RDLDILQK+LNLP EI+EY +S  +  +    
Sbjct: 552 DIYTLRDNNPRSISQRECHENKTYCDMTRDLDILQKILNLPDEIDEYSNSNLSKKHHHDN 611

Query: 593 YTPLEKAIVESITNACVSLDNNHSKAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRL 652
            TPLEKAIVESITNA +SLDNN S+  NFYSN+LVVGG SKF SLDFILTDRINIWRPRL
Sbjct: 612 ITPLEKAIVESITNASISLDNNMSRLGNFYSNLLVVGGGSKFPSLDFILTDRINIWRPRL 671

Query: 653 LSVNTLPTFQNQVSKQVKEFEQTQKLSEIXXXXXXXXXXXXXXXTIKVELQSYWEGVDAL 712
           LSVNT+ TF  +V++Q+K+FEQ  K+SE+                +K+ELQSYWE VDAL
Sbjct: 672 LSVNTISTFYKKVTQQIKDFEQENKVSEVTDPEQLATLKKKLLKMVKLELQSYWESVDAL 731

Query: 713 GGNESVFPANVLPAPREMDPALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCI 772
           GGNE+VFP NVLP PR+MDPA+LTWKGGSV AR+KL+EELY++  DWD+LGSRILQYKCI
Sbjct: 732 GGNENVFPINVLPPPRDMDPAVLTWKGGSVLARIKLVEELYITAKDWDVLGSRILQYKCI 791

Query: 773 FDY 775
           FDY
Sbjct: 792 FDY 794

>AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR141C (ARP8)
          Length = 791

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/786 (54%), Positives = 550/786 (69%), Gaps = 45/786 (5%)

Query: 20  EDAEMEHEGDYSTADQTPLSMTPALSSNPNASKVKKPD---PHAKQQTKVPGHLLEKRRL 76
           ++ EM  E D S  D  P +            KV KP+     A Q  KVP HLLEKRRL
Sbjct: 21  DEREMSVEMDVSIMDPIPTT----------EGKVSKPETAGAAAGQGKKVPQHLLEKRRL 70

Query: 77  GRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRER 136
           GR KAAE++A+K+K IGIEK+DN  + Q GLF+PL LINQKNYSSDYL++DDQIF+MRER
Sbjct: 71  GRIKAAEEFARKLKKIGIEKQDNLHISQTGLFRPLPLINQKNYSSDYLRKDDQIFSMRER 130

Query: 137 KSLRNANANQATPDMP--------EDD-----DQESVDGESDAQTIVIHPGSRNLKIGLA 183
           KSLR+ N N      P        EDD     D++ +D   DA TIVIHPGSR+LKIGL+
Sbjct: 131 KSLRSGNVNPVNSSQPPTLLAEAGEDDLKLNGDEDGIDDTEDANTIVIHPGSRSLKIGLS 190

Query: 184 TEVLPQSIPCCVAVPKRPRTSDSTPEPQVD-EEEYISAKESIQQDFKERMRYYKRKVIPN 242
           T+V P S+P CVAV +R  +    P+ + D +E+++   + IQ DFKERMRYYKRK+IPN
Sbjct: 191 TDVFPLSVPSCVAVARRA-SQRLEPQQRYDKDEDFMEHLQQIQSDFKERMRYYKRKIIPN 249

Query: 243 SHDIAVNFNARVTPEAIPEHNDLHRVDWIQDA--SKCYYGKDATRCLPSHFTVRHPFWKG 300
           SH+  +++N+R  PE IPEHNDLHR++WI+DA     YYG+ A RCLP +F +R+PF  G
Sbjct: 250 SHEQVLSYNSRAQPEKIPEHNDLHRIEWIKDAPEGTIYYGEGAERCLPENFVIRYPFSNG 309

Query: 301 RFNIESPDYGSLQELLVDVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETF 360
            FN+E PDY SLQELL DV++L+ FALS+ K+ +  SQ PNYKV++++PD F+K YVE  
Sbjct: 310 AFNVECPDYSSLQELLNDVTKLITFALSETKLGISRSQFPNYKVILIIPDLFEKNYVEQM 369

Query: 361 IRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITL 420
           IRLL++++ FQAVA+IQESLA+CYGAG+ +STCV+DIGA+ TKI+CVDEG VI NS I L
Sbjct: 370 IRLLLSEMNFQAVALIQESLATCYGAGLSNSTCVIDIGASETKISCVDEGQVIQNSCIRL 429

Query: 421 DYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIK 480
            YGGDDIT+LF + LL+SNFPY D +LN+ +GW L EQLK+ + TFQDADV +QL+NF K
Sbjct: 430 SYGGDDITRLFVELLLQSNFPYPDWNLNTRQGWILAEQLKKTHITFQDADVAVQLFNFFK 489

Query: 481 RIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCK 540
           R P+ PGAEKFEFK+F+EVM +PM  F+P IL  LK      NKY+  QLP S+D +T K
Sbjct: 490 REPSVPGAEKFEFKLFNEVMISPMAYFYPQILSFLKPA-TSYNKYMAQQLPESRDPYTYK 548

Query: 541 DNNPKSVSQLACQKKTTYCDMHRDLDILQKLLNLPSEIEEYQSS-----------TCANL 589
            +NPKS++Q +      Y D+++DLDI++KL+++  E+E   S            T    
Sbjct: 549 PDNPKSIAQESAFTGKVYTDINKDLDIIRKLVSVNDEVEALTSGPSERTSGDTIKTNTRR 608

Query: 590 EPAYTPLEKAIVESITNACVSLDNNHSKAANFYSNILVVGGSSKFSSLDFILTDRINIWR 649
              YTPL+KAI+ES+T A V L +N SK  NFYSN+LV+GGSSK   LD ILTDRINIWR
Sbjct: 609 ASNYTPLDKAIIESVTTASVLLGDNMSKLVNFYSNLLVIGGSSKVPGLDLILTDRINIWR 668

Query: 650 PRLLSVNTLPTFQNQVSKQVKEFEQTQKLSEIXXXXXXXXXXXXXXXTIKVELQSYWEGV 709
           PRLLSV+TLP    +VS+ VK+ E   K +                 +IK+EL++YWE V
Sbjct: 669 PRLLSVSTLPVVYKKVSEMVKQVENEIKKNNPESEEEIAQSRKKLIKSIKIELENYWESV 728

Query: 710 DALGGNESVFPANVLPAPREMDPALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQY 769
           D     E V+P  VLP PREMDP++LTWKGGSVF R+KL EELY++  DW++LGSRIL+Y
Sbjct: 729 DPY---EHVYPIAVLPPPREMDPSMLTWKGGSVFGRIKLCEELYITAMDWEMLGSRILKY 785

Query: 770 KCIFDY 775
           KCIFDY
Sbjct: 786 KCIFDY 791

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/784 (54%), Positives = 557/784 (71%), Gaps = 41/784 (5%)

Query: 24  MEHEGDYSTADQTPLSMTPALSSNPNASKVKKPDPH---AKQQTKVPGHLLEKRRLGRQK 80
           M+ E + S      + +T A +      KV KP+     + Q  KVP HLLEKRRLGR K
Sbjct: 1   MDDEREMSVEMDVSMEVTAAATE----GKVTKPETGGVASTQSKKVPQHLLEKRRLGRIK 56

Query: 81  AAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLR 140
           AAE++A+K+K IGIEK+DN  + Q GLF+  SLINQKNYSSDYL++DDQIF+MRERK+LR
Sbjct: 57  AAEEFARKLKKIGIEKQDNIHISQTGLFRVHSLINQKNYSSDYLRKDDQIFSMRERKNLR 116

Query: 141 NANANQAT---------PDMPEDD-----DQESVDGESDAQTIVIHPGSRNLKIGLATEV 186
           + N N  T         PD+ +D+     D++ +D  +D  TIVIHPGSR+LKIGL+T+V
Sbjct: 117 SGNVNSITNSSQPLIALPDVQDDEVKTNGDEDGLDDTADTNTIVIHPGSRSLKIGLSTDV 176

Query: 187 LPQSIPCCVAVPKRPRTSDSTPEPQVD-EEEYISAKESIQQDFKERMRYYKRKVIPNSHD 245
            P SIP CVA+  R    +   +P+ D +EE++   + IQ DFKERMRYYKRK+IPNSH+
Sbjct: 177 FPLSIPSCVAIA-RSEQVEVPSQPRYDNDEEFMGNLQQIQSDFKERMRYYKRKIIPNSHE 235

Query: 246 IAVNFNARVTPEAIPEHNDLHRVDWIQ--DAS-KCYYGKDATRCLPSHFTVRHPFWKGRF 302
             +++N++  PE IPEHNDLHR++WI+  DAS K YYG+ A RCLP  F +R+PF  G F
Sbjct: 236 QVLSYNSKCQPEKIPEHNDLHRIEWIKKSDASTKVYYGEYAERCLPEGFLLRYPFANGSF 295

Query: 303 NIESPDYGSLQELLVDVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIR 362
           N++SP+Y SLQELL DV  L+ FALS+ K+++  SQ  +Y VV+++PD F+K+YVE  IR
Sbjct: 296 NVKSPNYNSLQELLNDVVNLITFALSETKLNISKSQFSSYNVVLIIPDLFEKSYVEQMIR 355

Query: 363 LLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDY 422
           LLI+++ FQAVA+IQESLASCYGAG+ +STCV+DIG + TKI+CVDEG VI NS I L Y
Sbjct: 356 LLISEMDFQAVALIQESLASCYGAGLSNSTCVIDIGGSETKISCVDEGQVIQNSCIKLSY 415

Query: 423 GGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRI 482
           GGDDITKLFA+ LL+SNFPY+D +LN+ +GW L EQLK+ + TFQDADV +QL+NF KR 
Sbjct: 416 GGDDITKLFAELLLQSNFPYEDWNLNTRQGWLLAEQLKKNHITFQDADVAVQLFNFFKRN 475

Query: 483 PNKPGAEKFEFKVFDEVMTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCKDN 542
           PN  GAEK+EFK+F+EVM +PM  F+P IL LLK   V VNKYV  QLP S+D +TCK +
Sbjct: 476 PNISGAEKYEFKLFNEVMVSPMAYFYPQILALLKPP-VEVNKYVQQQLPPSRDPYTCKPD 534

Query: 543 NPKSVSQLACQKKTTYCDMHRDLDILQKLLNLPSEIEEYQSST---------CANLEPA- 592
           +P+SVS L       Y +M +DLDI++KL+++  ++E   +++           N E   
Sbjct: 535 DPQSVSNLGSLSGKWYTEMSKDLDIVRKLISITDKVEALSANSSDGTASDTIVENTEEVS 594

Query: 593 -YTPLEKAIVESITNACVSLDNNHSKAANFYSNILVVGGSSKFSSLDFILTDRINIWRPR 651
            Y PL+KAI+ES+TNA V L +N SK  NFYSN+L+VGGSSK   LD ILTDRINIWRPR
Sbjct: 595 NYMPLDKAIIESVTNAAVLLGDNMSKLTNFYSNLLIVGGSSKVPGLDLILTDRINIWRPR 654

Query: 652 LLSVNTLPTFQNQVSKQVKEFEQTQKLSEIXXXXXXXXXXXXXXXTIKVELQSYWEGVDA 711
           LLSV+TLP    ++S  VK+ E   K + +               +IK+EL++YWE VD 
Sbjct: 655 LLSVSTLPVIYKKISDMVKQVESEIKKNNVESEEEIQQSRKKLIKSIKIELENYWESVDP 714

Query: 712 LGGNESVFPANVLPAPREMDPALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
               E V+P  VLP PREMDP++LTWKGGSVF R+KL EELY++E DW++LGSRIL+YKC
Sbjct: 715 Y---EHVYPITVLPPPREMDPSMLTWKGGSVFGRIKLCEELYITEMDWEMLGSRILKYKC 771

Query: 772 IFDY 775
           IFDY
Sbjct: 772 IFDY 775

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/745 (49%), Positives = 499/745 (66%), Gaps = 32/745 (4%)

Query: 58  PHAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQK 117
           P   +  KVP HLLEKRRLGR KAAE +A K+K  GIE+ DN  L Q GLF  + L+NQK
Sbjct: 137 PSTTENKKVPRHLLEKRRLGRLKAAEAFAAKLKKTGIERVDNSHLQQTGLFGQMLLVNQK 196

Query: 118 NYSSDYLKRDDQIFAMRERKSLRNANANQATPDMPEDDDQESVDGESDAQ---------- 167
           N SSDYLK+DDQ+FA+RERK+LRN      T + P+  D ++++  S A           
Sbjct: 197 NCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPDVVDLKALNNGSSASLVDEVLNKND 256

Query: 168 ----------TIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTSDSTPEPQVDE--- 214
                     TIVIHPGSR LKIG A +  P  +P CVA+PK    S++  E  +D+   
Sbjct: 257 DDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLYSENVRELSIDKIED 316

Query: 215 -EEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLHRVDWIQD 273
            E  +  K  +QQ F+ERMRYYKRK+ PNSH+    FN +  PE + + ND  R++WI +
Sbjct: 317 SERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWINN 376

Query: 274 ASKCYYGKDATRCLPSHFTVRHPFWKG-RFNIESPDYGSLQELLVDVSELLKFALSQPKI 332
           + K Y+G++A RC   +F +R+PF KG   N++SP Y SL ELL DV+ L ++AL++   
Sbjct: 377 SDKIYFGEEAERCNKENFIIRYPFNKGGSLNLDSPYYSSLPELLSDVTRLFEYALTKRDE 436

Query: 333 DVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDST 392
            +  +QI   KV++V+PD F+K+++ET  R+L+ +++FQAVA++QESLA+CYGAGI  ++
Sbjct: 437 SITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTAS 496

Query: 393 CVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEG 452
           C+V+IGAT T IACVDEG V++NS+I LDYGGDDIT+LF  FLLE+NFP+QDLDL+S  G
Sbjct: 497 CIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHG 556

Query: 453 WSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512
           W+L EQLK+ YATF+DA++T+QLYNF+KRIP K  +EK+EFKVFDEV+ AP+ LF+P I 
Sbjct: 557 WTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKV-SEKYEFKVFDEVILAPLALFYPDIF 615

Query: 513 RLLKDKNVPVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHRDLDILQKLL 572
           + LK  +      +  QLP S+D++T   N+ +SVSQL C     Y     +LDI+ K+L
Sbjct: 616 QELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGNTNELDIITKVL 675

Query: 573 NLPSEIEEYQS--STCANLEPAYTPLEKAIVESITNACVSLDNNHSKAANFYSNILVVGG 630
           N+ S  EEY+   +T  +    Y PLEKAI++SITNACVS+D   SK   FY+NI+VVGG
Sbjct: 676 NINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVSMD--VSKMNQFYANIMVVGG 733

Query: 631 SSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLSEIXXXXXXXXX 690
           +S    LDF+LTDRINIWRP+ L   T P F   +SKQVKE + T K S           
Sbjct: 734 TSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKAS--TTPEEEEKI 791

