Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14938g3.496ON2292299091e-125
Kwal_55.212483.496ON2222296882e-91
SAKL0F02618g3.496ON2532524602e-56
ZYRO0D09812g3.496ON1851703621e-42
Suva_16.4793.496ON2121613598e-42
Kpol_1017.43.496ON1841703524e-41
YPR151C (SUE1)3.496ON2061563535e-41
Smik_16.4033.496ON2031583526e-41
Skud_16.4453.496ON2151563293e-37
TPHA0D033003.496ON1961403118e-35
KNAG0A079603.496ON1771402984e-33
KLLA0E03983g3.496ON1911462979e-33
NDAI0B058903.496ON2781402933e-31
TDEL0D056403.496ON1241572527e-27
CAGL0L08426g3.496ON1401421971e-18
NCAS0F035703.496ON2301371863e-16
Ecym_12333.496ON87521764e-16
TBLA0D029403.496ON71561721e-15
KAFR0G037103.496ON79461521e-12
AFR315C3.496ON77671231e-08
ZYRO0F07480g8.682ON2361321312e-08
KNAG0J017608.682ON2581361189e-07
KLLA0D06061g8.682ON2491601171e-06
NCAS0C013108.682ON2571371152e-06
TDEL0A062708.682ON2421621118e-06
YPL159C (PET20)8.682ON2531431092e-05
Smik_6.3568.682ON2531481082e-05
Suva_16.1518.682ON2531411073e-05
Kpol_1072.128.682ON2221341063e-05
Skud_16.1238.682ON2551421046e-05
TPHA0G015708.682ON255361002e-04
TPHA0D012908.682ON218130983e-04
Kpol_1013.98.682ON261132993e-04
SAKL0H06380g8.682ON219143974e-04
TBLA0B038008.682ON324133950.001
KLLA0A07447g3.62ON486146950.001
KLTH0D11396g8.682ON22543830.029
Kwal_26.88288.682ON22343820.041
NDAI0K013208.682ON25835810.049
Ecym_23908.682ON22727760.24
KAFR0H023808.682ON22037740.38
NCAS0A099403.62ON49438750.45
TDEL0E007103.62ON47628740.54
SAKL0C12342g3.62ON552132740.63
Kpol_1066.443.62ON479136720.84
CAGL0M02101g8.682ON26748701.3
ZYRO0C02244g3.62ON46028692.4
TBLA0B027208.798ON50238692.4
TPHA0P012603.62ON49428665.2
NDAI0B051301.256ON82517666.5
Skud_14.423.62ON52428657.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14938g
         (229 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   354   e-125
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   269   2e-91
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   181   2e-56
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   144   1e-42
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   142   8e-42
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   140   4e-41
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   140   5e-41
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   140   6e-41
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   131   3e-37
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   124   8e-35
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   119   4e-33
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   119   9e-33
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   117   3e-31
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...   101   7e-27
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    80   1e-18
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    76   3e-16
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    72   4e-16
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    71   1e-15
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    63   1e-12
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    52   1e-08
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    55   2e-08
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    50   9e-07
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    50   1e-06
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    49   2e-06
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    47   8e-06
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    47   2e-05
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    46   2e-05
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    46   3e-05
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    45   3e-05
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    45   6e-05
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    43   2e-04
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    42   3e-04
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    43   3e-04
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    42   4e-04
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    41   0.001
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    41   0.001
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    37   0.029
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    36   0.041
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    36   0.049
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    34   0.24 
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    33   0.38 
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    33   0.45 
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    33   0.54 
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    33   0.63 
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    32   0.84 
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    32   1.3  
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    31   2.4  
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    31   2.4  
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    30   5.2  
NDAI0B05130 Chr2 complement(1254612..1257089) [2478 bp, 825 aa] ...    30   6.5  
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    30   7.3  

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  354 bits (909), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 179/229 (78%)

Query: 1   MAHKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60
           MAHKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP
Sbjct: 1   MAHKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60

Query: 61  LFKEAGWKTQRLRGERGARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSK 120
           LFKEAGWKTQRLRGERGARKSSTVPQSSEMNAMA               TWRYNPRIPSK
Sbjct: 61  LFKEAGWKTQRLRGERGARKSSTVPQSSEMNAMAGPLGTGGIGSGGVNGTWRYNPRIPSK 120

