Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14916gna 1ON1511517991e-111
KLLA0E04005gna 1ON1371375002e-65
Kwal_55.21247na 1ON1341344862e-63
SAKL0F02684gna 1ON1381384664e-60
Kwal_23.2807singletonON1291274602e-59
ZYRO0C18436gsingletonON1291274445e-57
KLLA0B14817gsingletonON1311294291e-54
SAKL0F16654gsingletonON1311284272e-54
KLTH0C11880gsingletonON1311284108e-52
TDEL0D00210singletonON1301313483e-42
ZYRO0D09856gna 1ON1561233452e-41
KLTH0E03168gsingletonON1481433139e-37
SAKL0F02640gsingletonON1161112979e-35
Kwal_47.16590singletonON1261262918e-34
YER057C (HMF1)7.238ON129991596e-14
ADL077C7.238ON142971581e-13
Skud_5.1717.238ON1291021571e-13
Smik_5.1877.238ON1291021526e-13
KAFR0I018307.238ON1431001529e-13
TDEL0H020607.238ON1771001531e-12
Suva_5.1657.238ON1291031483e-12
Kpol_1033.127.238ON1431001475e-12
NDAI0A025507.238ON1441001468e-12
ZYRO0C08074g7.238ON1431001423e-11
KNAG0D016207.238ON142991405e-11
NCAS0A134907.238ON1481001398e-11
NCAS0E032407.238ON1281031352e-10
Kwal_23.58047.238ON141991362e-10
TPHA0C011007.238ON1421041353e-10
YIL051C (MMF1)7.238ON1451001336e-10
NDAI0E047507.238ON1281031301e-09
CAGL0M12386g7.238ON142991311e-09
Smik_9.1397.238ON1451001283e-09
Kpol_1009.257.238ON127981257e-09
KNAG0L014507.238ON1311001257e-09
TBLA0D040907.238ON1551051259e-09
KAFR0L008607.238ON128971231e-08
Skud_9.1187.238ON1451001241e-08
SAKL0F08558g7.238ON1441021222e-08
KLLA0C08349g7.238ON140991213e-08
KLTH0A04224g7.238ON141991204e-08
Suva_9.1487.238ON1451001197e-08
TBLA0J014207.238ON1261001161e-07
TPHA0K009207.238ON1281071091e-06
Kpol_1036.868.349ON69769790.048
AGL164W8.349ON68683790.052
NCAS0C031508.349ON68988770.10
CAGL0M04521g8.349ON68883760.11
KLTH0G11594g8.349ON68484681.2
KLTH0G09130g2.232ON258578691.2
SAKL0E11154g2.143ON92337681.3
YLR143W8.349ON68591681.3
Suva_10.2398.349ON68985671.7
Kpol_1003.232.263ON68437652.8
Kpol_1027.34.39ON103631653.7
Ecym_30636.122ON60961635.8
KAFR0H021508.349ON70286636.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14916g
         (151 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakl...   312   e-111
KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {O...   197   2e-65
Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C...   191   2e-63
SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {O...   184   4e-60
Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C (H...   181   2e-59
ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa] ...   175   5e-57
KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakl...   169   1e-54
SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakl...   169   2e-54
KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {O...   162   8e-52
TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON}                 138   3e-42
ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {O...   137   2e-41
KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {O...   125   9e-37
SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {O...   119   9e-35
Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}...   116   8e-34
YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}  H...    66   6e-14
ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON} Sy...    65   1e-13
Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}...    65   1e-13
Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}...    63   6e-13
KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON...    63   9e-13
TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.23...    64   1e-12
Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}...    62   3e-12
Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON...    61   5e-12
NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON...    61   8e-12
ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {O...    59   3e-11
KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON...    59   5e-11
NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7....    58   8e-11
NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238      57   2e-10
Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {...    57   2e-10
TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.23...    57   3e-10
YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}  M...    56   6e-10
NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {...    55   1e-09
CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} simi...    55   1e-09
Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}...    54   3e-09
Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON...    53   7e-09
KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {O...    53   7e-09
TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7....    53   9e-09
KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {O...    52   1e-08
Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}...    52   1e-08
SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {O...    52   2e-08
KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar...    51   3e-08
KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {O...    51   4e-08
Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}...    50   7e-08
TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.2...    49   1e-07
TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.2...    47   1e-06
Kpol_1036.86 s1036 (225185..227278) [2094 bp, 697 aa] {ON} (2251...    35   0.048
AGL164W Chr7 (388842..390902) [2061 bp, 686 aa] {ON} Syntenic ho...    35   0.052
NCAS0C03150 Chr3 complement(617756..619825) [2070 bp, 689 aa] {O...    34   0.10 
CAGL0M04521g Chr13 (496157..498223) [2067 bp, 688 aa] {ON} simil...    34   0.11 
KLTH0G11594g Chr7 complement(975378..977432) [2055 bp, 684 aa] {...    31   1.2  
KLTH0G09130g Chr7 complement(746572..754329) [7758 bp, 2585 aa] ...    31   1.2  
SAKL0E11154g Chr5 complement(938270..941041) [2772 bp, 923 aa] {...    31   1.3  
YLR143W Chr12 (427329..429386) [2058 bp, 685 aa] {ON} Putative p...    31   1.3  
Suva_10.239 Chr10 (436127..438196) [2070 bp, 689 aa] {ON} YLR143...    30   1.7  
Kpol_1003.23 s1003 (59536..61590) [2055 bp, 684 aa] {ON} (59536....    30   2.8  
Kpol_1027.3 s1027 complement(3956..7066) [3111 bp, 1036 aa] {ON}...    30   3.7  
Ecym_3063 Chr3 complement(120315..122144) [1830 bp, 609 aa] {ON}...    29   5.8  
KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {O...    29   6.4  

>KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 151

 Score =  312 bits (799), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 151/151 (100%), Positives = 151/151 (100%)

Query: 1   MIQTLHPLLTSCVRKMAKKVTWQEVGATKGIDLLSPAFVTSGSKLVFTSGCIGSDPVTDE 60
           MIQTLHPLLTSCVRKMAKKVTWQEVGATKGIDLLSPAFVTSGSKLVFTSGCIGSDPVTDE
Sbjct: 1   MIQTLHPLLTSCVRKMAKKVTWQEVGATKGIDLLSPAFVTSGSKLVFTSGCIGSDPVTDE 60

Query: 61  LPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPAR 120
           LPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPAR
Sbjct: 61  LPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPAR 120

Query: 121 SCVVVSFPNPKIKVELECIAEVQPKARWFKL 151
           SCVVVSFPNPKIKVELECIAEVQPKARWFKL
Sbjct: 121 SCVVVSFPNPKIKVELECIAEVQPKARWFKL 151

>KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {ON}
           weakly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 137

 Score =  197 bits (500), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 116/137 (84%), Gaps = 1/137 (0%)

Query: 16  MAKKVTWQEVGATKGIDLLSPAFVT-SGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQ 74
           MA+K+TW++VG   G  L+SP F T SG++L+F+SGC+G+DPVT+ELPEDLEQQARN++ 
Sbjct: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60

Query: 75  NLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKV 134
           NL+ VLE SGS+ D VLK+LLFV+DG+Y+  VN++++E FPN PARSC+VV+FPN K+KV
Sbjct: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120

Query: 135 ELECIAEVQPKARWFKL 151
           ELECIAE+  K RWFKL
Sbjct: 121 ELECIAEIPSKKRWFKL 137

>Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 130] FULL
          Length = 134

 Score =  191 bits (486), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 88/134 (65%), Positives = 110/134 (82%)

Query: 16  MAKKVTWQEVGATKGIDLLSPAFVTSGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQN 75
           MA++VTW+EVG  KG  +L+PA+VTS S LVFTSGC+G+DPVT ELP DLEQQ RNAL+N
Sbjct: 1   MARQVTWKEVGPGKGYPILAPAYVTSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALEN 60