Query: 691 XXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALLTWKGGSVFARLKLIE 750
                  I+ EL+ Y   +++ G  +  +P  VLP PR+M+P +L WKG SV A++KLIE
Sbjct: 792 KQSIKELIETELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGASVLAQIKLIE 851

Query: 751 ELYVSESDWDILGSRILQYKCIFDY 775
           EL+V+ +DWD+LGSRILQYKC+F Y
Sbjct: 852 ELFVTNTDWDMLGSRILQYKCLFTY 876

>TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {ON}
           Anc_5.477 YOR141C
          Length = 837

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/754 (50%), Positives = 505/754 (66%), Gaps = 31/754 (4%)

Query: 46  SNPNASKVKKPDP-HAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQ 104
           S   A K  + DP  A    KVP HLLEKRRLGR KAAE++A+K+K IGIEK ++  L  
Sbjct: 91  SQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPA 150

Query: 105 LGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRN----------------ANANQAT 148
            GLF+P+ LINQKNYSSDYLK+D+QIFA+RERK+LRN                 N N   
Sbjct: 151 TGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNNTQTSSINNTPDVIDIKNTNTEV 210

Query: 149 PDMPEDDDQESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTSDSTP 208
           PD     D E +D      T+VIHPGSR+L+IG A + +P  +P CVA+PK     +   
Sbjct: 211 PDYIAAAD-EDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDEFQE 269

Query: 209 EPQVDE--EEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLH 266
            P   E  EE+   K +IQ  F+ERMRYYKRKV  N+H+  V++N    P+ I + ND  
Sbjct: 270 APLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQNDPG 329

Query: 267 RVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKG-RFNIESPDYGSLQELLVDVSELLKF 325
            ++WI+ +SK YYG +A +C    F +R PF KG  FN+ SPDY SLQ+L+ DV  LL+ 
Sbjct: 330 AINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVISLLEH 389

Query: 326 ALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYG 385
           ALS   +++  +Q   YKVV+V+PD F K++VETFIR L+T+++FQAVA+IQESLA CYG
Sbjct: 390 ALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYG 449

Query: 386 AGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDL 445
           AG   STCVV+IGAT T IAC+DEG V++NS+++LDYGGDD+TKLFA FLL+S FPYQD 
Sbjct: 450 AGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDW 509

Query: 446 DLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMG 505
           D+NS  GW L E+LK+KY TFQDA+V +QLYNFIKR+P++  +E++EFKVFDEV  AP+ 
Sbjct: 510 DINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQ-QSEQYEFKVFDEVSLAPLA 568

Query: 506 LFFPHILRLLKDKNV--PVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHR 563
           LF+P I+  L  K+     N  V SQLP S+D+FT   N+ +S+SQ  C     Y   + 
Sbjct: 569 LFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSGNNN 628

Query: 564 DLDILQKLLNLPSEIEEYQSS--TCANLEPAYTPLEKAIVESITNACVSLDNNHSKAANF 621
           +  I+ KLL+L +  +++QS     A+    YTPLEKAI++SITNA   +D   +K ++F
Sbjct: 629 NQLIMSKLLDLQTSFDDFQSKPPMEADSRKNYTPLEKAIIQSITNASTPIDV--AKMSSF 686

Query: 622 YSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLSEI 681
           YSNILVVGG SK  +LDFILTDRINIWRPRLLS+ + P F  +++KQ K+ +   K  E 
Sbjct: 687 YSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKTAGKTGE- 745

Query: 682 XXXXXXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALLTWKGGS 741
                           I  ELQ+YW+ ++A  G+E + P NVLP PR+MD A L WKG  
Sbjct: 746 --SEEEDQSSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGAC 803

Query: 742 VFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775
           V A++KL+EELY++ +DWDI GSRILQYKC+F Y
Sbjct: 804 VLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837

>KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 788

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/750 (49%), Positives = 504/750 (67%), Gaps = 42/750 (5%)

Query: 65  KVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYL 124
           KVP HLLEKRRLGR KAAE++A+K+K IGIE+++N  + Q    KP+S+INQKNYSS+YL
Sbjct: 39  KVPQHLLEKRRLGRIKAAEEFAKKLKIIGIERQENEHIAQPITLKPVSVINQKNYSSNYL 98

Query: 125 KRDDQIFAMRERKSLRNAN----------ANQATPDMPEDDDQESVDGESDA-QTIVIHP 173
           K DDQIF MRERK LR             A   TP + +D+  +S   E D   +I+IHP
Sbjct: 99  KNDDQIFYMRERKHLRQQGQTGGSSSAPAAGIGTPALDDDNMADSNAIEDDELDSIIIHP 158

Query: 174 GSRNLKIGLATEVLPQSIPCCVAVPKRPRTSDSTPEPQVDEEEYISAKESIQQDFKERMR 233
           GS  +KIG   ++ PQ +P  VAVP    T  S  E   + E +   K+ IQ DFKERMR
Sbjct: 159 GSSFIKIGPNYDIFPQQVPNLVAVPTHGGTVPSPQEDISNNEIFQQLKDDIQFDFKERMR 218

Query: 234 YYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTV 293
           YYKR+++PNS + A  FNA+  PE +P+ ND  R++WI+D SK YYG DAT+CLPS F +
Sbjct: 219 YYKRRIMPNSTEQAAAFNAKSDPELVPDLNDFGRIEWIKDRSKSYYGHDATQCLPSDFKL 278

Query: 294 RHPFWKGRFNIESPDYGSLQELLVDVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFD 353
           R PF  G FN+  P+Y S QE+L DV +L+  +L+  KI +  +Q  NY+VV++VPD FD
Sbjct: 279 RSPFLNGSFNLNEPNYNSFQEILFDVEQLIVQSLAMEKIGIERNQFSNYRVVLIVPDLFD 338

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K +VE+ I LL+ +L FQ++A+IQESLASCYGAG+ +STCV+DIGA  TKIACVD+G+V+
Sbjct: 339 KTFVESMIHLLLIELDFQSIALIQESLASCYGAGLSNSTCVIDIGAKQTKIACVDDGVVV 398

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTI 473
            NS + L+YGGDDIT+LFA  LL++ FPY D ++N P GW+L E LK++  TFQDAD+ I
Sbjct: 399 KNSALRLNYGGDDITRLFAHMLLQNKFPYADWNINEPNGWTLAETLKKQCITFQDADIAI 458

Query: 474 QLYNFIKRIP---NKPGAEKFEFKVFDEVMTAPMGLFFPHILRLLKDKNVPVNKYVTSQL 530
           QLY+FIKR P       + K+E+K+FDEVM APMG+FFP I  ++K K    N+YV  Q 
Sbjct: 459 QLYSFIKRDPYARKYTQSHKYEYKLFDEVMCAPMGIFFPDIFEVIKPKQHKPNEYVIRQC 518

Query: 531 PRSKDMFTCKDNNPKSVSQLACQKKTT--YCDMHRDLDILQKLL---------------- 572
           PRSKD++T K N+ KS++Q+ C ++ T  Y ++ RD+DI+QKLL                
Sbjct: 519 PRSKDIYTLKPNDTKSLTQMLCIQEPTKWYSNLSRDIDIVQKLLNLDTDDLDEQNDDESA 578

Query: 573 ------NLPSEIEEYQSSTCANLEPAYTPLEKAIVESITNACVSLDNNHSKAANFYSNIL 626
                  +  EIE+       NL     PLEKAI+ESITNA + L +N SK    YSNIL
Sbjct: 579 GSKEETQINDEIEDINLRQYNNLS---MPLEKAIIESITNASMLLGDNMSKLNVLYSNIL 635

Query: 627 VVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLS-EIXXXX 685
           +VGGSSK  +LDFILTDRINIWRP+LLS++ L T   ++ + +K +E   KL  E     
Sbjct: 636 IVGGSSKIPALDFILTDRINIWRPKLLSISALSTLMEKIGEVIKSYETDNKLDLEPTDPQ 695

Query: 686 XXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALLTWKGGSVFAR 745
                       IK E+++YW+ +  L  ++ + P N+LP P +MDP++LTWKGGSVF++
Sbjct: 696 AAIAYKKKLSKLIKAEIEAYWDSLQTLHSDDDLLPINILPPPHDMDPSMLTWKGGSVFSK 755

Query: 746 LKLIEELYVSESDWDILGSRILQYKCIFDY 775
           +KL+EEL +++ DW++LG+RILQYKCIF+Y
Sbjct: 756 IKLLEELNITKQDWNMLGNRILQYKCIFEY 785

>Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON}
           YOR141C (REAL)
          Length = 879

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/764 (49%), Positives = 508/764 (66%), Gaps = 38/764 (4%)

Query: 42  PALSSNPNASKVKKPDP-HAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNP 100
           P   ++    K  K DP  A    KVP HLLEKRRLGR KAAE++A+ +K IGIEK +  
Sbjct: 124 PTAQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEAT 183

Query: 101 LLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNANANQA----TPD------ 150
            L   GLF+PL LINQKNYSSDYLK+DDQIFA+R+RK LRN N  Q     TPD      
Sbjct: 184 TLPATGLFQPLLLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDVVDMKS 243

Query: 151 MPEDDD-----QESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKR----- 200
           +P  +       + +D      TIVIHPGS ++KIG   +  P  +P CVAVPK+     
Sbjct: 244 LPNSEPSTAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIVVPNCVAVPKKWLNLA 303

Query: 201 -PRTSDSTPEPQVDEEEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAI 259
             +   +    +   EE+ S K  ++++F+ERMRYYKRKV  N+H+  V+FN    PE +
Sbjct: 304 NDQNEGNISLQRKQSEEFESIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNESSKPEVV 363

Query: 260 PEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKGRFNIESPDYGSLQELLVDV 319
              ND   ++WI D SK YYG DA RC+   F +R PF  G FNI+SP Y SL EL+ DV
Sbjct: 364 SVKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFKGGCFNIDSPYYKSLAELISDV 423

Query: 320 SELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQES 379
            +LL++AL    ++V+P++   YKVV+V+PD F K++VETFIR+L+T+L+FQAVA+IQES
Sbjct: 424 IKLLEYALDSETLNVKPTKFNQYKVVLVIPDVFKKSHVETFIRVLLTELQFQAVAIIQES 483

Query: 380 LASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESN 439
           LA+CYGAGI  STCVV+IGAT T+IACVDEG V++NS +TLDYGGDDIT+LFA  LL+S+
Sbjct: 484 LATCYGAGISTSTCVVNIGATETRIACVDEGTVLENSAVTLDYGGDDITRLFALLLLQSD 543

Query: 440 FPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEV 499
           FP QD  +NS  GW L EQLK+ + TFQDAD+ +QLYNFI R PNKP  EK+EFK+FDEV
Sbjct: 544 FPLQDWKINSEHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNKP-TEKYEFKLFDEV 602

Query: 500 MTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYC 559
           M AP+ LFFP I +L++  +   N  +  QLP S+D+FT + N+  S+SQ   ++   YC
Sbjct: 603 MLAPLALFFPQIFKLIRAPSGK-NSSLEFQLPESRDLFTNELNDWNSLSQFESKEGDLYC 661

Query: 560 DMHRDLDILQKLLNLPSEI-------EEYQSSTCANLEPAYTPLEKAIVESITNACVSLD 612
           +++ DL IL K L+  + I       E+Y S++  NL    TPLEKAI++SITNA V+ D
Sbjct: 662 NLNDDLKILNKTLDAHTMIDQLQDKPEKYGSTSKENL----TPLEKAIIQSITNASVTAD 717

Query: 613 NNHSKAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEF 672
              ++ ++FYSNIL+VGGSSK  +LDFILTDRINIWRP LLS  + P F  +++K++K+ 
Sbjct: 718 --VTRMSSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSTSFPQFYKKLTKEIKDL 775

Query: 673 E-QTQKLSEIXXXXXXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREMD 731
           E       E                 +  EL    + ++   GNE +FP +++P PR+M+
Sbjct: 776 ESHFVSAPEKTEEENKQVLQLQINEKVVAELDEQHQSIEHQNGNEHLFPISIIPPPRDMN 835

Query: 732 PALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775
           PAL+ WKG SV A++KL+EEL+++ +DWD+ GSRILQYKCIF Y
Sbjct: 836 PALIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 879

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/760 (49%), Positives = 507/760 (66%), Gaps = 30/760 (3%)

Query: 42  PALSSNPNASKVKKPDP-HAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNP 100
           P   ++    K  K DP  A    KVP HLLEKRRLGR KAAE++A+ +K IGIEK +  
Sbjct: 118 PTAQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEAT 177

Query: 101 LLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNANANQA----TPD------ 150
            L   GLF+PL LINQKNYSSDYLK+DDQIFA+R+RK LRN N  Q     TPD      
Sbjct: 178 TLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDVIDLKN 237

Query: 151 MPEDDDQ-----ESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTSD 205
           +P  +       E +D      TIVIHPGS ++KIG   +  P  +P CVAVPK+    +
Sbjct: 238 LPHSEANTASLNEEIDLNDSTATIVIHPGSNSVKIGFPKDEHPVLVPNCVAVPKKWLNLE 297

Query: 206 STPEPQV------DEEEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAI 259
           S+   ++        E++ S K  ++++F+ERMRYYKRKV  N+H+  ++FN    PE I
Sbjct: 298 SSENDEIFSLQREQSEKFHSIKSDMEKNFRERMRYYKRKVPGNAHEQVISFNENSKPEII 357

Query: 260 PEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKGRFNIESPDYGSLQELLVDV 319
            E ND   + WI D SK YYG DA RC+   F +R PF  G FNI SP Y SL EL+ DV
Sbjct: 358 SEKNDPSPIKWIFDDSKLYYGSDALRCVDEKFIIRKPFKGGSFNINSPYYKSLAELISDV 417

Query: 320 SELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQES 379
           ++LL++AL    ++V+P++   YKVV+V+PD F K+++ETFIR+L+T+L+FQAVA+IQES
Sbjct: 418 TKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIETFIRVLLTELQFQAVAIIQES 477

Query: 380 LASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESN 439
           LA+CYGAGI  STCVV+IGA+ T+IACVDEG V+++S ITLDYGGDDIT+LF  FLL+S+
Sbjct: 478 LATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITLDYGGDDITRLFGLFLLQSD 537

Query: 440 FPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEV 499
           FP QD  +NS  GW L EQLK+ + TFQDADV +QLYNFI R PN+P  EK+EFK+FDEV
Sbjct: 538 FPLQDWKINSEHGWLLAEQLKKNFTTFQDADVAVQLYNFINRSPNQP-TEKYEFKLFDEV 596

Query: 500 MTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYC 559
           M AP+ LFFP I +L++  +   N  +  QLP S+D+FT + N+  S+SQ   ++   YC
Sbjct: 597 MLAPLALFFPQIFKLIRTSS-DKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYC 655

Query: 560 DMHRDLDILQKLLNLPSEIEEYQS--STCANL-EPAYTPLEKAIVESITNACVSLDNNHS 616
           ++  DL+IL+K+L   + I++ Q       N+ +  + PLEKAI++SI NA ++ D   +
Sbjct: 656 NLDDDLEILKKILQAHNMIDQLQDKPENYGNISKENFAPLEKAIIQSIANASITAD--VT 713