Query: 121 LLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESPHRPVAERSTDCKXXXXXXXXXXX 180
           LLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESPHRPVAERSTDCK           
Sbjct: 121 LLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESPHRPVAERSTDCKAGSSPTVTAAA 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXEHGEDNKLSKQVGEFINYLREKDRG 229
                                   EHGEDNKLSKQVGEFINYLREKDRG
Sbjct: 181 VAPATALPATGARAKAPARKRKPAEHGEDNKLSKQVGEFINYLREKDRG 229

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  269 bits (688), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 141/229 (61%), Positives = 151/229 (65%), Gaps = 7/229 (3%)

Query: 1   MAHKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60
           MA KRQF +EASKMLKR+SS+IFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP
Sbjct: 1   MAQKRQFCVEASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60

Query: 61  LFKEAGWKTQRLRGERGARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSK 120
           LFKE GWKTQRLR E G+  + T  + S  NAMA               TWRYNPRIPSK
Sbjct: 61  LFKETGWKTQRLREEPGSDTALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSK 120

Query: 121 LLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESPHRPVAERSTDCKXXXXXXXXXXX 180
           LLP++LWS TSMAMEYHPEWLAVPRTVVNKLRPF SP RP                    
Sbjct: 121 LLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSPERP-------DNAGGDSEATSAS 173

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXEHGEDNKLSKQVGEFINYLREKDRG 229
                                   E  +D KLSKQVG+FINYLREKDRG
Sbjct: 174 DTPAVQAAQAAQAKQHARKRKSSSEGSQDRKLSKQVGQFINYLREKDRG 222

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  181 bits (460), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 136/252 (53%), Gaps = 26/252 (10%)

Query: 1   MAHKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60
           M   R FS  A+ M+K+K+S+IFR LPKVPTTQ+LEP ELTRDIL+SGYRPV YPVKENP
Sbjct: 1   MKQSRLFSTTATNMIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENP 60

Query: 61  LFKEAGWKTQRLRGERGARK-----SSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNP 115
            F   G + + L GE  A+K     +    +  E N MA               TWRYNP
Sbjct: 61  FF-NIGTQRKGLAGETSAKKEYKNEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNP 119

Query: 116 RIPSKLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESP-------------HR--- 159
           RIP+KLLPYNLWS ++MAMEY+PEWL VP+T+ NKL+PF+ P             HR   
Sbjct: 120 RIPTKLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKDKKQYNPTHRCAF 179

Query: 160 --PVAERSTDCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEHGE--DNKLSKQ 215
              + E+    K                                   ++G+  D KLSKQ
Sbjct: 180 NGVLEEQLPFAKEEENKQQLSDNNSLVLEGEGVHKIKHAYMNYRKKKQNGKFLDKKLSKQ 239

Query: 216 VGEFINYLREKD 227
           V +FI YL+EK+
Sbjct: 240 VDQFIKYLKEKE 251

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  144 bits (362), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 102/170 (60%), Gaps = 13/170 (7%)

Query: 1   MAHKRQFSLEASKMLKRK--SSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKE 58
           M  KR FS    +  KRK  SS+IFRS+P+VPTTQ+LE  ELTRDIL+SGYRPV+YPVKE
Sbjct: 1   MMSKRLFSTATIRSFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKE 60

Query: 59  NPLFKEAGWKTQRLRGERGARKSSTVPQS----------SEMNAMAXXXXXXXXXXXXXX 108
           NPLFKE   +   L  E  +R +S + Q            E + +A              
Sbjct: 61  NPLFKERT-RNGELTDELQSRHNSGLRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGAS 119

Query: 109 XTWRYNPRIPSKLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESPH 158
            TWR   ++PSKLLPY+ WS TSM ME+ PEW  VPR VV KL+PF+  H
Sbjct: 120 GTWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFDRGH 169

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  142 bits (359), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 99/161 (61%), Gaps = 3/161 (1%)

Query: 12  SKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQR 71
           SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF++   K+ +
Sbjct: 51  SKLFKNAHFFDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQ 110

Query: 72  L---RGERGARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWS 128
           +     E+ A ++    +S   N                  TW+YNP +P++LLPYN WS
Sbjct: 111 MLLASDEKPATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWS 170

Query: 129 CTSMAMEYHPEWLAVPRTVVNKLRPFESPHRPVAERSTDCK 169
            +SM MEY PEW  VP  ++ KL+PF+   +  A+ S++ K
Sbjct: 171 TSSMGMEYFPEWKNVPSYMMRKLKPFDRALQLQAKHSSNKK 211