Query: 76  LRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKVE 135
           L+NVL ASGS+ ++V+KVLLFV+DG+Y+  VN++Y E FP +PARSC+VVSFPN  +KVE
Sbjct: 61  LKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKVE 120

Query: 136 LECIAEVQPKARWF 149
           LECIAE  P    F
Sbjct: 121 LECIAEAGPAKPKF 134

>SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {ON}
           conserved hypothetical protein
          Length = 138

 Score =  184 bits (466), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 108/138 (78%), Gaps = 2/138 (1%)

Query: 16  MAKKVTWQEVGATKGIDLLSPAFVT-SGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQ 74
           M  K TW+++GA +   LLSPAFVT S + LV+TSGC+G+DP T ELPEDLEQQ RNA++
Sbjct: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60

Query: 75  NLRNVLEASGSNS-DRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIK 133
           NLR VL  SG +S D+V+KVLLFVADG Y+  VN++Y+E F N P RSCVVV FPN KIK
Sbjct: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120

Query: 134 VELECIAEVQPKARWFKL 151
           VELEC+AE+  K RWFKL
Sbjct: 121 VELECVAEIDKKTRWFKL 138

>Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 246] FULL
          Length = 129

 Score =  181 bits (460), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 86/127 (67%), Positives = 103/127 (81%), Gaps = 1/127 (0%)

Query: 16  MAKKVTWQEVGATKGIDLLSPAFVTSGSK-LVFTSGCIGSDPVTDELPEDLEQQARNALQ 74
           MAK+V W  VG  KG D+LSPA+V S S  LVFTSGC+G+DPVT  LPEDLEQQ  NAL+
Sbjct: 1   MAKQVQWSAVGPGKGYDILSPAYVASKSNDLVFTSGCVGTDPVTGNLPEDLEQQIINALE 60

Query: 75  NLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKV 134
           NL+NVL ASGS+ +RVLKVLLFV+D +Y+ TVN +Y   FPN+PARSC+VV+FP P +KV
Sbjct: 61  NLKNVLHASGSSLERVLKVLLFVSDASYASTVNEVYSRYFPNAPARSCIVVAFPAPALKV 120

Query: 135 ELECIAE 141
           ELECIAE
Sbjct: 121 ELECIAE 127

>ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa]
           {ON} similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C
          Length = 129

 Score =  175 bits (444), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 82/127 (64%), Positives = 106/127 (83%), Gaps = 1/127 (0%)

Query: 16  MAKKVTWQEVGATKGIDLLSPAFVTSGSK-LVFTSGCIGSDPVTDELPEDLEQQARNALQ 74
           M  ++TW +VG   G  LLSPA+VT+ +K LVFTSGC+G+DP T  L E+L+QQ RNAL+
Sbjct: 1   MPTQITWNQVGPLGGSSLLSPAYVTADAKKLVFTSGCVGTDPKTGTLAEELDQQVRNALE 60

Query: 75  NLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKV 134
           NL+NVL+ASGS+ D VLKVLLFVADG+++  VN+IY+E FP +PARSC+VVSFP+PK+KV
Sbjct: 61  NLKNVLKASGSSIDNVLKVLLFVADGSFAAPVNKIYQEYFPGAPARSCIVVSFPDPKLKV 120

Query: 135 ELECIAE 141
           ELECIA+
Sbjct: 121 ELECIAQ 127

>KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 131

 Score =  169 bits (429), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 102/129 (79%), Gaps = 1/129 (0%)

Query: 16  MAKKVTWQEVGATKGIDLLSPAFVTS-GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQ 74
           M ++V W+EVG   G   L+PA+VTS  ++LV+TSGC+GSD +T E+PEDLE+Q RNAL 
Sbjct: 1   MVRRVEWKEVGVESGPTFLAPAYVTSKDTELVYTSGCVGSDLLTGEIPEDLEKQVRNALD 60