Query: 617 KAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFE-QT 675
           +  +FYSNIL+VGGSSK  +LDFILTDRINIWRP LLS  + P F  +++K++K+ E   
Sbjct: 714 RMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLESHF 773

Query: 676 QKLSEIXXXXXXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALL 735
               +                 +  EL    + ++   GNE VFP +++P PR+M+PAL+
Sbjct: 774 VNAPDKTEEENKLVLQRQIKEKVVEELDEQHQNIENQNGNEHVFPISIIPPPRDMNPALI 833

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775
            WKG SV A++KL+EEL+++ +DWD+ GSRILQYKCIF Y
Sbjct: 834 IWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 873

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/760 (49%), Positives = 512/760 (67%), Gaps = 30/760 (3%)

Query: 42  PALSSNPNASKVKKPDP-HAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNP 100
           PA+ ++    K  K DP  A    KVP HLLEKRRLGR KAAE++A+ +K IGIEK +  
Sbjct: 126 PAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETT 185

Query: 101 LLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNANANQA----TPD------ 150
            L   GLF+PL LINQKNYSSDYLK+DDQIFA+R+RK LRN N +Q     TPD      
Sbjct: 186 TLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTSQISSTNTPDVIDLKS 245

Query: 151 MPEDDD-----QESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTSD 205
           +P  +       + +D      TIVIHPGS ++KIG   +  P  +P CVAVPK+    +
Sbjct: 246 LPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLE 305

Query: 206 STPE------PQVDEEEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAI 259
           ++         +   EE+ + K  ++++F+ERMRYYKRKV  N+H+  V+FN    PE I
Sbjct: 306 NSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEII 365

Query: 260 PEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKGRFNIESPDYGSLQELLVDV 319
            E ND   ++WI D SK YYG DA RC+   F +R PF  G FN++SP Y SL EL+ DV
Sbjct: 366 SEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLAELISDV 425

Query: 320 SELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQES 379
           ++LL+ AL+   ++V+P++   YKVV+V+PD F K++VETFIR+L+T+L+FQAVA+IQES
Sbjct: 426 TKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQES 485

Query: 380 LASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESN 439
           LA+CYGAGI  STCVV+IGA  T+IACVDEG V+++S ITLDYGGDDIT+LFA FLL+S+
Sbjct: 486 LATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSD 545

Query: 440 FPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEV 499
           FP QD  ++S  GW L E+LK+ + TFQDADV +QLYNF+ R PN+P  EK+EFK+FDEV
Sbjct: 546 FPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQP-TEKYEFKLFDEV 604

Query: 500 MTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYC 559
           M AP+ LFFP I +L++  +   N  +  QLP S+D+FT + N+  S+SQ   ++   YC
Sbjct: 605 MLAPLALFFPQIFKLIRTSSHK-NSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYC 663

Query: 560 DMHRDLDILQKLL---NLPSEIEEYQSSTCANLEPAYTPLEKAIVESITNACVSLDNNHS 616
           D++ DL IL ++L   N+  ++++   +    L+  + PLEKAIV+SI NA ++ D   +
Sbjct: 664 DLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITAD--VT 721

Query: 617 KAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFE-QT 675
           +  +FYSNIL+VGGSSK  +LDFILTDRINIWRP LLS  + P F  +++K++K+ E   
Sbjct: 722 RMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGHY 781

Query: 676 QKLSEIXXXXXXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALL 735
               +                 I  EL+   + ++   GNE +FP +++P PR+M+PAL+
Sbjct: 782 VNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPALI 841

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775
            WKG SV A++KL+EEL+++ SDWD+ GSRILQYKCIF Y
Sbjct: 842 IWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881

>ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 868

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/758 (50%), Positives = 501/758 (66%), Gaps = 40/758 (5%)

Query: 52  KVKKPDP-HAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKP 110
           K  K DP  A    KVP HLLEKRRLGR KAAE++A+K+K IGIEK +   L   GLF+P
Sbjct: 117 KYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQP 176

Query: 111 LSLINQKNYSSDYLKRDDQIFAMRERKSLRN-------ANA---------NQATPDMPED 154
           + LINQKNYSSDYLK+D+Q+FA+R+RK LRN       AN          N  T ++ E 
Sbjct: 177 MILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTPDVADLKRENGNTTELNEA 236

Query: 155 DDQESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTSDSTPEPQVDE 214
              E +D      T+VIHPGS +LK+G A +  P  IP CVA+PK     +  P  Q ++
Sbjct: 237 AGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKS-ELHNQIPMDQKNQ 295

Query: 215 E--------EYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLH 266
                    E+   K  +Q  F+ERMR+YKRKV PN+H+  +NFN    PE I + ND +
Sbjct: 296 TCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDYN 355

Query: 267 RVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKG-RFNIESPDYGSLQELLVDVSELLKF 325
           R++WI    + YYG DA RC   HF +R+P  KG  FNI SPDY SLQ+L+ D + LL+ 
Sbjct: 356 RINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTGLLEH 415

Query: 326 ALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYG 385
            L  P+  ++ SQ   YKVV+V+PD F+K++VET IR LIT+++FQAVA++QESLA+CYG
Sbjct: 416 VLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYG 475

Query: 386 AGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDL 445
           AGI  STCVV+IGAT T+IACVDEG V+ +S ITLDYG DDITKLFA FLL+S FPYQD 
Sbjct: 476 AGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDW 535

Query: 446 DLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMG 505
           D+ +  GW L E+LK+ Y TFQDA+VT+QLYNFIKRIP +  AEKF+FKVFDEV+ AP+ 
Sbjct: 536 DIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQ-QAEKFDFKVFDEVILAPLS 594

Query: 506 LFFPHILRLLKDKNVPV--NKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHR 563
           LF+P I+  L+++  P   N+ + S+LP S+D+FT   ++ +S+SQ  C     YC    
Sbjct: 595 LFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQD 654

Query: 564 DLDILQKLLNLPSEIEEYQSSTCANLEP----AYTPLEKAIVESITNACVSLDNNHSKAA 619
           +  +L KLL+ PS ++E Q+     LEP     Y PLEKAIV+SITNAC+S D   SK +
Sbjct: 655 EFQMLCKLLDAPSRLDELQAEN--RLEPDIRQNYAPLEKAIVQSITNACLSFD--VSKMS 710

Query: 620 NFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLS 679
           +FYSNILV GG S   + DFILTDRINIWRPR+LS  + P    ++SKQ+K+ + + K  
Sbjct: 711 SFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNG 770

Query: 680 EIXXX--XXXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALLTW 737
           E                   IK EL+ Y E +++    +   P +VLP PR++DPA+L W
Sbjct: 771 EGKSNGPQEDEQLKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIW 830

Query: 738 KGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775
           KG SV A++KL+EELY++ +DWDI GSRILQYKCIF Y
Sbjct: 831 KGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868

>NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {ON}
           Anc_5.477 YOR141C
          Length = 863

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/772 (47%), Positives = 507/772 (65%), Gaps = 38/772 (4%)

Query: 39  SMTPALSSNPNASKVKKPDPHAKQ--------QTKVPGHLLEKRRLGRQKAAEQYAQKMK 90
           ++TP  S+N   +K + P    ++          KVP HLLEKRRLGR KAA+++A+K+K
Sbjct: 95  TLTPMGSANGKTTKEEGPQKKVQKVEPNKVPLGKKVPLHLLEKRRLGRIKAAKEFAKKLK 154

Query: 91  TIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLR-NANANQATP 149
            IGIEK ++  +   G+F+PL LINQKNYSSDYL++D+QIFA+RERK+LR N   N ++ 
Sbjct: 155 EIGIEKVESVPVPMTGMFQPLLLINQKNYSSDYLRKDEQIFALRERKTLRSNTTQNISSS 214

Query: 150 DMPEDDDQESV---------DGESDA-------QTIVIHPGSRNLKIGLATEVLPQSIPC 193
           + PE  D +SV         +G +D         TIVIHPGS  LK+G A + +P+ IP 
Sbjct: 215 NTPEVTDLQSVRETSNFTTANGNNDEILLNDPNTTIVIHPGSSFLKVGFALDEVPELIPN 274

Query: 194 CVAVPKRPRT------SDSTPEPQVDEEEYISAKESIQQDFKERMRYYKRKVIPNSHDIA 247
           CVA+PK          S  T     D E++ S K  +++ F+ERMRYYKR++ PN HD  
Sbjct: 275 CVALPKTDFNNTNIIKSKQTSVNIEDNEKFESLKAEMEESFEERMRYYKRRIQPNGHDQV 334

Query: 248 VNFNARVTPEAIPEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKG-RFNIES 306
           V+FN    PE++P  ND   +DWI D +K +YG DA RC   +F  R+PF KG  FN  S
Sbjct: 335 VSFNRLSKPESLPVQNDPAHIDWITDGTKRFYGDDALRCTDENFIKRYPFKKGGSFNTSS 394

Query: 307 PDYGSLQELLVDVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLIT 366
             Y SLQ+LL DV  L++  LS  K +++ SQ   YKVV+V+PD+F+K++VE FIRLL+T
Sbjct: 395 NSYKSLQDLLSDVVGLIEGTLSSDKFNIKSSQFSQYKVVLVIPDSFEKSHVELFIRLLVT 454

Query: 367 DLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDD 426
           +L+FQAVA+IQESL+ CYG+G+G STCVV++G+  T +ACVDEG+V+DNS+ITLDYG +D
Sbjct: 455 ELQFQAVAIIQESLSVCYGSGLGGSTCVVNVGSKETTVACVDEGIVLDNSLITLDYGSND 514

Query: 427 ITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKP 486
           +TKLFAKFLL+ +FPY++ DLNS EGW L E+L ++  TFQDAD+T+QL NFIKR P   
Sbjct: 515 VTKLFAKFLLDCDFPYKNWDLNSTEGWRLAEELMKQCVTFQDADITVQLSNFIKRTPRGN 574

Query: 487 GAEKFEFKVFDEVMTAPMGLFFPHILRLLKDK-NVPVNKYVTSQLPRSKDMFTCKDNNPK 545
             EK +FKVF+EVM AP+ LF+P I +LL+ K +   N  +  QLP S+D+FT K N+ +
Sbjct: 575 TVEKLDFKVFEEVMLAPLALFYPEIFKLLRSKESEEQNAELEYQLPPSRDIFTDKINDWR 634

Query: 546 SVSQLACQKKTTYCDMHRDLDILQKLLNLPSEIEEYQSSTCANLEPA--YTPLEKAIVES 603
           S+SQ  C    T+CD+H + ++L+K ++ P+ +E +  +     +    +TPL+KAIVES
Sbjct: 635 SLSQNDCINHQTFCDIHDEYELLKKAVDCPNTLETFMDNPPEEKKSTFNFTPLDKAIVES 694

Query: 604 ITNACVSLDNNHSKAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQN 663
           IT A + LD   SK A FYSNILVVGG SK    D +L DR+NIWRPRLLS+     F  
Sbjct: 695 ITTASLGLD--VSKMATFYSNILVVGGGSKIPGFDLMLMDRVNIWRPRLLSLRAFTHFYR 752

Query: 664 QVSKQVKEFEQTQKLSEIXXXXXXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANV 723
           +++KQ+KE  Q+ K  +                 IK EL  Y E ++   GNE   P  V
Sbjct: 753 ELTKQLKEL-QSLKTGDGEEEIKEDELNEKISELIKTELTKYLEVIEQQSGNEHFLPVEV 811

Query: 724 LPAPREMDPALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775
           +P+P E+DP  + WKG SV A++KL+EEL+++  DWD+ G+RILQYK I  Y
Sbjct: 812 IPSPNEIDPGSIAWKGASVLAQIKLVEELFITNGDWDVHGNRILQYKSILTY 863

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/765 (48%), Positives = 505/765 (66%), Gaps = 40/765 (5%)

Query: 42  PALSSNPNASKVKKPDP-HAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNP 100
           P + ++    K  K DP  A    KVP HLLEKRRLGR KAAE++A+ +K IGIEK +  
Sbjct: 128 PGVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEAT 187

Query: 101 LLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNANANQA----TPDM----- 151
            L   GLF+PL LINQKNYSSDYLK+DDQIFA+R+RK LRN N  Q     TPD+     
Sbjct: 188 TLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDVVDLKN 247

Query: 152 ---------PEDDDQESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPR 202
                    P +D+   +D      TIVIHPGS ++KIG   +  P  +P CVAVPK+  
Sbjct: 248 LSHTEPSTAPLNDE---IDLNDPTATIVIHPGSNSIKIGFPKDEHPIIVPNCVAVPKKWL 304

Query: 203 TSDSTP--------EPQVDEEEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARV 254
              + P          Q DE E I  K  ++++F+ERMRYYKRKV  N+H+  V+FN   
Sbjct: 305 NLGNGPNEDNISLQREQSDEFENI--KSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENS 362

Query: 255 TPEAIPEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKGRFNIESPDYGSLQE 314
            PE I E ND   ++WI D SK YYG DA RC+   F VR PF  G FNI SP Y SL E
Sbjct: 363 KPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVVRKPFQGGSFNINSPYYESLAE 422

Query: 315 LLVDVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVA 374
           L+ DV++LL++AL+   ++V+ ++   YKVV+V+PD F K +VETFIR+L+T+L+FQAVA
Sbjct: 423 LISDVTKLLEYALASETLNVKSTKFNQYKVVLVIPDVFKKNHVETFIRVLLTELQFQAVA 482

Query: 375 VIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKF 434
           VIQESLA+CYGAGI  STCVV+IGAT T+IACVDEG V+++S +TL+YGGDDIT+LFA  
Sbjct: 483 VIQESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLEHSAVTLNYGGDDITRLFALL 542

Query: 435 LLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFK 494
           LL+S+FP QD  +++  GW L EQLK+ + TFQDAD+ +QLYNFI R PN+P +EK+EFK
Sbjct: 543 LLQSDFPLQDWKIDTKHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNQP-SEKYEFK 601

Query: 495 VFDEVMTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQK 554
           +FDEVM AP+ LFFP I +L++  +   N  +  QLP S+D+FT + N+  S+SQ   ++
Sbjct: 602 LFDEVMLAPLALFFPQIFKLIRSSSGK-NSNLEFQLPESRDLFTNELNDWNSLSQFESKE 660

Query: 555 KTTYCDMHRDLDILQKLLNLPSEIEEYQ---SSTCANLEPAYTPLEKAIVESITNACVSL 611
              Y +++ DL IL K+L   + I++ Q    +     +  + PLEKAI++SI NA ++ 
Sbjct: 661 GDLYSNLNDDLKILNKILEAHTIIDQIQDKPENYGDTSKENFAPLEKAIIQSIANASITA 720

Query: 612 DNNHSKAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKE 671
           D   ++  +FYSNIL+VGG+SK  +LDFILTDRINIWRP LLS  + P F  +++K++K+
Sbjct: 721 D--VTRMNSFYSNILIVGGTSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKD 778