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  140 bits (352), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 74/170 (43%), Positives = 101/170 (59%), Gaps = 17/170 (10%)

Query: 2   AHKRQFSLEASKMLKRKSS----EIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVK 57
           ++ R +S    + +KRK S     IFRSLP+VPTTQ+LE   LT DIL+SGYRP+ YPVK
Sbjct: 11  SYVRCYSSTPIRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVK 70

Query: 58  ENPLFKEAGWKTQRLRG------ERGARKSSTVPQ------SSEMNAMAXXXXXXXXXXX 105
           ENPLF+  G  T+ + G      E  +  +S + +      S E N ++           
Sbjct: 71  ENPLFRNTG-NTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSG 129

Query: 106 XXXXTWRYNPRIPSKLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFE 155
               TWR+NPR+PSKLLPY+ WS + M MEY+PEW  +PR VV  L+P++
Sbjct: 130 GVNGTWRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQ 179

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  140 bits (353), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 95/156 (60%), Gaps = 3/156 (1%)

Query: 3   HKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF 62
           H++     +SK+LK      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF
Sbjct: 35  HQQITKQRSSKILKNAHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 94

Query: 63  ---KEAGWKTQRLRGERGARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPS 119
              K    +T     E+   ++ T+ +    N +                TW+YNP +P+
Sbjct: 95  RDKKRKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPN 154

Query: 120 KLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFE 155
           +LLP+N WS +SM MEY PEW  VP  ++ KL+PF+
Sbjct: 155 ELLPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPFD 190

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  140 bits (352), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 72/158 (45%), Positives = 96/158 (60%), Gaps = 3/158 (1%)

Query: 3   HKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF 62
           H++     +SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF
Sbjct: 33  HQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 92

Query: 63  KEAGWKTQRL---RGERGARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPS 119
           ++   K+ ++     E    ++ T  +S   N +                TW+YNP +P+
Sbjct: 93  RDKKKKSLQMLLTADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPN 152

Query: 120 KLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESP 157
           +LLP+N WS +SM MEY PEW  +P  +  KL+PF+ P
Sbjct: 153 ELLPFNWWSTSSMGMEYFPEWRNIPSYMTRKLKPFDKP 190

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  131 bits (329), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 93/156 (59%), Gaps = 3/156 (1%)

Query: 3   HKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF 62
           H++     +SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF
Sbjct: 42  HQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 101

Query: 63  KEAGWKT-QRLRGERGARKSSTVPQSSEM--NAMAXXXXXXXXXXXXXXXTWRYNPRIPS 119
           ++    + Q L     A  +       +M  N +                TW+YNP +P+
Sbjct: 102 RDKKRDSLQMLLAPDEAPAAEAKATEKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPN 161

Query: 120 KLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFE 155
           +LLP+N WS +SM MEY PEW  VP  ++ KL+PF+
Sbjct: 162 ELLPFNWWSTSSMGMEYFPEWKNVPSYMMRKLKPFD 197

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  124 bits (311), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 84/140 (60%), Gaps = 4/140 (2%)

Query: 20  SEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAG-WKTQRLRGERGA 78
           + IF++LP+VPTT+YLE  +LT DIL+SGYRP+ YPVKENPLF+    +    L  +   
Sbjct: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQ 107

Query: 79  RKSSTV-PQSSE--MNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAME 135
            K++ V PQ +    + +                TW+YNP +P  LLPYN WS + M ME
Sbjct: 108 EKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGME 167

Query: 136 YHPEWLAVPRTVVNKLRPFE 155
           Y+PEW  VPR  +  L+PFE
Sbjct: 168 YYPEWNNVPRRFLKTLKPFE 187

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  119 bits (298), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 81/140 (57%), Gaps = 10/140 (7%)

Query: 22  IFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAG------WKTQRLRGE 75
           +FR LPKVP T+YLE  EL +DILYSGYRPV+YPV+ENPLF+ +              G 
Sbjct: 31  MFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGT 90

Query: 76  RGARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAME 135
            G  + S    +     +                TW+Y P+IP K+LP+N WS +S+AME
Sbjct: 91  EGTHRDSQTVNTE----LFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAME 146

Query: 136 YHPEWLAVPRTVVNKLRPFE 155
            +PEW +VP+ VV  L+PF+
Sbjct: 147 VYPEWSSVPKHVVKGLKPFD 166

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  119 bits (297), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 89/146 (60%), Gaps = 9/146 (6%)