Query: 75  NLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKV 134
           NL  VL+AS S+ D VLK+LLFVADG+Y+ TVN +Y+E FP  PARSC+VVSFP+P +KV
Sbjct: 61  NLGRVLKASNSSFDDVLKILLFVADGSYASTVNAVYKEYFPERPARSCIVVSFPDPTLKV 120

Query: 135 ELECIAEVQ 143
           ELEC+A V 
Sbjct: 121 ELECVAAVS 129

>SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1
          Length = 131

 Score =  169 bits (427), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 78/128 (60%), Positives = 101/128 (78%), Gaps = 1/128 (0%)

Query: 16  MAKKVTWQEVGATKGIDLLSPAFVTSGSK-LVFTSGCIGSDPVTDELPEDLEQQARNALQ 74
           MA+K+ W +VG T G  LLSP F+ S  + ++FTSG +G+DP + E+PEDL  Q +NAL+
Sbjct: 1   MARKIEWNQVGVTSGHALLSPGFICSKDEDILFTSGNVGTDPKSGEVPEDLRAQTKNALE 60

Query: 75  NLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKV 134
           NL+  LEA GS+ D VLKVLLFVADG+Y+ TVN +Y+E FP SPARSC+VVSFP+PK+K+
Sbjct: 61  NLKTTLEAGGSSLDNVLKVLLFVADGSYAATVNEVYKEYFPGSPARSCIVVSFPDPKLKL 120

Query: 135 ELECIAEV 142
           ELECIA V
Sbjct: 121 ELECIAAV 128

>KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {ON}
           conserved hypothetical protein
          Length = 131

 Score =  162 bits (410), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 101/128 (78%), Gaps = 1/128 (0%)

Query: 16  MAKKVTWQEVGATKGIDLLSPAFVTSGS-KLVFTSGCIGSDPVTDELPEDLEQQARNALQ 74
           M +K+ W+EVG + G   LSP  V+S +  L+FTSGC+G+DP+T E PED+E QARNA++
Sbjct: 1   MVRKLKWEEVGVSNGPSFLSPGCVSSKNCDLLFTSGCVGNDPITGEYPEDVESQARNAME 60

Query: 75  NLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKV 134
           N++ VLE++ SN D VLK LLF++D +Y+  VN++Y+E FP  P+RSC+VVSFP+PK+K 
Sbjct: 61  NMKRVLESASSNFDYVLKALLFISDPSYASAVNKVYQEFFPGRPSRSCIVVSFPDPKLKF 120

Query: 135 ELECIAEV 142
           E+EC+AEV
Sbjct: 121 EMECVAEV 128

>TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON} 
          Length = 130

 Score =  138 bits (348), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 94/131 (71%), Gaps = 3/131 (2%)

Query: 16  MAKKVTWQEVGATKGIDLLSPAFVTS-GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQ 74
           MA ++ W++V       LLSP +VT+  S+L+FTSGC+G+D  + +L E +E Q + AL+
Sbjct: 1   MATQIQWEDVNGPSH-SLLSPGYVTAKNSQLLFTSGCVGTDK-SGKLAEGVEAQTKLALE 58

Query: 75  NLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKV 134
           NL+ VLEA GS+   VLKVLLFV DG+Y+  VN +Y+E FP  P RSCVVV+FP+P IKV
Sbjct: 59  NLKVVLEAGGSSLSNVLKVLLFVGDGSYASAVNSVYQEYFPGRPGRSCVVVAFPDPAIKV 118

Query: 135 ELECIAEVQPK 145
           ELEC+A V  K
Sbjct: 119 ELECVAVVPEK 129

>ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {ON}
           some similarities with uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1
          Length = 156

 Score =  137 bits (345), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 70/123 (56%), Positives = 90/123 (73%), Gaps = 4/123 (3%)