Query: 672 FE-QTQKLSEIXXXXXXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREM 730
            E       +                 +  EL    + ++   GNE +FP +++P PR+M
Sbjct: 779 LESHFVNAPDKTEEENKQVMQSQIKDKVVAELDEQHQNIENQNGNEHLFPVSIIPPPRDM 838

Query: 731 DPALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775
           +PAL+ WKG SV A++KL+EEL+++ +DWD+ GSRILQYKCIF Y
Sbjct: 839 NPALIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 883

>TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {ON}
           Anc_5.477 YOR141C
          Length = 882

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/820 (45%), Positives = 521/820 (63%), Gaps = 62/820 (7%)

Query: 4   SQALEPPSEDVPMGDAEDAEMEHEGDYSTADQTPLSMTPALSSNPNASKVKKPD----PH 59
           S  +  P+ D    DA   + + + D S+ D+         +  PN+    + D     +
Sbjct: 77  SSVVGTPTGDFGKSDAFHDDKKRKLDESSPDKN--------AEKPNSEMTNRSDISNGSN 128

Query: 60  AKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNY 119
               TK+   +LE+RRLGRQ+AA  YA K++  GIEK++N  +   GLF+P+ L+NQKN 
Sbjct: 129 KPVSTKMSTSVLERRRLGRQRAAAAYAIKLQKTGIEKKENDNIQSTGLFRPIPLVNQKNC 188

Query: 120 SSDYLKRDDQIFAMRERKSLRNANANQAT-------------PDMPEDDDQESVDGESDA 166
           SSDYLK + QIFA+RERK LRN                     + PE  D ++V+ ES+ 
Sbjct: 189 SSDYLKTNSQIFALRERKVLRNNTNIININSGNNSNSTSGTTANTPEVSDLKNVNSESNV 248

Query: 167 Q---------------------TIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTSD 205
                                 TIVIHPGSR LKIG A +  P  IP CVA PK    S+
Sbjct: 249 SLIDETILKNNPDNIVFDDPTTTIVIHPGSRYLKIGFAKDDSPLVIPNCVAFPKNSLYSE 308

Query: 206 STPEPQVDEEE---YISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEH 262
           +  E  V +EE   + + K  IQQ F++RMRYYKRK+  NSH+   +FN +  PE + + 
Sbjct: 309 NVEETIVSKEESDNFKTKKNQIQQSFRDRMRYYKRKIQNNSHERVRSFNIQSKPEKVEDK 368

Query: 263 NDLHRVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKG-RFNIESPDYGSLQELLVDVSE 321
            + +RV+WI +  K YYG++A+RC    F +R+PF KG  FNI SP Y SL E++ D+S 
Sbjct: 369 TEYNRVEWITNPDKIYYGEEASRCSKDAFIIRYPFVKGGSFNITSPYYNSLPEIIGDISN 428

Query: 322 LLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLA 381
           L ++ALSQ + +++PS+   YK+++V+PD F+K+++ET  R+L+ ++KFQAVA++QESLA
Sbjct: 429 LFEYALSQDRFNLKPSEYSKYKIILVIPDIFEKSHLETMFRVLLKEMKFQAVAIMQESLA 488

Query: 382 SCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFP 441
           + YGAGIG +TC+V+IGAT T++AC+DEG V ++S+ITLDYGGDDITKLF   LL++ FP
Sbjct: 489 ASYGAGIGGATCIVNIGATQTRVACIDEGTVSEHSLITLDYGGDDITKLFLHLLLQNEFP 548

Query: 442 YQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPG--AEKFEFKVFDEV 499
           YQDLD+NS  GW  +E LK+++ TF+DA++T+QLYNFIK   NKPG  AEK EFKVFDEV
Sbjct: 549 YQDLDINSSHGWRQIENLKKQFVTFEDANITVQLYNFIK---NKPGAQAEKLEFKVFDEV 605

Query: 500 MTAPMGLFFPHILRLLKDKNVP--VNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTT 557
           + AP+GLF+P I R++ ++N    VNK +  QLP S D++T + ++ +S+SQ+ C    T
Sbjct: 606 INAPLGLFYPEIFRIMAEENEKRRVNKKLQDQLPPSTDLYTEERDDWRSLSQVQCLDNDT 665

Query: 558 YCDMHRDLDILQKLLNLPSEIEEYQ--SSTCANLEPAYTPLEKAIVESITNACVSLDNNH 615
           Y     DLD++ KLLN    +++    ++     E  YT L+KAI++SITNA V++D   
Sbjct: 666 YSGNDNDLDVITKLLNANLNLDDMDLINNDQNENEKNYTSLDKAIIQSITNAVVTMDT-- 723

Query: 616 SKAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQT 675
           SK   FY+NI+VVGGSS   SLDFILTDRINIWRPR+LS    P+F   + KQVK+F   
Sbjct: 724 SKMTQFYNNIMVVGGSSSIPSLDFILTDRINIWRPRILSSREFPSFFRNLVKQVKDFNTA 783

Query: 676 QKLSEIXXXXXXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALL 735
            K S                  IK EL+ Y + +++   NE + P +VLP P +MDP++L
Sbjct: 784 NK-SNNRPEEGEEEQKKGIAELIKTELKKYKDNLESQNANEHLLPVSVLPPPADMDPSVL 842

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775
            WKG SV  +LKLIEELYV+ +DWD+LGSRILQYKC+F Y
Sbjct: 843 NWKGASVLGQLKLIEELYVTNADWDMLGSRILQYKCLFPY 882

>TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.477
           YOR141C
          Length = 854

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/749 (47%), Positives = 489/749 (65%), Gaps = 35/749 (4%)

Query: 54  KKPDPHAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSL 113
           K P   + +  K   HLLEKRRLGR KAAE++A+K+K  GIEK +   ++  GLF+P  L
Sbjct: 114 KNPKIDSSKNKKFHLHLLEKRRLGRLKAAEEFAKKLKQSGIEKIETLTVNPTGLFQPAML 173

Query: 114 INQKNYSSDYLKRDDQIFAMRERKSLR-NANANQA---TPDMPEDDDQ-------ESVDG 162
           INQKNYSSDYLK+D QIFAMR RK +R NA    +   TPD  E   +       E ++ 
Sbjct: 174 INQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQAAQDEDINL 233

Query: 163 ESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKR------PRTSDSTPEPQVDEEE 216
              + TIVIHPGS+ LKIG A +  P  IP CVAVPK          +D+    +   E+
Sbjct: 234 GDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELNDNFNYSKDQSEK 293

Query: 217 YISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLHRVD-WIQDAS 275
           +   K  + + FKERMR+YKRKV  N H+  ++FN    PE + E ND+  V+ WI D  
Sbjct: 294 FDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIEDVNRWINDPQ 353

Query: 276 KCYYGKDATRCLPSHFTVRHPFWKG-RFNIESPDYGSLQELLVDVSELLKFALSQPKIDV 334
           K Y+G DA RC   +F +R+PF  G  FNIE+P Y +L ELL +V E L   L+     +
Sbjct: 354 KKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLVHILTSDTFQL 413

Query: 335 RPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCV 394
           + S   +YK+V+V+ D F+K+++E   RLL+ +++F AVA+IQESLA+CYGAG+G STCV
Sbjct: 414 KTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCV 473

Query: 395 VDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWS 454
           V++GAT T+IACVDEG ++++S+++LDYGGDDITKLF+  LL+S FPY DL++N+   W 
Sbjct: 474 VNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTDLNINAAHDWI 533

Query: 455 LMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
           L E+LK+ + TF DA+VT+QLYNFIKR+P +   +K+EF+ F+EVM AP+ LF+P +L+L
Sbjct: 534 LAEKLKKDFVTFHDANVTVQLYNFIKRVPGQI-PQKYEFETFEEVMLAPLSLFYPQVLKL 592

Query: 515 LKDKNVP--VNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHRDLDILQKLL 572
           LK + +    N+ V  QLP S+D+FT + N+ KS++Q  C  K  Y +   ++ +L++ L
Sbjct: 593 LKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETSDEISMLKRTL 652

Query: 573 NLPSEIEEYQSSTCANLE---PAYTPLEKAIVESITNACVSLDNNHSKAANFYSNILVVG 629
           N+   +EE +       E     YT LEKAI++SI NA  SLD   SK  +FYSNIL+VG
Sbjct: 653 NIHLNLEEIRDEIDKEHEIPNSNYTSLEKAIIQSIANASASLD--ISKINSFYSNILLVG 710

Query: 630 GSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKE---FEQTQKLSEIXXXXX 686
           G +K  SLDFIL DRI IWRPRLLSVN+ PTF  +++K +KE   + +T K SE      
Sbjct: 711 GGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKTNKTSE-----E 765

Query: 687 XXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALLTWKGGSVFARL 746
                      IK E ++Y   ++    N+S FP ++LP+PR MDPA L WKG SV A++
Sbjct: 766 EESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGASVLAQI 825

Query: 747 KLIEELYVSESDWDILGSRILQYKCIFDY 775
           KL+EEL+V+ +DWD+ GSRILQ+KCIF Y
Sbjct: 826 KLVEELFVTTADWDMHGSRILQHKCIFTY 854

>CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141c ARP8
           Actin-related protein
          Length = 837

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/749 (46%), Positives = 495/749 (66%), Gaps = 42/749 (5%)

Query: 65  KVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYL 124
           KVP HLLEKRRLGR KAAE++A+K+K +GIE+ +N  L Q GLF P+ LINQKNYSSDYL
Sbjct: 93  KVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVPLINQKNYSSDYL 152

Query: 125 KRDDQIFAMRERKSLRNANANQA----TPDMPE-----------------DDDQ-----E 158
           ++D+  FA+RERK +RN+NAN +    T ++                   D D      E
Sbjct: 153 RKDENAFAVRERKQMRNSNANNSAHAKTSELGSGAQSASMASSASLDALVDTDTKLQSVE 212

Query: 159 SVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTS--DSTPEPQVD--- 213
            +D      TIVIHPGS ++KIGLAT+  P SIP  VAVP+    +  D TP   ++   
Sbjct: 213 DIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQVVNPVDETPVNVLNIEL 272

Query: 214 EEEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLHRVDWIQD 273
           ++++      ++ +FKERM+YYKRK+  N+H+   +FN+   PE + + ND  ++DWI +
Sbjct: 273 DDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKPEEVSDKNDQGKIDWIYN 332

Query: 274 ASKCYYGKDATRCLPSHFTVRHPFWK-GRFNIESPDYGSLQELLVDVSELLKFALSQPKI 332
           A K YYG+DA RC+   F +R PF K G FN+ES +Y S+Q+LL DVSEL+  ALS  K 
Sbjct: 333 ADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQDLLGDVSELVDSALSSDKF 392

Query: 333 DVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDST 392
           ++  S+  +YK VIV+PD F K+++ETFIRLL+ ++ F++VA++QESLA+CYGAGI   T
Sbjct: 393 NITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPT 452

Query: 393 CVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEG 452
           CVV+IGA   +IACVD+G +I +S +TLDYGG+D+T L A  L +S FPY++ +L++  G
Sbjct: 453 CVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYG 512

Query: 453 WSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512
           W   E  K+K+ TFQDAD+ +QL+NFIKR+P  P +EK++FKVFDEV+ AP+GLF+P I 
Sbjct: 513 WKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIP-SEKYDFKVFDEVILAPLGLFYPEIF 571

Query: 513 RLLKDKNVPVNK-YVTS---QLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHRDLDIL 568
           + ++++  P  K Y T+   Q+  S+D++T   N+ +S++Q  C++   YCD   DL+I+
Sbjct: 572 KYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDCEENMIYCDAKDDLEII 631

Query: 569 QKLLNLPSEIEEYQSSTCANL--EPAYTPLEKAIVESITNACVSLDNNHSKAANFYSNIL 626
           Q  L+L + IE+ QS        +  + PL+KAIV+SITNA +++D   SK + FYSNI+
Sbjct: 632 QHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIVQSITNAAINVD--ISKISQFYSNII 689

Query: 627 VVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLSEIXXXXX 686
           +VGG +   +LDFIL+DRINIWRP +L +++ P F   ++KQ+K+  QT   S       
Sbjct: 690 IVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDI-QTSNKSNTGDKSQ 748

Query: 687 XXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALLTWKGGSVFARL 746
                      +KVEL      ++     +  F   VLPAPR +DP+LL WKG SV A++
Sbjct: 749 EQEVAERSIALVKVELDKLVASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQI 808

Query: 747 KLIEELYVSESDWDILGSRILQYKCIFDY 775
           KLIEELY+S +DWD+ G+R+LQYKCIF Y
Sbjct: 809 KLIEELYISRNDWDVHGNRVLQYKCIFAY 837

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/844 (44%), Positives = 516/844 (61%), Gaps = 80/844 (9%)

Query: 3   SSQALEPPSEDVPMGDAEDAEMEHEGDYS---TADQTPLSMTPA-------------LSS 46
           SS   E P E +P+ D  D E   + D++   ++  TPL+   A             + S
Sbjct: 8   SSIVYEDPIE-IPLDDDSDDEQPSQQDHNDLRSSTNTPLAERAATIDGEEDVDGDDDIES 66

Query: 47  NPNASKVKKPDPHAKQ--------QTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRD 98
           N N+ K  K D    Q         TKVP HLLE+RR+GR KAAE +A+K+K IGIEK +
Sbjct: 67  N-NSVKTVKIDGKDVQLSYGKTMAGTKVPKHLLERRRIGRIKAAEAFAKKLKKIGIEKIE 125

Query: 99  NPLLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNANAN--------QATPD 150
           N  L Q GLF+PL+LINQKNYSSDY+++DDQIFA+RERK+LR++           +A  D
Sbjct: 126 NITLPQTGLFQPLNLINQKNYSSDYIRKDDQIFALRERKTLRSSTNANNNNTSTPKAVVD 185

Query: 151 MPEDDDQESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTSDSTPEP 210
           +      + +D      TI+I PGS  +KIG A +  P  IP  VA+PK+  +   + E 
Sbjct: 186 LKTGVMDDEIDLNDPNSTIIIQPGSETMKIGFALDETPLLIPNLVAIPKKDDSKGPSTES 245

Query: 211 QVD---EEEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLHR 267
           +++    EE+   K  +   FKERMRYYKR++ PNSH+   +FN    PE I ++ND  R
Sbjct: 246 KLNTEQSEEFEDLKNELHSTFKERMRYYKRRIQPNSHEQVKSFNRNAQPETILDNNDPAR 305

Query: 268 VDWIQDASKCYYGKDATRCLPSHFTVRHPFWKGR----FNIESPDYGSLQELLVDVSELL 323
           + WI    K YYG DA  C  S F+ R PF   R    FN+    Y S+QELL DV +L+
Sbjct: 306 IRWITQNDKVYYGNDALLCPESFFSHRKPFGTCRNGALFNLMGSSYSSVQELLGDVIKLI 365