Query: 16  KRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGE 75
           K K+++++R LP+VPTT++L P ELT DIL+SGYRP++ P+++NPLF+    K + L  E
Sbjct: 5   KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQA---KVKELEVE 61

Query: 76  R----GARKSSTVPQSSEMN--AMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSC 129
           R    G +  S    +SE     MA               TWRYNPRIP+KLL   LWS 
Sbjct: 62  REKNGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSS 121

Query: 130 TSMAMEYHPEWLAVPRTVVNKLRPFE 155
           ++M ME++PEW  VP  V   L+P++
Sbjct: 122 SAMGMEFYPEWNDVPNKVSASLKPYQ 147

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  117 bits (293), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 82/140 (58%), Gaps = 5/140 (3%)

Query: 20  SEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGAR 79
           + IFR++PKVP T+YLE  EL++D+LYSGYRP++YPVKENPLF+    K           
Sbjct: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFSTT 185

Query: 80  KSSTV----PQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAME 135
            SS+     PQ  +M                   TWRY+PRIP+ LLP  +WS + M ME
Sbjct: 186 SSSSSEKKKPQQEQMKK-HYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGME 244

Query: 136 YHPEWLAVPRTVVNKLRPFE 155
           Y+PEW  VP  +V  L+PF+
Sbjct: 245 YYPEWKGVPFNIVKNLKPFD 264

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score =  101 bits (252), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 86/157 (54%), Gaps = 46/157 (29%)

Query: 5   RQFSLEASKMLKRKS--SEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF 62
           R+FS  +S++ +RKS   ++FR+LP+VPTT++LE   L+ DIL+SGYRPV+YPV+ENPLF
Sbjct: 12  RRFS-TSSRVWRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF 70

Query: 63  KEAGWKTQRLRGERGARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLL 122
              G KT+              P S E N                       PR      
Sbjct: 71  GR-GTKTE-------------APASLESNL----------------------PR------ 88

Query: 123 PYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESPHR 159
            Y+LWS T+M +E  PEW  VPR VV KLRPF+  HR
Sbjct: 89  -YDLWSTTTMGLERFPEWSNVPREVVRKLRPFDRHHR 124

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 75/142 (52%), Gaps = 14/142 (9%)

Query: 17  RKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGER 76
           ++ +EIFR LPKVP T+YLE   L+ D+LY+GYRP++YP++ENPL   +  +     GE 
Sbjct: 2   KRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE- 60

Query: 77  GARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKL---LPYNLWSCTSMA 133
               SS   Q  +   +                  R     PSK+   L Y++     M 
Sbjct: 61  ----SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMAD-PSKVKLGLSYSI-----MG 110

Query: 134 MEYHPEWLAVPRTVVNKLRPFE 155
           MEY+PEW  VPR VV +++P+E
Sbjct: 111 MEYYPEWEKVPRDVVKRIKPYE 132

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 76.3 bits (186), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 70/137 (51%), Gaps = 33/137 (24%)

Query: 19  SSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGA 78
           S+ IFR LPKVP T+YLE  +L+++IL++GY+P++YPV+ENPLFK       +++ E   
Sbjct: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK------LKIKQEDAK 167

Query: 79  RKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAMEYHP 138
           R++      +E  A+                                +WS + + ++ +P
Sbjct: 168 REN-----GNEKRALGSSVSHKYK----------------------GIWSTSILGLQDYP 200

Query: 139 EWLAVPRTVVNKLRPFE 155
           EW  VP   +  L+PF+
Sbjct: 201 EWNNVPWNNIKNLKPFD 217

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 72.4 bits (176), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 32/52 (61%), Positives = 40/52 (76%)

Query: 14 MLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEA 65
          M+K K  EI R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLF+ +
Sbjct: 1  MVKGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSS 52

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 70.9 bits (172), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%)

Query: 13 KMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWK 68
          +++ R S  + R LP+VPTT+YLE   L  DI +SGYRPV+YPVKENPLF+    K
Sbjct: 6  QVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELK 61

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 63.2 bits (152), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 38/46 (82%)

Query: 17 RKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF 62
          R  S + ++LP+VPTT+YL+ ++L  DILY+GYRPV+YP+KENPL 
Sbjct: 2  RGGSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 52.0 bits (123), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 10/67 (14%)

Query: 21 EIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFK----------EAGWKTQ 70
          + FR LP+VP+TQ+L   ++  DIL+S +RP+ YPV +NPL +          +    T+
Sbjct: 5  QFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPAESTK 64