Query: 19  KVTWQEVGATKGIDLLSPAFV-TSGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLR 77
           +V W ++G +    LLSPAFV +S   LVFTSGC+G+D   D+LPE   +Q +NA +NL 
Sbjct: 28  RVDWNQLGTSN--PLLSPAFVVSSAHHLVFTSGCLGTDD-QDQLPECPAEQTKNAFENLS 84

Query: 78  NVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKVELE 137
            VLEASGS+   V+KVLLFV D A    VNRIY++ FP  PARSC+VV+FPNPK++VELE
Sbjct: 85  KVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELE 144

Query: 138 CIA 140
           C+A
Sbjct: 145 CVA 147

>KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {ON}
           conserved hypothetical protein
          Length = 148

 Score =  125 bits (313), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 92/143 (64%), Gaps = 5/143 (3%)

Query: 1   MIQTLHPLLTSCVRKMAKKVTWQEVGATKGIDLLSPAFVTSGSKLVFTSGCIGSDPVTDE 60
            I  LH L TS +  +AKK+TW+ +   K    LSPAFV++G   VFTSG IGS   T E
Sbjct: 11  FIYQLHDLGTSIM--VAKKITWESIEG-KEHPTLSPAFVSNGH--VFTSGIIGSKYGTGE 65

Query: 61  LPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPAR 120
           + + +E Q   A+QNL NVL  +GS+ ++V KV +F++   YS+ VN IY + FP  PAR
Sbjct: 66  VSQQIEDQVHLAIQNLENVLAVAGSSLEQVFKVTMFISHAEYSKVVNEIYGQYFPQKPAR 125

Query: 121 SCVVVSFPNPKIKVELECIAEVQ 143
           SCVVV+F +  IK ELE +A ++
Sbjct: 126 SCVVVAFMDAAIKYELEAVATLE 148

>SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {ON}
           some similarities with uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to mitochondria
          Length = 116

 Score =  119 bits (297), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 79/111 (71%), Gaps = 2/111 (1%)

Query: 33  LLSPAFV-TSGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNS-DRV 90
           + S AF+ TS + LV+TSGC+G+DP T ELPEDLEQQ RNA++NLR VL  SG +S D+V
Sbjct: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60

Query: 91  LKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKVELECIAE 141
           +KVLLFVADG Y    N++Y++ F N   +S  VV F N  IK+E   +A+
Sbjct: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAK 111

>Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}
           YER057C (HMF1) - heat-regulated protein [contig 376]
           FULL
          Length = 126

 Score =  116 bits (291), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 60/126 (47%), Positives = 83/126 (65%), Gaps = 7/126 (5%)

Query: 17  AKKVTWQEVGATKGID--LLSPAFVTSGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQ 74
           A+K+TW+   A KG +   LSP +V++G   VFTSG IG++  T E+P ++E Q   A++
Sbjct: 3   AEKITWE---AIKGKEHPTLSPGYVSNGH--VFTSGIIGANYGTGEVPHEIEDQVHLAIK 57

Query: 75  NLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKV 134
           NL  VL A GS+  +V KV +F++   YS+ VN IY   FP+ PARSCVVV+F +  IK 
Sbjct: 58  NLETVLVAGGSSLSKVFKVTMFISHADYSKVVNEIYGHYFPHKPARSCVVVAFMDAAIKY 117

Query: 135 ELECIA 140
           ELE IA
Sbjct: 118 ELEAIA 123

>YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}
           HMF1Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible;
           high-dosage growth inhibitor; forms a homotrimer in
           vitro
          Length = 129

 Score = 65.9 bits (159), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 58/99 (58%), Gaps = 1/99 (1%)

Query: 43  SKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAY 102
           + L+F SG I   P    +   +  +A   +QN++NVLEAS S+ DRV+KV +F+AD  +
Sbjct: 27  NNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADINH 86

Query: 103 SQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
               N +Y + F  + PARSCV V+     + +E+E IA
Sbjct: 87  FAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIA 125

>ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL051C
           (MMF1) and YER057C (HMF1)
          Length = 142