Query: 324 KFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASC 383
           +F L++    +       YK ++V+PD F+K++VE  IRLL+T+L F AVA+IQESLA+C
Sbjct: 366 EFGLNKL---LEAKNKDKYKAILVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQESLATC 422

Query: 384 YGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQ 443
           YGAGI  STCVV++GA+ T ++C+DEG+V++NS+I L+YGGDDIT+LF+  L  +NFPYQ
Sbjct: 423 YGAGISTSTCVVNVGASETSVSCIDEGVVLENSLINLNYGGDDITRLFSVLLKMNNFPYQ 482

Query: 444 DLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAP 503
           D ++ S  GW++ E LK++  T QDADVT+QL NF+KR+ N+P  EK+EFK FDEVM AP
Sbjct: 483 DWNVESIAGWNIAETLKKQIVTLQDADVTVQLSNFMKRVFNEP-TEKYEFKTFDEVMLAP 541

Query: 504 MGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHR 563
           + LF P I   L+++    N  +  QLP SKD+FT + N+ +S++Q AC+   +YCD+  
Sbjct: 542 LALFAPRIFSYLRNEESK-NSTLQYQLPESKDLFTHELNDWRSMTQEACKNNGSYCDISD 600

Query: 564 DLDILQKLLNLPSEIEEYQSSTCANLEPAYT--PLEKAIVESITNACVSLDNNHSKAANF 621
           +L +L  LL + S++E +QS     L+      PL+KAI++SIT+AC+SLD   SK  +F
Sbjct: 601 ELQLLTALLEVDSKLEAFQSEATTTLDNKRNMLPLDKAIIQSITDACLSLD--PSKMDSF 658

Query: 622 YSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFE----QTQK 677
           YSNILVVGGSS   + DF+LTDRINIWRPRLLS+++ P F   +SK++K+ E     T K
Sbjct: 659 YSNILVVGGSSNIPAFDFMLTDRINIWRPRLLSLSSFPQFYKNLSKEIKDLEMESQSTAK 718

Query: 678 LSEIXXXXXXXXXXXXXXXT--------------------------IKVELQSYWEGVDA 711
           L                  T                          IK +LQ Y   V++
Sbjct: 719 LQAQTGSVVPTTGSSTPLATNAGNDGETMADLNEVSKKLSSNINDLIKTKLQDYISNVES 778

Query: 712 LGGNESVFPANVLPAPREMDPALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
              NE  FP  V+P PR+M  A+L+WKG SV A++KL+EEL+++  DWD+ GSRILQ+KC
Sbjct: 779 QNSNEHYFPVGVVPPPRDMSAAILSWKGASVLAQIKLVEELFITNLDWDMHGSRILQHKC 838

Query: 772 IFDY 775
           IF Y
Sbjct: 839 IFTY 842

>KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.477
           YOR141C
          Length = 934

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/824 (43%), Positives = 488/824 (59%), Gaps = 83/824 (10%)

Query: 28  GDYSTADQTPLSMTPALSSNPNASKVKKPDPHAKQQTKVPGHLLEKRRLGRQKAAEQYAQ 87
           GD  +A  +P   TP++  N  A + ++ D  +    KVP HLLEKRRLGR KAAE++A+
Sbjct: 118 GDVPSATASP---TPSVVMNGAADEKQEKDSKSAAGKKVPLHLLEKRRLGRIKAAEEFAK 174

Query: 88  KMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNANANQ- 146
           K+K IGIEK D+  L   G  KPL +INQKNYSSDY+++DDQIFA+RERK LR+A  +  
Sbjct: 175 KLKQIGIEKVDSTTLPSTGGLKPLIVINQKNYSSDYIRKDDQIFALRERKFLRSAGTSNT 234

Query: 147 -----------------------ATPDMPEDDDQES--VDGESDAQTIVIHPGSRNLKIG 181
                                  AT  +P +   +S  +D      TIVI PGS ++KIG
Sbjct: 235 TTTTTNNGSNTNGVGSASHTPEVATSTIPNEFTLKSDDIDFTDATTTIVIQPGSESIKIG 294

Query: 182 LATEVLPQSIPCCVAVPKRPRT--SDSTPEPQVDEEEYISAKESIQQDFKERMRYYKRKV 239
            AT+  P  IP CVAVP    T   ++    +   ++++  KE +Q  FKERMR+YKR+V
Sbjct: 295 FATDETPLVIPNCVAVPHSGETPIGNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRV 354

Query: 240 IPNSHDIAVNFNARVTPEAIPEHNDLHRVDWI-----QDASKCYYGKDATRCLPSHFTVR 294
             +S+D    FN    PE I + ND  ++ W      Q+    Y G +A  CL  H+  R
Sbjct: 355 QLSSYDQVNTFNETTKPEIIEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHR 414

Query: 295 HPFW----KGRFNIESPDYGSLQELLVDVSELLKFALSQ--PKIDVRPSQIPNYKVVIVV 348
            PF     K  FN++   Y SL  LL DVS LL+ A+ +   K D    +   YK V+V+
Sbjct: 415 RPFGCSEGKYLFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVI 474

Query: 349 PDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVD 408
           PD F+K++VET IRLL+++L F AVA++QESLA+CYG+GI  STCVV++GAT TK+ACVD
Sbjct: 475 PDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVD 534

Query: 409 EGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQD 468
           EG+V++NS+I L+YGGDDI+KLFA  LL SNFPYQ+ D++S  G  + E LK++  TFQD
Sbjct: 535 EGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQD 594

Query: 469 ADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRLL---KDKNVPVNKY 525
           AD+T QL+NFIKR+P  P  EK EFK FDEV+ AP+ LF+P I  LL   K KN+  N  
Sbjct: 595 ADITTQLFNFIKRVPGLP-TEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNL-TNPK 652

Query: 526 VTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHRDLDILQKLLNLPSEIEEYQSST 585
           +  QLP S+D+FT K NN KS+S++ C   T Y DM ++  +L  LL + S  E     +
Sbjct: 653 LKYQLPDSRDLFTNKANNWKSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDS 712

Query: 586 CANLEPA---YTPLEKAIVESITNACVSLDNNHSKAANFYSNILVVGGSSKFSSLDFILT 642
               E      T L+K++++SITNA +SL+    K A+FYSNIL+VGGSS     D IL 
Sbjct: 713 GVGSETTELNLTALDKSVIQSITNATLSLE--PGKMASFYSNILIVGGSSNIPGFDTILK 770

Query: 643 DRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLS----------------------- 679
           DRIN+WRP+L+++ + P F N++ K++K+ E + K S                       
Sbjct: 771 DRINMWRPKLIALASFPNFYNELVKEIKDLETSAKTSSAAIVTGGTATATPAPVLNDDDA 830

Query: 680 --------EIXXXXXXXXXXXXXXXTIKVELQSYWEGVDALGGNESVFPANVLPAPREMD 731
                   E                 I+  L+ Y   ++   GNE   P +V PAP  M+
Sbjct: 831 PKEVPEVKETSSDAKEYELNEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMN 890

Query: 732 PALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775
           P+LL W+G  V A++KLIEEL+V+  DWD+ GSR+LQ+KCIF Y
Sbjct: 891 PSLLPWRGAGVLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY 934

>NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.477
           YOR141C
          Length = 974

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/642 (49%), Positives = 441/642 (68%), Gaps = 35/642 (5%)

Query: 65  KVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYL 124
           KVP HLLEKRRLGR KAAE++A+K+K  GIEK ++  +   GLF+PL+LINQKNYSS YL
Sbjct: 171 KVPLHLLEKRRLGRIKAAEEFAKKLKEAGIEKVESVTVPPTGLFQPLNLINQKNYSSIYL 230

Query: 125 KRDDQIFAMRERKSLRNANANQ---ATPDMPEDDDQESVDGESDA---------QTIVIH 172
           K DDQIF +R+ KSL+N + NQ   ATPD   +     ++ +S           +TI+IH
Sbjct: 231 KNDDQIFCLRDDKSLKNTSPNQTSTATPDNIVESVATGINNKSTGDQLNLNDPTKTIIIH 290

Query: 173 PGSRNLKIGLATEVLPQSIPCCVAVPKRP--------RTSDSTPEPQ--------VDEEE 216
            GS +LKIG A +  P  +P CVA+PK+          T DS P P            +E
Sbjct: 291 TGSHSLKIGKALDENPIIVPNCVAIPKQEYEGMTRNINTKDSIPTPPENNIFDSIAQSDE 350

Query: 217 YISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLHRVDWIQDAS- 275
           +   K  I+ +FKERM+YYKR++ PNS +   +FN    PE +P  ND  R+ WI +++ 
Sbjct: 351 FNDLKLEIETNFKERMKYYKRRIQPNSCEQVKSFNKISKPEILPISNDPQRIQWINESTN 410

Query: 276 KCYYGKDATRCLPSHFTVRHPFWK-GRFNIESPDYGSLQELLVDVSELLKFALSQPKIDV 334
           K YYG +A RC   HF  R PF   G FNI S DY SLQ+LL DV+ L++ +L+    D+
Sbjct: 411 KRYYGSNAERCTDLHFKTRKPFSNNGSFNIASTDYISLQDLLSDVTNLIEHSLTSSPFDL 470

Query: 335 RPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCV 394
           +PSQ   +KVV+++PD+F K++VE FI LL+T LKFQAVA+IQESLA+CYGAG    TCV
Sbjct: 471 KPSQFKEHKVVLIIPDSFGKSHVELFITLLLTHLKFQAVAIIQESLATCYGAGNSVPTCV 530

Query: 395 VDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWS 454
           V++GA+ T +ACVDEG V++NS+++L+YGG+DIT +FA FLL+++FPY + +LNS EGW 
Sbjct: 531 VNLGASQTTVACVDEGTVLENSMVSLNYGGNDITNIFATFLLQNDFPYHNWNLNSIEGWK 590

Query: 455 LMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
           L E+LKEKY TFQD DVT+QL+NFIKR+P     EK++FKVFD+VM AP+ LFFP IL+L
Sbjct: 591 LAEELKEKYITFQDMDVTVQLFNFIKRLPGMDTIEKYDFKVFDDVMLAPLTLFFPKILKL 650

Query: 515 LKDKN-VPVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHRDLDILQKLLN 573
           +K++     NK++ SQLP S+D++T K N+ +S++Q  C +   +  +  +L++L++ L 
Sbjct: 651 MKEQQPQNRNKFLQSQLPDSRDIYTTKINDWRSITQEECLESKLFSYIDNELELLKRTLE 710

Query: 574 LPSEIEEYQSSTCANLEPA--YTPLEKAIVESITNACVSLDNNHSKAANFYSNILVVGGS 631
           +P  +E +Q+++  N      YTPL+ AI++SI NA  ++D   SK ++FYSNILVVGG 
Sbjct: 711 VPILLENFQNNSPDNKNDKLNYTPLDVAIIQSIMNASTNID--MSKMSSFYSNILVVGGG 768

Query: 632 SKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFE 673
           SK  +LDFILTDRINIWRPRLLS+ + P F  ++SK +K+ +
Sbjct: 769 SKIPALDFILTDRINIWRPRLLSLTSFPNFYKELSKDIKDLQ 810

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 45/79 (56%), Positives = 61/79 (77%), Gaps = 1/79 (1%)

Query: 698 IKVELQSYWEGVD-ALGGNESVFPANVLPAPREMDPALLTWKGGSVFARLKLIEELYVSE 756
           +K +L+ Y E V+ A  GN+   P +V+PAPR++DPAL+ WKG SV A+LK+IEELY++ 
Sbjct: 896 LKEKLEEYLETVEKAQNGNDHYLPVSVVPAPRDIDPALILWKGASVLAQLKIIEELYMTN 955

Query: 757 SDWDILGSRILQYKCIFDY 775
           +DWD+ GSRILQYK IF Y
Sbjct: 956 ADWDVHGSRILQYKSIFPY 974

>Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON}
           complement(1914..3305) [1392 nt, 464 aa]
          Length = 463

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 85/181 (46%), Gaps = 13/181 (7%)

Query: 295 HPFWKGRF-NIESPDYGSLQEL-LVDVSELLKFALSQPK-IDVRPSQIPNYKVVIVVPDA 351
           HP   G   NI++     LQ L +V VS L + +LS P   D   S IP    +++   +
Sbjct: 66  HPIVNGEIVNIDA----FLQFLKIVYVSILNEKSLSDPNSFDRELSNIP---FLLISHHS 118

Query: 352 FDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGL 411
           + + ++E     +   L+  +   +  SLAS Y      ++C++DIG T T I  V + L
Sbjct: 119 WSQFHIEKITHFVFEALQLNSFITLPVSLASNYAMISLQNSCIIDIGETHTDIVPVIDYL 178

Query: 412 VIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQ--LKEKYATFQDA 469
            +D+   ++ YGG  I    +K L + + P Q  DL     + ++ +   KE    FQ +
Sbjct: 179 QMDHIASSIKYGGQTINDSLSKILTDLS-PEQIEDLKKSAIFEVLSEDAKKESAFKFQSS 237

Query: 470 D 470
           D
Sbjct: 238 D 238

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 61/130 (46%), Gaps = 13/130 (10%)

Query: 327 LSQPKIDVRPSQIPNYKVVIVVP---DAFDKAYVETFIRLLITDLKFQAVAVIQESLASC 383
           L + ++ V P ++P   +VI VP      D   VE +  L +  L+  A+ ++ E LA  
Sbjct: 83  LYEYELKVDPQELP---LVISVPATHSEIDPQVVENYFDLALNKLQVPALQIVVEPLAVA 139

Query: 384 YGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQ 443
              G   S  V+D+GA  T +  + +G V+ + V+   +GGD +    AK L E      
Sbjct: 140 LAMG-KSSALVIDVGARGTTVTPIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEP----- 193

Query: 444 DLDLNSPEGW 453
            L  +S E W
Sbjct: 194 -LGSSSHEAW 202

>ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp,
           462 aa] {ON} similar to uniprot|Q05123 Saccharomyces
           cerevisiae YMR033W ARP9 Actin-related protein involved
           in transcriptional regulation; subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 462

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 50/101 (49%)

Query: 337 SQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVD 396
           +++ N  V IV   ++ +  +E+ ++ L   L+     ++  +L+S Y  G   + CV+D
Sbjct: 104 AELSNIPVFIVTHHSWSQFQLESIVQFLFEALRVNGAMLLSTALSSTYAMGSLQNCCVID 163

Query: 397 IGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLE 437
           IG   T I  V +   +     T+ YGG+ I +  A+ L E
Sbjct: 164 IGTAHTDIIPVVDYAPLVPLTSTIPYGGNTINENLARILPE 204

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 4/86 (4%)

Query: 342 YKVVIVVPDA---FDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIG 398
           Y +VI +P      D   +E +  L+    KF    +I E LA     G   S  V+D+G
Sbjct: 106 YPLVITIPSMKKEIDGEVLEKYFSLVFERFKFPVFQIILEPLAITLSLG-KSSGLVIDMG 164

Query: 399 ATTTKIACVDEGLVIDNSVITLDYGG 424
           ++  ++  + +G VI N+V++  YGG
Sbjct: 165 SSGCRVTPIIDGTVIKNAVLSSKYGG 190

>YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}
           ARP7Component of both the SWI/SNF and RSC chromatin
           remodeling complexes; actin-related protein involved in
           transcriptional regulation
          Length = 477

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 7/111 (6%)

Query: 318 DVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAF---DKAYVETFIRLLITDLKFQAVA 374
           D  E+    L   ++ V P ++P   +VI +P      D A +E +  L    L      
Sbjct: 81  DALEMQWRYLYDTQLKVSPEELP---LVITMPATNGKPDMAILERYYELAFDKLNVPVFQ 137

Query: 375 VIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGD 425
           ++ E LA     G   S  V+DIGA+   +  + +G+V+ N+V+   +GGD
Sbjct: 138 IVIEPLAIALSMG-KSSAFVIDIGASGCNVTPIIDGIVVKNAVVRSKFGGD 187

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 51/102 (50%), Gaps = 7/102 (6%)

Query: 327 LSQPKIDVRPSQIPNYKVVIVVPDAF---DKAYVETFIRLLITDLKFQAVAVIQESLASC 383
           + + ++ V P ++P   +VI +P      D + +E +  L    LK     ++ E LA  
Sbjct: 90  MYETQLKVSPEELP---LVITMPATNGKPDMSILERYYELAFDKLKVPVFQIVIEPLAIA 146

Query: 384 YGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGD 425
              G   S  V+D+GA+   +  + +G+V+ N+V+   +GGD
Sbjct: 147 LSMG-KSSAFVIDMGASGCNVTPIIDGIVVKNAVVRSKFGGD 187

>TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 62/135 (45%), Gaps = 14/135 (10%)

Query: 329 QPKIDVRPSQIPNYKVVIVVPDAFDK------AYVETFIRLLITDLKFQAVAVIQESLAS 382
           +  + V P Q+P   + I VP    K        +E + ++    L   ++ V+ ESLA 
Sbjct: 88  EEHLKVSPDQLP---LAITVPSILTKNVELETKIIEEYCKIAFLKLGIPSLRVVNESLAI 144

Query: 383 CYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGD----DITKLFAKFLLES 438
               G  +S  ++D+  +   +  + +G++I N ++   +GGD    ++ K+  + + ES
Sbjct: 145 SLSLGKKNS-LIIDLSGSGCSVTPILDGILIKNGILKSKFGGDFLDFEVNKIINEKIKES 203

Query: 439 NFPYQDLDLNSPEGW 453
           +    D D  S E W
Sbjct: 204 DKEEMDEDKKSTEMW 218

>Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034W
           (REAL)
          Length = 476

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 7/102 (6%)

Query: 327 LSQPKIDVRPSQIPNYKVVIVVPDAF---DKAYVETFIRLLITDLKFQAVAVIQESLASC 383
           L   ++ V P ++P   +VI +P      D   +E +  L    LK     ++ E LA  
Sbjct: 90  LYDTQLKVSPEELP---LVITMPATNGKPDMGILERYYELAFDKLKVPVFQIVIEPLAIA 146

Query: 384 YGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGD 425
              G   S  V+D+GA+   +  + +G+V+ N+V+   +GGD
Sbjct: 147 LSMG-KSSAFVIDMGASGCNVTPIIDGIVVKNAVVRSKFGGD 187

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 54/109 (49%), Gaps = 8/109 (7%)

Query: 321 ELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAY----VETFIRLLITDLKFQAVAVI 376
           E L   + + ++ V PS++P   +VI +P   ++      VE ++ L    LK   + ++
Sbjct: 98  ERLYRYIYEKELKVDPSELP---LVITLPSMTNRELETKIVENYMELAFEKLKVPVLQIV 154

Query: 377 QESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGD 425
            E L      G   S+ V+D+GAT   +  + +G ++ NS++   + GD
Sbjct: 155 VEPLGIMLSTG-KSSSLVIDVGATGCTVTPIIDGTILRNSIVKSRFAGD 202

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 59/125 (47%), Gaps = 15/125 (12%)

Query: 329 QPKIDVRPSQIPNYKVVIVVPDAFDK------AYVETFIRLLITDLKFQAVAVIQESLAS 382
           + ++   P+++P   V+I +P +  K        +E + ++     K   + ++ ESL+ 
Sbjct: 90  EKQLKCDPTELP---VLITIPSSISKNEDIENKVIEQYCKIAFEKFKIPYLQIVNESLSI 146

Query: 383 CYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPY 442
             G G   ++ V+DI  + + +  + +G++I N ++   YGGD     F  + +   F  
Sbjct: 147 SLGLG-KKTSLVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGD-----FLDYQIIKKFST 200

Query: 443 QDLDL 447
            D DL
Sbjct: 201 IDEDL 205

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%)

Query: 357 VETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNS 416
           +E+    +   LK   + ++  SL + Y      + C++DIG   T I  + +   I++ 
Sbjct: 123 MESITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTTINHL 182

Query: 417 VITLDYGGDDITKLFAKFLLESN 439
             TL+YGG  I  +  K L E N
Sbjct: 183 SNTLNYGGSYINTILQKLLPELN 205

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 69/163 (42%), Gaps = 20/163 (12%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F  V V  +++ + Y  G+  S  VVD G   T I  V E +V+++  
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLT 178

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATFQDADVTIQL 475
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++ D D+  +L
Sbjct: 179 RRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIKEKLCYVSY-DLDLDTRL 232

Query: 476 YNFIKRIPNKPGAEKFEF------KVFDEVMTAPMGLFFPHIL 512
                 +      EK+E       KV  E   AP  LF P+++
Sbjct: 233 ARETTTL-----VEKYELPDGRIIKVGQERFEAPECLFQPNLV 270

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 68/161 (42%), Gaps = 16/161 (9%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    LL       A+ V  +++ S Y +G   + CVVD G        V +G  + +S+
Sbjct: 148 EKMCELLFESFNVPALYVSVQAVLSLYASG-RTTGCVVDCGDGCCHAVPVFDGFSVPSSI 206

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYN 477
             +D  G DIT+ F + LL        + L S     ++  +KEK A F   D  ++  N
Sbjct: 207 RRIDIAGRDITE-FLQLLLRKT---TGVSLLSSSEREIVRTIKEK-ACFVTKDPKLEEQN 261

Query: 478 FIKRIPNKPGAEKFEF------KVFDEVMTAPMGLFFPHIL 512
           F    P  P   KF+       ++  E   AP  LF P ++
Sbjct: 262 F----PMNPSFSKFKLPDGKTIELGQERYRAPEILFQPELI 298

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 67/166 (40%), Gaps = 26/166 (15%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F  V V  +++ + Y  G+  S  VVD G   T I  V E +V+++  
Sbjct: 120 EQMCEVMFEKYDFGGVYVGIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLT 178

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATF--------- 466
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++         
Sbjct: 179 RRLDVAGRDMTRYLIDLLSRRGYAF-----NKTADFETVRQIKEKLCYVSYDLDLDTRLA 233

Query: 467 QDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512
           Q+    ++ Y        K G+E+FE         AP  LF P ++
Sbjct: 234 QETTTLVEQYELPDGRVIKVGSERFE---------APECLFQPSLV 270

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 83/207 (40%), Gaps = 31/207 (14%)

Query: 318 DVSELLKFAL-SQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVI 376
           D+ +L  +A   Q KI   PS    +KV++  P        E    ++     F  V V 
Sbjct: 83  DMEQLWDYAFYDQMKI---PST-AGHKVLLTEPPMNPLKNREQMCEVMFEKYDFGGVYVA 138

Query: 377 QESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLL 436
            +++ + Y  G+  S  VVD G   T I  V E +V+++    LD  G D+T+     L 
Sbjct: 139 IQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLS 197

Query: 437 ESNFPYQDLDLNSPEGWSLMEQLKEK--YATF---------QDADVTIQLYNFIKRIPNK 485
              + +     N    +  + Q+KEK  Y ++          +    ++ Y        K
Sbjct: 198 RRGYAF-----NKTADFETVRQIKEKLCYVSYDLDLDTKLAHETTTLVETYELPDGRVIK 252

Query: 486 PGAEKFEFKVFDEVMTAPMGLFFPHIL 512
            G+E+FE         AP  LF P ++
Sbjct: 253 VGSERFE---------APECLFQPSLV 270

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 72/183 (39%), Gaps = 26/183 (14%)

Query: 341 NYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGAT 400
           N K+++  P        E    ++     F  V V  +++ + Y  G+  S  VVD G  
Sbjct: 103 NGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDG 161

Query: 401 TTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLK 460
            T I  V E +V+ +    LD  G D+T+     L    + +     N    +  + Q+K
Sbjct: 162 VTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIK 216

Query: 461 EK--YATF---------QDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFP 509
           EK  Y ++         ++  V ++ Y        K G E+FE         AP  LF P
Sbjct: 217 EKLCYVSYDLDLDTKLARETTVLVESYELPDGRTIKVGQERFE---------APECLFQP 267

Query: 510 HIL 512
            ++
Sbjct: 268 GLV 270

>Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034W
           (REAL)
          Length = 479

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 49/102 (48%), Gaps = 7/102 (6%)

Query: 327 LSQPKIDVRPSQIPNYKVVIVVPDAF---DKAYVETFIRLLITDLKFQAVAVIQESLASC 383
           L   ++ V P+++P   +VI +P      D + +  +  L    L      ++ E LA  
Sbjct: 90  LYDTQLKVSPNELP---LVITMPATNGKPDMSILRRYYELAFDKLNVPVFQIVIEPLAIA 146

Query: 384 YGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGD 425
              G   S  V+D+GA+   +  + +G+V+ N+V+   +GGD
Sbjct: 147 LSMG-KSSAFVIDMGASGCNVTPIIDGIVVKNAVVRSKFGGD 187

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 67/158 (42%), Gaps = 10/158 (6%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F  V V  +++ + Y  G+  S  VVD G   T I  V E +V+++  
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLT 178

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATFQDADVTIQL 475
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++ D D+  +L
Sbjct: 179 RRLDVAGRDVTRHLIDLLSRRGYAF-----NRSADFETVRQIKEKLSYVSY-DLDLDTKL 232

Query: 476 YN-FIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512
                  + N    +    KV  E   AP  LF P+++
Sbjct: 233 ARETTTLVENYELPDGRVIKVGSERFEAPECLFQPNLV 270

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 68/166 (40%), Gaps = 26/166 (15%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F  V V  +++ + Y  G+  S  VVD G   T I  V E +V+++  
Sbjct: 66  EKMCEVMFEKYNFGGVYVAIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLT 124

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATF--------- 466
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++         
Sbjct: 125 RRLDVAGRDVTRNLIDLLSRRGYAF-----NRTADFETVRQIKEKLCYVSYDLDLDTKLA 179

Query: 467 QDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512
           ++    ++ Y        K G+E+FE         AP  LF P+++
Sbjct: 180 RETTTLVESYELPDGRVIKVGSERFE---------APECLFQPNLV 216

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 68/167 (40%), Gaps = 28/167 (16%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F  V V  +++ + Y  G+  S  VVD G   T I  V E +V+++  
Sbjct: 66  EQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLT 124

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATFQDADVTIQL 475
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++ D D+  +L
Sbjct: 125 RRLDVAGRDVTRHLIDLLSRRGYAF-----NRSADFETVRQIKEKLSYVSY-DLDLDTKL 178

Query: 476 ----------YNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512
                     Y        K G+E+FE         AP  LF P ++
Sbjct: 179 ARETTTLVENYELPDGRVIKVGSERFE---------APECLFQPSLV 216

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 105/260 (40%), Gaps = 39/260 (15%)

Query: 338 QIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDI 397
           Q+  + VV+    +  K   E    +L       A+   ++ + S YG G   + C V  
Sbjct: 103 QLQEHPVVLTNSMSTSKKEEEKMCEVLFEKFSIPAIYCSRDPIMSLYGLG-RTTGCSVSC 161

Query: 398 GATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLME 457
           G     I  V +G+++  S    + GG  +T      LL  N P  +   N   G  L+ 
Sbjct: 162 GHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLD-LLRHNHPKLE---NGQNGIELIR 217

Query: 458 QLKEKYATF-QDADVTIQLYNFIK--------RIPN----KPGAEKFEFKVFDEVMTAPM 504
            +KE+     +D    I+ Y  I         R+P+    + G+E+FE         AP 
Sbjct: 218 SIKERCCVLSKDFYNEIRAYELITSKTSNNKYRLPDGNIIEIGSERFE---------APE 268

Query: 505 GLFFPHILRLLKDKNVPVNKYVTSQ------LPRSKDMFTCKDNNPKSVSQLACQKKTTY 558
            +F P          +P+ K + +       LPRS+ + +   +   S+ +   ++ T  
Sbjct: 269 IIFNPQAYGY---SEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGERLTK- 324

Query: 559 CDMHRDLDILQK-LLNLPSE 577
            ++ +++D  QK +LN P E
Sbjct: 325 -EIRKEIDGNQKIMLNAPHE 343

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 67/166 (40%), Gaps = 26/166 (15%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F  V V  +++ + Y  G+  S  VVD G   T I  V E +V+++  
Sbjct: 120 ELMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLT 178

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATF--------- 466
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++         
Sbjct: 179 RRLDVAGRDVTRHLIDLLSRRGYAF-----NRSADFETVRQIKEKLSYVSYDLNLDTKLA 233

Query: 467 QDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512
           ++  V ++ Y        K G E+FE         AP  LF P ++
Sbjct: 234 RETTVLVENYELPDGRVIKVGQERFE---------APECLFQPDLV 270

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 68/163 (41%), Gaps = 20/163 (12%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E   +++     F  V V  +++ + Y  G+  S  VVD G   T I  V E +V+++  
Sbjct: 122 EMMCQVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLT 180

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATFQDADVTIQL 475
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++ D D   +L
Sbjct: 181 RRLDVAGRDVTRHLIDLLSRRGYAF-----NRSADFETVRQIKEKLSYVSY-DLDFDTKL 234

Query: 476 YNFIKRIPNKPGAEKFEF------KVFDEVMTAPMGLFFPHIL 512
                 +      E +E       KV  E   AP  LF P+++
Sbjct: 235 ARETTTL-----VENYELPDGRIIKVGQERFEAPECLFQPNLV 272

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 68/163 (41%), Gaps = 20/163 (12%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F  V V  +++ + Y  G+  S  VVD G   T I  V E +V+++  
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLT 178

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATFQDADVTIQL 475
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++ D D+  +L
Sbjct: 179 RRLDVAGRDVTRHLIDLLSRRGYAF-----NRSADFETVRQIKEKLCYVSY-DLDLDTKL 232

Query: 476 YNFIKRIPNKPGAEKFEF------KVFDEVMTAPMGLFFPHIL 512
                 +      E +E       KV  E   AP  LF P+++
Sbjct: 233 ARETTTL-----VENYELPDGRIIKVGQERFEAPECLFQPNLV 270

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 72/175 (41%), Gaps = 10/175 (5%)

Query: 341 NYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGAT 400
           N K+++  P        E    ++     F  V V  +++ + Y  G+  S  VVD G  
Sbjct: 103 NGKILLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDG 161