Query: 71 RLRGERG 77
          R  G RG
Sbjct: 65 RDDGSRG 71

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 53/132 (40%), Gaps = 37/132 (28%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGARKSSTVP 85
           LP+VP+T YL P +++  ILYSGYRP+     E    ++ G          GAR      
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRPLFLNPDELKTSQDGG------NANNGARLYEFAM 141

Query: 86  QSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAMEYHPEWLAVPR 145
           +  E+   +                               LW+ ++   E +PEW  VP 
Sbjct: 142 KLEELGEQS-------------------------------LWTSSATGQEIYPEWDYVPM 170

Query: 146 TVVNKLRPFESP 157
            V  KL+PF +P
Sbjct: 171 EVQRKLKPFNAP 182

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 62/136 (45%), Gaps = 32/136 (23%)

Query: 23  FRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGARKSS 82
           +  LP VP+TQ++E  ++  ++LYSGYR         PLF ++   T   RG   A++ +
Sbjct: 93  YHPLPSVPSTQHIEANDMCTELLYSGYR---------PLFLDS---TALERGLLAAKEQA 140

Query: 83  TVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKL-LPYNLWSCTSMAMEYHPEWL 141
           +  QS+                     T      I  KL  P  +W+ ++  +E + EW 
Sbjct: 141 SFTQSAS-------------------PTGSTFYEIAMKLEDPACIWANSATGLEKYTEWD 181

Query: 142 AVPRTVVNKLRPFESP 157
            +P +V N L+PF  P
Sbjct: 182 NIPYSVANSLKPFVPP 197

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 62/160 (38%), Gaps = 56/160 (35%)

Query: 13  KMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYP---VKENPLFKEAGWKT 69
           KM  +K S  +  LP+VPTT+++   E   D+LYSGYRP++      KEN L + A  K 
Sbjct: 99  KMATKKLSRDYSWLPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQFA-MKL 157

Query: 70  QRLRGERGARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSC 129
           ++L        S  VP                                         W  
Sbjct: 158 EKL--------SEPVP-----------------------------------------WVS 168

Query: 130 TSMAMEYHPEWLAVPRTVVNKLRPFESPHRPVAERSTDCK 169
           ++   E+  EW  VP  ++  L+PF   H P  E + + K
Sbjct: 169 SATGQEFFSEWDNVPSEIIKDLKPF---HPPSIEETNNAK 205

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 59/137 (43%), Gaps = 30/137 (21%)

Query: 23  FRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGARKSS 82
           + +LPKV     L   E++ DILYSGYRP+    K+         +    + E G   +S
Sbjct: 87  YSTLPKVEPITNLRHNEISTDILYSGYRPLFLNFKD--------LENSSRKAEFGNSNNS 138

Query: 83  TVPQ-SSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTS-MAMEYHPEW 140
           T+ + + +++ ++                    P   S     N W  TS   ME   EW
Sbjct: 139 TLYEIAMKLDDLS--------------------PEAISGSTSSNFWHSTSATGMEVFDEW 178

Query: 141 LAVPRTVVNKLRPFESP 157
             VP +++  L+PF++P
Sbjct: 179 DNVPNSILKNLKPFQAP 195

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 71/162 (43%), Gaps = 39/162 (24%)

Query: 2   AHKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPL 61
           + +++ ++E S   +++    +  LP+VP+T  L+P +++  +LYSGYRP+      NP 
Sbjct: 72  SQQKKMTVEISGRGRKQQRHDYSWLPRVPSTGNLKPRDMSMKVLYSGYRPLFI----NP- 126

Query: 62  FKEAGWKTQRLRGERGARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKL 121
                                 +  SSE +                   + +  ++  +L
Sbjct: 127 --------------------DEIKTSSEGSGTG-------------GTLYEFAMKL-EEL 152

Query: 122 LPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESPHRPVAE 163
              + W  ++  +EY+ EW ++P  +  KL+PF +P +  ++
Sbjct: 153 GDQSPWVTSATGLEYYREWDSIPGELQKKLKPFTAPEQAASD 194

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 62/143 (43%), Gaps = 42/143 (29%)

Query: 15  LKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRG 74
           LK+K S+ F  LP+VP+T +L+ +++T ++LYSGYRP+      NP          +L+ 
Sbjct: 93  LKKKRSD-FSWLPRVPSTSHLKQSDMTTNVLYSGYRPLFI----NP-------NDPKLKE 140