Query: 401 TTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLK 460
            T I  V E +V+++    LD  G D+T+     L    + +     N    +  + Q+K
Sbjct: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF-----NRSADFETVRQIK 216

Query: 461 EK--YATFQDADVTIQLYN-FIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512
           EK  Y ++ D D+  +L       + N    +    KV  E   AP  LF P ++
Sbjct: 217 EKVCYVSY-DLDLDTKLARETTTLVENYELPDGRVIKVGQERFEAPECLFQPSLV 270

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 73/180 (40%), Gaps = 20/180 (11%)

Query: 341 NYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGAT 400
           N K+++  P        E    ++     F  V V  +++ + Y  G+  S  VVD G  
Sbjct: 103 NGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDG 161

Query: 401 TTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLK 460
            T I  V E +V+++    LD  G D+T+     L    + +     N    +  + Q+K
Sbjct: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIK 216

Query: 461 EK--YATFQDADVTIQLYNFIKRIPNKPGAEKFEF------KVFDEVMTAPMGLFFPHIL 512
           EK  Y ++ D D+  +L      +      E +E       KV  E   AP  LF P ++
Sbjct: 217 EKLCYVSY-DLDLDTKLARETTTL-----VESYELPDGRTIKVGQERFEAPECLFQPGLV 270

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 4/94 (4%)

Query: 332 IDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDS 391
           +++ P ++P   +VI VP          ++ L +  LK     ++ E LA     G  ++
Sbjct: 84  LEISPEELP---LVITVPPDLSAGTRSKYLELALEKLKVPVFQMVVEPLAISLSLG-RNT 139

Query: 392 TCVVDIGATTTKIACVDEGLVIDNSVITLDYGGD 425
           + VVDIGA+   +  + +G V+  +V+   + GD
Sbjct: 140 SLVVDIGASKITVTPIIDGSVVKPAVLRSKFAGD 173

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 4/95 (4%)

Query: 331 KIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGD 390
           ++ V P ++P   V I VP          F  L++  L+   + +I E LA     G   
Sbjct: 84  QLRVGPEELP---VCITVPPDLSATVRSQFHELVLCKLRAPVLQLISEPLAVTLSLG-RS 139

Query: 391 STCVVDIGATTTKIACVDEGLVIDNSVITLDYGGD 425
           +  VVD+GA+   +  + +G V+   ++   Y GD
Sbjct: 140 TALVVDVGASKVTVTPIVDGSVVKTGILRSRYAGD 174

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 72/180 (40%), Gaps = 20/180 (11%)

Query: 341 NYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGAT 400
           N K+++  P        E    ++     F  V V  +++ + Y  G+  S  VVD G  
Sbjct: 103 NGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDG 161

Query: 401 TTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLK 460
            T I  V E +V+ +    LD  G D+T+     L    + +     N    +  + Q+K
Sbjct: 162 VTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIK 216

Query: 461 EK--YATFQDADVTIQLYNFIKRIPNKPGAEKFEF------KVFDEVMTAPMGLFFPHIL 512
           EK  Y ++ D D+  +L      +      E +E       KV  E   AP  LF P ++
Sbjct: 217 EKLCYVSY-DLDLDTKLARETTTL-----VESYELPDGRTIKVGQERFEAPECLFQPGLV 270

>ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 465

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 7/98 (7%)

Query: 331 KIDVRPSQIPNYKVVIVVPDA---FDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAG 387
           ++ + PS++P   ++I VP +    D   V  +  L    L+   + ++ E LA      
Sbjct: 93  QLQIDPSELP---LIISVPASSSEVDMKIVHKYFELAFEKLRVPTLQIVVEPLAIALSMS 149

Query: 388 IGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGD 425
              S  V+DIGA   KI  V +G V+ + V+   + GD
Sbjct: 150 -KSSALVIDIGARECKITPVIDGTVVKSGVMKSKFAGD 186

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 39.3 bits (90), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 342 YKVVIVVPDA---FDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIG 398
           Y +VI +P A    D+  ++ +  L         + +I E LA     G   S+ VV++G
Sbjct: 106 YPLVITIPSANKDVDEIILKKYFELAFETFNVPVLQIIIEPLAVALSLG-KSSSLVVNLG 164

Query: 399 ATTTKIACVDEGLVIDNSVITLDYGGD 425
           A+   +  + +G VI ++V+   YGGD
Sbjct: 165 ASGCNVTPIVDGTVIKHAVMKSKYGGD 191

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 67/163 (41%), Gaps = 20/163 (12%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F  V V  +++ + Y  G+  S  VVD G   T I  V E +V+++  
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLT 178

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATFQDADVTIQL 475
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++ D D+  +L
Sbjct: 179 RRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIKEKLCYVSY-DLDLDTKL 232

Query: 476 YNFIKRIPNKPGAEKFEF------KVFDEVMTAPMGLFFPHIL 512
                 +      E +E       KV  E   AP  LF P ++
Sbjct: 233 ARETTTL-----VESYELPDGRTIKVGQERFEAPECLFQPGLV 270

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 72/180 (40%), Gaps = 20/180 (11%)

Query: 341 NYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGAT 400
           N K+++  P        E    ++     F  V V  +++ + Y  G+  S  VVD G  
Sbjct: 103 NGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDG 161

Query: 401 TTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLK 460
            T I  V E +V+ +    LD  G D+T+     L    + +     N    +  + Q+K
Sbjct: 162 VTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIK 216

Query: 461 EK--YATFQDADVTIQLYNFIKRIPNKPGAEKFEF------KVFDEVMTAPMGLFFPHIL 512
           EK  Y ++ D D+  +L      +      E +E       KV  E   AP  LF P ++
Sbjct: 217 EKLCYVSY-DLDLDTKLARETTAL-----VESYELPDGRTIKVGQERFEAPECLFQPGLV 270

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 66/166 (39%), Gaps = 26/166 (15%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F  V V  +++ + Y  G+  S  VVD G   T I  V E +V+++  
Sbjct: 120 ERMCEVMFERYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLT 178

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATF--------- 466
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++         
Sbjct: 179 RRLDVAGRDVTRHLIDLLSRRGYSF-----NRTADFETVRQIKEKVCYVSYDLNLDTKLA 233

Query: 467 QDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512
           ++    +Q Y        K G E+FE         AP  LF P ++
Sbjct: 234 RETTTLVQEYELPDGRIIKVGQERFE---------APECLFQPDLV 270

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 4/87 (4%)

Query: 342 YKVVIVVP---DAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIG 398
           + +VI VP   DA     +E +  L         + VI E LA     G   S  VVD+G
Sbjct: 99  FPLVITVPIMKDAVALRVMERYFDLAFNKFNVPVLQVIIEPLAIALSMG-KSSALVVDLG 157

Query: 399 ATTTKIACVDEGLVIDNSVITLDYGGD 425
           +++  +  V +G V  NSV+   Y GD
Sbjct: 158 SSSCNVTPVIDGTVAKNSVLKSKYAGD 184

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 72/180 (40%), Gaps = 20/180 (11%)

Query: 341 NYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGAT 400
           N K+++  P        E    ++     F  V V  +++ + Y  G+  S  VVD G  
Sbjct: 103 NGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDG 161

Query: 401 TTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLK 460
            T I  V E +V+ +    LD  G D+T+     L    + +     N    +  + Q+K
Sbjct: 162 VTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIK 216

Query: 461 EK--YATFQDADVTIQLYNFIKRIPNKPGAEKFEF------KVFDEVMTAPMGLFFPHIL 512
           EK  Y ++ D D+  +L      +      E +E       KV  E   AP  LF P ++
Sbjct: 217 EKLCYVSY-DLDLDTKLARETTAL-----VESYELPDGRTIKVGQERFEAPECLFQPGLV 270

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 66/163 (40%), Gaps = 20/163 (12%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F  V V  +++ + Y  G+  S  VVD G   T I  V E +V+ +  
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLSHLT 178

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATFQDADVTIQL 475
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++ D D+  +L
Sbjct: 179 KRLDVAGRDVTRHLIDLLSRRGYAF-----NRSADFETVRQIKEKLCYVSY-DLDLDTKL 232

Query: 476 YNFIKRIPNKPGAEKFEF------KVFDEVMTAPMGLFFPHIL 512
                 +      E +E       KV  E   AP  LF P ++
Sbjct: 233 ARETTTL-----VENYELPDGRVIKVGSERFEAPECLFQPSLV 270

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 5/126 (3%)

Query: 337 SQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVD 396
           SQI ++ ++I           ET   +L     F A+ V   ++ S Y  G   + CV++
Sbjct: 107 SQIGDHPLLITEAPLNSTKNRETMCEILYETFNFDALYVAHPAVLSLYATG-QTTGCVLE 165

Query: 397 IGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLM 456
            G   +    V +G  + +S+  +D GG DIT+    ++ +S      L L S     ++
Sbjct: 166 CGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKST----GLSLFSNSEQEIV 221

Query: 457 EQLKEK 462
             +KEK
Sbjct: 222 RTIKEK 227

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 38.1 bits (87), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 22/103 (21%), Positives = 49/103 (47%)

Query: 333 DVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDST 392
           D   +++ N  ++++   ++ ++ +ET  + +   L+   +  +  SLA+ Y      + 
Sbjct: 100 DAFEAELSNIPLLLITHHSWSQSDLETITQYIFESLEINNLIQLPASLAATYSMISLQNC 159

Query: 393 CVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFL 435
           C++D+G   T I  + +   +D+ V +L  GG  I     K L
Sbjct: 160 CIIDVGTYHTDIIPIVDYAQLDHLVSSLPVGGQSINDSLKKLL 202

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 6/105 (5%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F  V V  +++ + Y  G+  S  V+D G   T I  V E +V+++  
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVIDSGDGVTHIVPVYESVVLNHLT 178

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK 462
             LD  G D+T+     L    + +     N    +  + Q+KEK
Sbjct: 179 RRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIKEK 218

>ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR033W
           (ARP9); 1-intron
          Length = 464

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 46/103 (44%)

Query: 333 DVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDST 392
           D   +   N  ++++   ++ +   E   + +  +++     V+  +L+  Y  G   + 
Sbjct: 93  DTWEAHASNIPMLLLTHYSWSQREQELITQYVFEEMRLNHFMVVPAALSISYAFGSIQNC 152

Query: 393 CVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFL 435
            V+DIGAT T I  + + + +D    +   GGDDI    A  L
Sbjct: 153 LVIDIGATHTDIVPIVDYVPLDYMAYSAPIGGDDINAKLATLL 195

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 66/163 (40%), Gaps = 20/163 (12%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    ++     F    V  +++ + Y  G+  S  VVD G   T I  V E +V+++  
Sbjct: 120 EQMCEVMFEKYDFGGTYVAIQAVLALYAQGL-SSGVVVDSGDGVTHIVPVYESVVLNHLT 178

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK--YATFQDADVTIQL 475
             LD  G D+T+     L    + +     N    +  + Q+KEK  Y ++ D D+  +L
Sbjct: 179 RRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIKEKLCYVSY-DLDLDTKL 232

Query: 476 YNFIKRIPNKPGAEKFEF------KVFDEVMTAPMGLFFPHIL 512
                 +      E +E       KV  E   AP  LF P ++
Sbjct: 233 ARETTTL-----VESYELPDGRVIKVGPERFEAPECLFQPSLV 270

>Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}
           similar to Ashbya gossypii ABR084W
          Length = 407

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 44/99 (44%)

Query: 337 SQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVD 396
           +Q+ N  + ++   ++ ++  E   + +   +K     ++  SLA+ Y  G   +  V+D
Sbjct: 41  AQVSNIPMFLITHYSWSQSEQEILTQFVFESMKLNNFMIMPNSLATSYAFGSLQNCVVID 100

Query: 397 IGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFL 435
           IG   T I  + +   ++    +   GGD I    A FL
Sbjct: 101 IGGAHTDIIPIVDYTPLEYLAYSAPVGGDAINAKLASFL 139

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 67/161 (41%), Gaps = 16/161 (9%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    LL       A+ V  +++ S Y +G   + CVVD G        V +G  I +S+
Sbjct: 120 ERMCELLFESFNVPALYVSIQAVLSLYASG-RTTGCVVDCGDGCCHAVPVFDGFSIPSSI 178

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYN 477
             +D  G DIT+ F + LL        + L S     ++  +KEK A +   D  I+  N
Sbjct: 179 RRIDIAGRDITE-FLQLLLRKT---TGVSLLSSSEREVVRIIKEK-ACYVAKDPHIEEQN 233

Query: 478 FIKRIPNKPGAEKFEF---KVFD---EVMTAPMGLFFPHIL 512
           F       P   KF+    K  D   E   AP  LF P ++
Sbjct: 234 F----SINPNYTKFKLPDGKTIDLGQEKFRAPEILFQPELI 270

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSM 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + +++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSVEKSYELPDGQV--ITIGNERFRAPEALFHPSVLSL 269

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAIMRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLSL 269

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 324 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 359

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 98  KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 156

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 157 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 211

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 212 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 254

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 340 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 375

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 114 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 172

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 173 PHAILRIDLAGRDMTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 227

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 228 MQTAAQSSAIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 270

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   ++L       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQILFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDMTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSAIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 269

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLSL 269

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P IL L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSILSL 269

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 340 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 375

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 69/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 114 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 172

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQ-DADVT 472
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK      D D  
Sbjct: 173 PHAILRIDLAGRDMTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDYDQE 227

Query: 473 IQLY---NFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
           +Q     + I++    P  +     + +E   AP  LF P +L L
Sbjct: 228 MQTAAQSSAIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 270

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 269

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 269

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 269

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 269

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 269

>KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033W ARP9
           Actin-related protein
          Length = 432

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 48/104 (46%), Gaps = 3/104 (2%)

Query: 332 IDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDS 391
            D+  S IP   ++++   ++    +ET  + +   L+      +  +LAS Y  G   +
Sbjct: 75  FDMELSNIP---MLMLSHSSWTHHQLETIAQFVFEQLQINNFMFLPSALASSYALGSLQN 131

Query: 392 TCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFL 435
             V+DI    T +  + + + + +  + +++GG  I +  AK L
Sbjct: 132 CVVIDIHTNGTDVIPILDYIQLGHLAVKVEHGGSQIDQELAKLL 175

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 67/165 (40%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSM 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            + ++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHGILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 269

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTASQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 269

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 269

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+ +KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            ++++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 269

>NDAI0C00580 Chr3 complement(110741..112246) [1506 bp, 501 aa] {ON}
           Anc_2.593 YMR033W
          Length = 501

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

Query: 337 SQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVD 396
           +++ N   +++    + +  +E   + +   LK     ++  SL++        + C++D
Sbjct: 108 TELSNIPFLLITHYTWSQPQLEKITQFIFESLKILNAMLLPSSLSTSVAMISLQNCCIID 167

Query: 397 IGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNF 440
           IG + T I  + +   +     TL  GGD+I K F K  L SNF
Sbjct: 168 IGKSHTDIIPIIDYTPLSFLASTLPMGGDNINK-FLKTQLPSNF 210

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 35.4 bits (80), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 3/76 (3%)

Query: 361 IRLLITDLKFQAVAVIQESLASCYGAGIGDSTC-VVDIGATTTKIACVDEGLVIDNSVIT 419
           + +L+  + F+A  +   S+ +C     G   C VVDIG  TT ++ V +G+ +  S + 
Sbjct: 132 LEILLEGMNFEACYL--SSVPTCVSFAAGRPNCLVVDIGHDTTSVSPVVDGMTLSKSSMR 189

Query: 420 LDYGGDDITKLFAKFL 435
               G  I  L  K+L
Sbjct: 190 NFIAGKYINTLIEKYL 205

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 5/93 (5%)

Query: 370 FQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITK 429
           F AV +   S  S Y +G   + CV+D G        + EG  + +S+  +D GG D+T+
Sbjct: 136 FAAVYIANPSTLSLYASG-RTTGCVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTE 194

Query: 430 LFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK 462
              +F +     Y  + L S     +++ +KEK
Sbjct: 195 QL-QFQIRK---YTGISLYSSSEHEIVKNVKEK 223

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 66/161 (40%), Gaps = 12/161 (7%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E   ++L       A  V  +++ S Y +G   +  V+D G   T +  +  G  + +++
Sbjct: 117 EKMTQILFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAI 175

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDADVTI 473
           + +D  G DIT    K L E  + +     ++     ++  +KEK       F+    T 
Sbjct: 176 LRIDLAGRDITDYLMKILAERGYSF-----STTAEREIVRDIKEKLCYVALDFEQEMQTA 230

Query: 474 QLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
              + +++    P  +     + +E   AP  LF P +L L
Sbjct: 231 SQSSAVEKSYELPDGQV--ITIGNERFRAPEALFHPSVLSL 269

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 22/36 (61%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+  KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKC 374

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 34.7 bits (78), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E   ++L       A+ V   ++ S Y +G   + CV+D G        + +G  +  S+
Sbjct: 125 EVMAQVLFETFNLPALYVSNPAVLSLYASG-RTTGCVIDCGEGYCSTVPIYDGFALPASM 183

Query: 418 ITLDYGGDDITK 429
           + +D GG DITK
Sbjct: 184 MRMDIGGRDITK 195

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 22/36 (61%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+  KC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKC 374

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 67/165 (40%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   ++L       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQILFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            + ++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHGILRIDLAGRDMTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSAIEKSYELPDGQV--ITIGNERFRAPEALFHPSLLGL 269

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 22/36 (61%)

Query: 736 TWKGGSVFARLKLIEELYVSESDWDILGSRILQYKC 771
            W GGS+ A L   +++++S+ ++D  G  I+  KC
Sbjct: 324 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKC 359

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 67/165 (40%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   ++L       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 98  KSNREKMTQILFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSL 156

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT----FQDA 469
            + ++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 157 PHGILRIDLAGRDMTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 211

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 212 MQTAAQSSAIEKSYELPDGQV--ITIGNERFRAPEALFHPSLLGL 254

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 68/160 (42%), Gaps = 12/160 (7%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E   ++L       A+ +   ++ S Y +G   + CVVD G        + +G  +  S+
Sbjct: 125 EVMAQVLFETFNLPALYISNPAVLSLYASG-RTTGCVVDCGEGYCSTVPIYDGFALPASI 183

Query: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATF-----QDADVT 472
           + +D GG DIT+     L +S      + L S     ++  +KEK         ++ D  
Sbjct: 184 MRMDIGGRDITEQLQFQLRKS----AGISLFSSSELEVVRMIKEKVCYLAKNIKKEEDRY 239

Query: 473 IQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512
           +Q ++ +  +   P  +  E  + ++   AP  LF P I+
Sbjct: 240 LQGHHDLGSVFKLPDGKCIE--IGNDRYRAPEILFSPQII 277

>YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa]
           {ON}  ARP9Component of both the SWI/SNF and RSC
           chromatin remodeling complexes; actin-related protein
           involved in transcriptional regulation
          Length = 467

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/103 (19%), Positives = 48/103 (46%)

Query: 333 DVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDST 392
           D   +++ N  ++++   ++ ++ +E   + +   L+   +  +  SLA+ Y      + 
Sbjct: 100 DAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNC 159

Query: 393 CVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFL 435
           C++D+G   T I  + +   +D+ V ++  GG  I     K L
Sbjct: 160 CIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLL 202

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 5/100 (5%)

Query: 363 LLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDY 422
           LL      QA+ V   ++ S Y +G   S CV+D G   +    V +G  + +++  +D 
Sbjct: 127 LLFESFGVQALYVANPAVLSLYASG-KISGCVLDCGDGYSCSVPVYQGYTLKSAIKRIDL 185

Query: 423 GGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK 462
           GG D+T+     L +S      L L +     L+  +KEK
Sbjct: 186 GGRDLTEQLQLQLRKST----GLSLTTSGEMELVRMIKEK 221

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E   +++       A+ V   ++ S Y +G   + CVVD G        + +G  +  S+
Sbjct: 125 EMIAQVMFETFNLSAIYVSDPAVLSLYASG-RTTGCVVDCGEGYCSSVPIYDGFALPASI 183

Query: 418 ITLDYGGDDITK 429
           + +D GG DIT+
Sbjct: 184 MRMDIGGGDITE 195

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 93/226 (41%), Gaps = 30/226 (13%)

Query: 293 VRHPFWKGRFNIESPDYGSLQELLVDVSELLKFALSQPKIDVRPSQIPNYKVVIVVPDAF 352
           +RHP   G       D+ +L++L   V E            ++ S + ++ V++      
Sbjct: 72  LRHPLEHGVVT----DWNALEQLWGHVFEK----------GLQLSSLQDHPVLVTEAPLN 117

Query: 353 DKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLV 412
            K   E    LL       AV V  +++ S Y +G   + CV+D G   +    V +G  
Sbjct: 118 PKKNREQMCELLFETFSVPAVYVSIQAVLSLYASG-RTTGCVLDSGDGCSHAVPVYDGYT 176

Query: 413 IDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATF------ 466
           + +++  +D  G DI++L    + +S      + L S     ++  +KEK          
Sbjct: 177 LPSAIRRIDIAGRDISELLQVLIRKST----GVSLLSSSEREIVRIIKEKACYIALDPKE 232

Query: 467 QDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512
           ++ + T+     + R+P+       + ++ +E   AP  LF P ++
Sbjct: 233 EEKNYTMHGKQTMFRLPDGK-----QIELDNEKFRAPEILFNPQLI 273

>Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/103 (19%), Positives = 48/103 (46%)

Query: 333 DVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDST 392
           D   +++ N  ++++   ++ ++ +E   + +   L+   +  +  SLA+ Y      + 
Sbjct: 100 DAFEAELSNIPLLLITHHSWSQSDLERITQYVFESLEINNLIQLPASLAATYSMISLQNC 159

Query: 393 CVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFL 435
           C++D+G   T I  + +   +D+ V ++  GG  I     K L
Sbjct: 160 CIIDVGTYHTDIIPIVDYAQLDHLVSSIPIGGQSINDSLKKLL 202

>TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 461
           aa] {ON} Anc_2.593 YMR033W
          Length = 461

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 45/99 (45%), Gaps = 3/99 (3%)

Query: 337 SQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVD 396
           S IP   +++V   ++ +  +E   + +   L+     ++  SLAS Y      + C++D
Sbjct: 106 SSIP---LLMVAHHSWSQIQLEVITQFVFEALQINNALLLPASLASSYAMSSLQNCCIID 162

Query: 397 IGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFL 435
           IG T T I  + +   ++     + YGG  I    +K L
Sbjct: 163 IGTTHTDIIPIIDYTPLEALSSKIAYGGQLINDQLSKQL 201

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 372 AVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITK 429
           ++ V   S+ S Y +G   + CVVD G        + EG V+  S+  ++ GG DIT+
Sbjct: 138 SLYVANPSVLSLYASG-NTTGCVVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITE 194

>TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.448
           YPR034W
          Length = 482

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 352 FDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGL 411
            +K   E + +L     +   + +I   LA  +  G   S  VVDIGA T ++  + +G 
Sbjct: 132 LEKQIKEEYYKLAFEKFRIPILYLIPSPLAIAFSLG-KKSALVVDIGAKTCQVTPILDGT 190

Query: 412 VIDNSVITLDYGGD 425
           +I ++V+   + GD
Sbjct: 191 IIKDAVMKSKFAGD 204

>Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/103 (18%), Positives = 48/103 (46%)

Query: 333 DVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDST 392
           D   +++ N  ++++    + ++ +E   + +   L+   +  +  SLA+ Y      + 
Sbjct: 100 DAFEAELSNIPLLLITHHFWSQSDLERITQYIFESLEINNLIQLPASLAATYSMISLQNC 159

Query: 393 CVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFL 435
           C++D+G   T +  + +   +D+ V ++  GG  I +   K L
Sbjct: 160 CIIDVGTYHTDVIPIVDYAQLDHLVSSIPMGGQSINESLKKLL 202

>KLLA0F24310g Chr6 complement(2267285..2268013) [729 bp, 242 aa]
           {ON} similar to uniprot|P53915 Saccharomyces cerevisiae
           YNL129W NRK1 Nicotinamide riboside kinase catalyzes the
           synthesis of nicotinamide nucleotide (NMN) from
           nicotinamide riboside involved in a salvage pathway for
           NAD biosynthesis
          Length = 242

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 51/111 (45%), Gaps = 22/111 (19%)

Query: 388 IGDSTC--VVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDL 445
           I D  C   +DI A   ++  + E  +I + +I  D   DDITK                
Sbjct: 56  IADWDCPEALDIPAFKRELDQIKETGLIKSKLIHND-NVDDITKF--------------- 99

Query: 446 DLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVF 496
           D+ SPE W   + LK KYA  Q++D+ I L +      ++   +KF+ K+F
Sbjct: 100 DI-SPEDW---DSLKRKYAIVQNSDLKIVLVDGFMIFNDEELTKKFDIKIF 146

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E  + +        A+ V    + S Y +G   + CVVD G        V EG  + +S+
Sbjct: 122 EKMLEVFFETFNIPAICVSIPGVLSLYASG-RTTGCVVDCGEGYCSSVPVCEGYTLASSI 180

Query: 418 ITLDYGGDDITK 429
             ++ GG D+TK
Sbjct: 181 KRINLGGIDVTK 192

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 348 VPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACV 407
           +PDA    Y+E    + +  LK     ++ E LA     G  ++  VVD+GA  + +  +
Sbjct: 98  LPDAVRAQYLE----MALGRLKIPVFQLVVEPLAVALSLG-RNTALVVDVGAAKSTVTPI 152

Query: 408 DEGLVIDNSVITLDYGGD 425
            +G V+  +V    + GD
Sbjct: 153 IDGTVVQTAVARSKFAGD 170

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 68/155 (43%), Gaps = 29/155 (18%)

Query: 372 AVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLF 431
           AV V  +++ + Y AG   + CV+D G    +   V +G  + +++  +D  G DIT+ F
Sbjct: 137 AVYVSIQAVLALY-AGGRTTGCVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITE-F 194

Query: 432 AKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIK----------R 481
            + LL  +        +  E   ++  +KEK A F   DV  +  N+            +
Sbjct: 195 LQLLLRKSSGVTLSSSSERE---IVRMIKEK-ACFVATDVGNEEQNYEGANSAELETRFK 250

Query: 482 IPNKP----GAEKFEFKVFDEVMTAPMGLFFPHIL 512
           +P+      GAEKF          AP  LF PH++
Sbjct: 251 LPDGKILTLGAEKFR---------APEVLFQPHLI 276

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 67/165 (40%), Gaps = 12/165 (7%)

Query: 354 KAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVI 413
           K+  E   +++       A  V  +++ S Y +G   +  V+D G   T +  +  G  +
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSM 171

Query: 414 DNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYA----TFQDA 469
            + ++ +D  G D+T    K L E  + +     ++     ++  +KEK       F+  
Sbjct: 172 PHGILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREIVRDIKEKLCYVALDFEQE 226

Query: 470 DVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514
             T    + I++    P  +     + +E   AP  LF P +L L
Sbjct: 227 MQTAAQSSSIEKSYELPDGQV--ITIGNERFRAPEALFHPSVLGL 269

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 2/79 (2%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E    +L       AV V  +++ S Y +G   + CV+D G        V +G  + +S+
Sbjct: 122 EAMCEMLFETFNVPAVYVSIQAVLSLYASG-RTTGCVLDCGDGCCHSVPVFDGFSLPSSI 180

Query: 418 ITLDYGGDDITKLFAKFLL 436
             +D  G D+T+ F + LL
Sbjct: 181 RRIDVAGRDVTE-FLQLLL 198

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E   ++L       A+ V   ++ S Y +G   + CVVD G        + +G  +  S+
Sbjct: 125 EQMAQVLFETFDVSALYVSNPAVLSLYASG-RTTGCVVDCGEGYCSTVPIYDGFALPASM 183

Query: 418 ITLDYGGDDITK 429
           + +D GG DIT+
Sbjct: 184 MRMDIGGADITE 195

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 61/147 (41%), Gaps = 27/147 (18%)

Query: 390 DSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNS 449
           D   V+D G   T I  + +G+    ++  LD GG  +T L  + L   ++   D  L  
Sbjct: 189 DYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-- 246

Query: 450 PEGWSLMEQLKEK---------YATFQDA----------DVTIQLYNFIKRIPNKPGAEK 490
                L+  +KEK         + +F+            D++     + +   +KP  E 
Sbjct: 247 -----LVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEG 301

Query: 491 FEF-KVFDEVMTAPMGLFFPHILRLLK 516
            +  K++DE+ + P   F P I R+LK
Sbjct: 302 SQVVKLYDELFSVPETFFHPEISRILK 328

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417
           E     L       A+ +   ++ S Y +G   + CVV+ G        + EG  +  S+
Sbjct: 124 EKMCETLFESFNIPALYIANPAVLSLYASG-RTTGCVVEAGDGYCSSVPIYEGFALTPSI 182

Query: 418 ITLDYGGDDITK 429
             +D GG DITK
Sbjct: 183 RRIDIGGRDITK 194

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 34/71 (47%), Gaps = 4/71 (5%)

Query: 496 FDEVMTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKK 555
           F++V T  +G+   H+  L+K+   P ++    Q P+   +  C D N +  S +     
Sbjct: 691 FNDVKTFQVGILMDHLEELIKEHGSPSSR----QDPKKSPVIICGDFNSQKDSAVYELLS 746

Query: 556 TTYCDMHRDLD 566
           T +   H+D+D
Sbjct: 747 TGHVQSHKDID 757

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,629,580
Number of extensions: 3862056
Number of successful extensions: 14298
Number of sequences better than 10.0: 158
Number of HSP's gapped: 14644
Number of HSP's successfully gapped: 181
Length of query: 775
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 658
Effective length of database: 40,065,477
Effective search space: 26363083866
Effective search space used: 26363083866
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)