Query: 75  ERGARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAM 134
           + G+       +  ++N                               P + W  ++  +
Sbjct: 141 DTGSTLYEFAMKLEDLNE------------------------------PLSPWISSATGL 170

Query: 135 EYHPEWLAVPRTVVNKLRPFESP 157
           E+  EW  +P  ++  L+PF  P
Sbjct: 171 EFFSEWENIPSELLKNLKPFHPP 193

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 64/148 (43%), Gaps = 42/148 (28%)

Query: 16  KRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGE 75
           K+K S+ F  LPKVP+T +L+ +++T ++LYSGYRP+      NP          +L+ +
Sbjct: 94  KKKRSD-FSWLPKVPSTSHLKQSDMTTNVLYSGYRPLFI----NP-------NDPKLKED 141

Query: 76  RGARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAME 135
            G+       +  ++N                               P + W  ++  +E
Sbjct: 142 TGSTLYEFAMKLEDLNE------------------------------PLSPWISSATGLE 171

Query: 136 YHPEWLAVPRTVVNKLRPFESPHRPVAE 163
           +  EW  +P  ++  L+PF  P+  + +
Sbjct: 172 FFSEWDNIPSELLRNLKPFHPPNEKLIQ 199

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 58/141 (41%), Gaps = 41/141 (29%)

Query: 17  RKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGER 76
           RK    F  LP+VP+T +L+ +++T ++LYSGYRP+      NP          +L+ + 
Sbjct: 94  RKKRRDFSWLPRVPSTSHLKHSDMTTNVLYSGYRPIFI----NP-------NDPKLKEDT 142

Query: 77  GARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAMEY 136
           G+       +  ++N                               P + W  ++  +E+
Sbjct: 143 GSTLYEFAMKLDDLNE------------------------------PLSPWISSATGLEF 172

Query: 137 HPEWLAVPRTVVNKLRPFESP 157
             EW  +P  ++  L+PF  P
Sbjct: 173 FSEWENIPSELLKNLKPFHPP 193

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 55/134 (41%), Gaps = 42/134 (31%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPV-IYPVK-ENPLFKEAGWKTQRLRGERGARKSST 83
           LPKVP+ + L   ++T DI YSG+RP+ I P + EN     + W    L  +      S 
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPLSIDPTELENKDEDSSTWYEVSLTLD------SP 150

Query: 84  VPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAMEYHPEWLAV 143
           VP S   +                                  +W+ ++  ME + EW +V
Sbjct: 151 VPPSGHNS----------------------------------IWTSSATGMERYREWHSV 176

Query: 144 PRTVVNKLRPFESP 157
           P  V+N L PF+ P
Sbjct: 177 PEEVINSLTPFQPP 190

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 58/142 (40%), Gaps = 41/142 (28%)

Query: 17  RKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGER 76
           RK    F  LP+VP+T +L+  ++T ++LYSGYRP+      NP          +L+ + 
Sbjct: 94  RKKRRDFSWLPRVPSTSHLKHTDMTTNVLYSGYRPLFI----NP-------NDPKLKEDT 142

Query: 77  GARKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAMEY 136
           G+       +  ++N                               P + W  ++  +E+
Sbjct: 143 GSTLYEFAMKLEDLNE------------------------------PLSPWISSATGLEF 172

Query: 137 HPEWLAVPRTVVNKLRPFESPH 158
             EW  +P  ++  L+PF  P+
Sbjct: 173 FSEWENIPSELLKNLKPFHPPN 194

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query: 23  FRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKE 58
           + SLPK PTT +L  +E   D+ YSGYRP+   V +
Sbjct: 103 YSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQ 138

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 52/130 (40%), Gaps = 35/130 (26%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGARKSSTVP 85
           LPKVP T  +   E+T + LYSGYRP+    K+  L  +     Q          SS   
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLLGDVNSTAQDAN-------SSIYE 147

Query: 86  QSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAMEYHPEWLAVPR 145
            + ++N ++                       PS       W  ++  +E + EW  VP 
Sbjct: 148 FAMKLNELSE----------------------PSP------WMMSATGLESYSEWDYVPS 179

Query: 146 TVVNKLRPFE 155
            V+ KL+P++
Sbjct: 180 KVIKKLKPYD 189

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 49/132 (37%), Gaps = 38/132 (28%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGARKSSTVP 85
           LPKVP+T+ L   E+    LYSGYRP+    K        G    +L G      +ST  
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPIYINSK--------GSGKNKLSGTMKNGVNSTFY 163

Query: 86  QSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAMEYHPEWLAVPR 145
           +                              I  KL   + W  ++  ME + EW  VP 
Sbjct: 164 E------------------------------IAMKLENPSPWMSSATGMELYSEWDHVPL 193

Query: 146 TVVNKLRPFESP 157
            V+  L+PF  P
Sbjct: 194 DVLKDLKPFHPP 205

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 59/143 (41%), Gaps = 45/143 (31%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGARKSSTVP 85
           LPK P+T++L+  E++ D+ YSGYR    P+  NP                   +S+   
Sbjct: 83  LPKAPSTEHLKLREISTDVFYSGYR----PIFLNP-------------ASPKESESTLYE 125

Query: 86  QSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAMEYHPEWLAVPR 145
            + ++ A+                    +P IP        W  ++   E++ EW  VP 
Sbjct: 126 FAMKLEALG-------------------DP-IP--------WVSSATGTEFYGEWDNVPT 157

Query: 146 TVVNKLRPFESPHRPVAERSTDC 168
            V+ KL+PF+ P   + ++  D 
Sbjct: 158 EVIKKLKPFQPPVDEMEKKDIDA 180

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 55/133 (41%), Gaps = 33/133 (24%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGARKSSTVP 85
           LPKVPT + L+  ++  ++LYSGYRP+         FK     T           SST+ 
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPLSID------FKALNDPTNIYDPYSSPNGSSTLY 220

Query: 86  QSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAMEYHPEWLAVPR 145
           +     AM                         S++ P   W  ++  +E + EW ++P 
Sbjct: 221 EF----AMQLQSL--------------------SEIFP---WMSSAAGLEVYSEWDSIPI 253

Query: 146 TVVNKLRPFESPH 158
            V+ KL+P +SP 
Sbjct: 254 EVLKKLKPLQSPQ 266

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 68/146 (46%), Gaps = 19/146 (13%)

Query: 16  KRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGE 75
           KRK+ + F  +P+VP+T YL   +L  + L++GY+P+   +  +PL  E+      L G 
Sbjct: 81  KRKAEKSFL-VPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPL--ESNNNDVLLDGL 135

Query: 76  RGA-RKSSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWR----YNPRIPSKLLPYNLWSCT 130
             + RK      +SE N +                 ++      P+IP        W  +
Sbjct: 136 FSSIRKLKNAQINSENNTVEIDVSDMLDDLKKDNQEYQRLHEKAPKIP--------WDAS 187

Query: 131 SMAMEYHPE-WLAVPRTVVNKLRPFE 155
              + Y+ E +  VPR+VV+KL+PF+
Sbjct: 188 ISGLVYNDEPFKGVPRSVVSKLKPFK 213

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%)

Query: 11  ASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVI 53
           AS++  ++    F  LPK P+T +L+  +++  +LYSGYRP +
Sbjct: 70  ASELRGKQRKTDFSWLPKAPSTDHLKHRDVSTTLLYSGYRPFV 112

 Score = 35.8 bits (81), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 127 WSCTSMAMEYHPEWLAVPRTVVNKLRPFESP 157
           W  ++   E++ EW  +P  V+ KLRPF+ P
Sbjct: 141 WISSATGTEFYGEWDNIPADVIKKLRPFQPP 171

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 36.2 bits (82), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 22/43 (51%)

Query: 127 WSCTSMAMEYHPEWLAVPRTVVNKLRPFESPHRPVAERSTDCK 169
           W  ++   E++ EW  VP  V+ +LRPF+ P    A +    +
Sbjct: 141 WISSATGTEFYGEWDGVPADVIKQLRPFQPPADDGASKDKKAR 183

 Score = 35.8 bits (81), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 23  FRSLPKVPTTQYLEPAELTRDILYSGYRPVI 53
           F  LPK P+T +L+  +++  +LYSGYRP +
Sbjct: 82  FSWLPKAPSTDHLKQRDVSTTLLYSGYRPFV 112

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 35.8 bits (81), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 126 LWSCTSMAMEYHPEWLAVPRTVVNKLRPFESPHRP 160
           +W  ++  +E   EW  VP +V+  L+PF+ P  P
Sbjct: 156 IWDTSATGVETFTEWDNVPESVIRNLKPFQKPTSP 190

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 15  LKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYP 55
           L+RK    F  LPK+     L   +++  +LYSGYRP+  P
Sbjct: 83  LQRKKVLNFSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP 123

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPV 52
            P  P T++L+  ++  D+LYSGYRP+
Sbjct: 89  FPVAPKTEHLKEGDIAVDLLYSGYRPL 115

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 25/37 (67%)

Query: 23  FRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKEN 59
           + +LP+VP+T  ++  +L  ++L+S YRP+   +K +
Sbjct: 88  YSALPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
           {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 5/38 (13%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPV-----IYPVKE 58
           +PKVPTT Y+   E+  + L++GY+P+     + PVK+
Sbjct: 70  VPKVPTTDYIPSLEMQTEGLFAGYKPLFLGNHVLPVKK 107

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 20/28 (71%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVI 53
           LP+VP+T Y+   E+  + L++GYRP+ 
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLF 102

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 52/132 (39%), Gaps = 12/132 (9%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGARKSSTVP 85
           +P VP T Y+  +E+  + L++GY+P+   +  + L ++       L       K  T  
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPLF--LGNSSLDEKRADVLDGLFTSLTKIKKGTSA 218

Query: 86  QSSEMNAMAXXXXXXXXXXXXXXXTWRY-NPRIPSKLLPYNLWSCTSMAMEYHP-EWLAV 143
            + E+N                     +  P IP        W  +   M Y+   +  V
Sbjct: 219 PNGEINVQEILDDLQKDDTMETLKEKSHKKPVIP--------WDASISGMVYNDLPFKDV 270

Query: 144 PRTVVNKLRPFE 155
           PR VV KL+PF+
Sbjct: 271 PRNVVGKLKPFK 282

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 32.3 bits (72), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 55/136 (40%), Gaps = 13/136 (9%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIY---PVKENPLFKEAGWKTQRLRGERGARK-- 80
           LP+VP+T+ +   E+  D L++GYRP+     P+ +     E G +  R        K  
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLFLGNCPIDD----AEKGSELDRFLASFSDLKLL 129

Query: 81  SSTVPQSSEMNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPYNLWSCTSMAMEYHPE- 139
           ++    S E+                       N R    ++P   W  +   + Y+   
Sbjct: 130 NNEDSDSKEVKIEDILEDIQNDIRNATNEDIGDNSRTRKPVVP---WDASISGLIYNDRP 186

Query: 140 WLAVPRTVVNKLRPFE 155
           +  +P  VV+KL+PF+
Sbjct: 187 FKNIPNEVVSKLKPFK 202

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 9   LEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPV 56
           L++ K   +K    + +LP+V      +   ++ ++LYSGYRP+ + V
Sbjct: 99  LKSEKAQTKKKVYDYSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDV 146

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa]
          {ON} similar to gnl|GLV|KLLA0A07447g Kluyveromyces
          lactis KLLA0A07447g and weakly similar to YNL295W
          uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Hypothetical ORF
          Length = 460

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 26 LPKVPTTQYLEPAELTRDILYSGYRPVI 53
          +P+VP T Y+   E+  + L++GYRP+ 
Sbjct: 58 VPRVPPTDYISAPEIQTEGLFAGYRPLF 85

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 17  RKSSEIFRSLPKVPTTQYLEPAELTRDILYSG--YRPV 52
           +K   I+  LP +P T YL    L +DI+ SG  Y P+
Sbjct: 267 KKGQMIYNHLPSLPDTLYLNAKNLGQDIISSGPLYSPI 304

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVI 53
           +PKV +T  L  AE+  + L++GYRP+ 
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPLF 116

>NDAI0B05130 Chr2 complement(1254612..1257089) [2478 bp, 825 aa]
           {ON} Anc_1.256
          Length = 825

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (64%)

Query: 124 YNLWSCTSMAMEYHPEW 140
           YN+W CT   + +HP W
Sbjct: 406 YNIWGCTKRKVLFHPHW 422

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVI 53
           +PKV +T+Y+   E+  + L++GYRP+ 
Sbjct: 111 VPKVASTEYIPIKEVHTEGLFAGYRPLF 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,760,654
Number of extensions: 594107
Number of successful extensions: 1497
Number of sequences better than 10.0: 62
Number of HSP's gapped: 1506
Number of HSP's successfully gapped: 84
Length of query: 229
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 123
Effective length of database: 41,326,803
Effective search space: 5083196769
Effective search space used: 5083196769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)