 Score = 65.5 bits (158), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 45  LVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQ 104
           +VF SG I   P    +   +  +    + N+RNVLEAS S  DRV KV +F+AD AY  
Sbjct: 42  MVFVSGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFA 101

Query: 105 TVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
             N +Y + F  + PARSCV V      + +E+E IA
Sbjct: 102 EFNSVYAKYFGEHKPARSCVAVRALPLNVDLEMEVIA 138

>Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 65.1 bits (157), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 62/102 (60%), Gaps = 7/102 (6%)

Query: 43  SKLVFTSGCIGSDPVTDE---LPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVAD 99
           + L+F SG I   PVT +   +   + ++A   LQN++NVLE+S S+ DRV+KV +F+AD
Sbjct: 27  NNLIFLSGQI---PVTQDNKLVEGSIAEKAEQVLQNVKNVLESSNSSLDRVVKVNIFLAD 83

Query: 100 GAYSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
             +    N +Y + F  + PARSCV V+     + +E+E IA
Sbjct: 84  IKHFAEFNSVYAKYFHTHKPARSCVAVAALPLGVDMEMEAIA 125

>Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 63.2 bits (152), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 61/102 (59%), Gaps = 7/102 (6%)

Query: 43  SKLVFTSGCIGSDPVTDE---LPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVAD 99
           + L+F SG I   PVT +   +   +  +A   +QN++NVLE+S S+ DRV+KV +F+AD
Sbjct: 27  NNLIFLSGQI---PVTSDNKLVEGSIADKAEQVIQNIKNVLESSNSSLDRVVKVNIFLAD 83

Query: 100 GAYSQTVNRIYREQFP-NSPARSCVVVSFPNPKIKVELECIA 140
             +    N +Y + F  + PARSCV V+     + +E+E IA
Sbjct: 84  INHFAEFNTVYAKYFSTHKPARSCVAVAALPLGVDMEMEAIA 125

>KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON}
           Anc_7.238 YIL051C
          Length = 143

 Score = 63.2 bits (152), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 57/100 (57%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
            +  V+ SG I   P    +   L  +A    QN++N+LEAS S+ ++++KV +F+AD  
Sbjct: 40  ANNFVYVSGQIPYTPDNKPVEGTLSDKANQVFQNVKNILEASNSSMNKIVKVNVFLADMK 99

Query: 102 YSQTVNRIYREQFP-NSPARSCVVVSFPNPKIKVELECIA 140
           + Q  N +Y + F  + PARSCV V+     + +E+E +A
Sbjct: 100 FFQEFNSVYAKYFNVHKPARSCVAVASLPLNVDLEVEVVA 139

>TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.238
           YIL051C
          Length = 177

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
            + L+F SG I   P    +   +  +A    +N+RN+LEAS S+ +RV+KV +F+AD  
Sbjct: 68  ANNLIFVSGQIPYTPENKPVEGSIADKAEQVFKNVRNILEASDSSFERVIKVNVFLADIN 127

Query: 102 YSQTVNRIYREQFP-NSPARSCVVVSFPNPKIKVELECIA 140
                N++Y + F  + PARSCV V+     + +E+E IA
Sbjct: 128 NFAEFNKVYAKYFSTHKPARSCVAVAALPLNVDLEMEVIA 167

>Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 61.6 bits (148), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 60/103 (58%), Gaps = 7/103 (6%)

Query: 42  GSKLVFTSGCIGSDPVTDE---LPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVA 98
            + L+F SG I   P+T +   +   +  +A   +QN+++VL AS S+ DR++KV +F+A
Sbjct: 26  ANNLIFLSGQI---PMTSDNKLVEGSIADKAEQVIQNIKDVLAASNSSLDRIIKVNIFLA 82

Query: 99  DGAYSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
           D  Y    N +Y + F  + PARSCV V+     + +E+E IA
Sbjct: 83  DIKYFAEFNSVYAKYFTTHKPARSCVAVAALPLNVDMEVEIIA 125

>Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON}
           complement(28172..28603) [432 nt, 144 aa]
          Length = 143

 Score = 61.2 bits (147), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
            + L+F SG I   P    +   +  +A     N+ N+LEAS S+ DRV+KV +F+ D  
Sbjct: 39  ANNLIFVSGQIPYTPENKPVEGSISDKAEQVFSNVTNILEASNSSLDRVIKVNVFLKDIK 98

Query: 102 YSQTVNRIYREQFP-NSPARSCVVVSFPNPKIKVELECIA 140
             Q  N +Y + F  + PARSCV V+     + +E+E IA
Sbjct: 99  NFQEFNSVYAKYFNVHKPARSCVAVAALPLNVDLEMEVIA 138

>NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON}
           Anc_7.238
          Length = 144

 Score = 60.8 bits (146), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
            +  V+ SG I   P    +   +  +A    QN+RN+LEAS S+ D+++KV +F+AD  
Sbjct: 42  ANNFVYVSGQIPYTPENKPVEGSISDKAEQVFQNVRNILEASNSSLDKIVKVNVFLADIN 101

Query: 102 YSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
             +  N +Y + F  + PARSCV V      + +E+E IA
Sbjct: 102 NFKEFNGVYAKYFNTHKPARSCVAVKALPLNVDLEVEVIA 141

>ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {ON}
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and similar to
           YER057C uniprot|P40037 Saccharomyces cerevisiae YER057C
           HMF1 Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 143

 Score = 59.3 bits (142), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
            S L+F SG I   P    +   +  +      N++++L+A  S+ +RV+KV +F+AD  
Sbjct: 40  ASNLLFVSGQIPYTPDNKPVEGSISDKTEQVFSNVKSILQAGNSSLERVVKVNVFLADIK 99

Query: 102 YSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
           Y +  N++Y + F  + PARSCV V+       +E+E IA
Sbjct: 100 YFEEFNKVYAKYFNEHQPARSCVAVAALPKNCDLEMEVIA 139

>KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON}
           Anc_7.238 YIL051C
          Length = 142

 Score = 58.5 bits (140), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 57/99 (57%), Gaps = 1/99 (1%)

Query: 43  SKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAY 102
           +K+VF SG I        +   + ++A    QN++N+L+AS S+ D+++KV +F+ D   
Sbjct: 40  NKMVFVSGQIPYTHDNKPVEGSISKKADQVFQNIKNILDASNSSLDKIIKVNVFLKDINN 99

Query: 103 SQTVNRIYREQFP-NSPARSCVVVSFPNPKIKVELECIA 140
            +  N +Y + F  + PARSCV V+     + VE+E IA
Sbjct: 100 FKEFNGVYAKYFNVHKPARSCVAVAALPLDVDVEVEVIA 138

>NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7.238
          Length = 148

 Score = 58.2 bits (139), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
            +  V+ SG I   P    +   +  +A    QN++N+L+ SGS+ D+++KV +F+AD  
Sbjct: 42  ANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADIN 101

Query: 102 YSQTVNRIYREQFP-NSPARSCVVVSFPNPKIKVELECIA 140
             +  N +Y + F  + PARSCV V      + +E+E IA
Sbjct: 102 NFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEVEVIA 141

>NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238
          Length = 128

 Score = 56.6 bits (135), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 59/103 (57%), Gaps = 7/103 (6%)

Query: 42  GSKLVFTSGCIGSDPVTDE---LPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVA 98
            + L+F SG I   P+T E   +   +  +A   +QN++NVLEAS S+ ++++KV +F+A
Sbjct: 25  ANNLIFLSGQI---PMTAENKPVEGSIADKAEQVIQNIKNVLEASNSSLEKIVKVNIFLA 81

Query: 99  DGAYSQTVNRIYREQFP-NSPARSCVVVSFPNPKIKVELECIA 140
           D       N +Y + F  + PARSCV V+       +E+E IA
Sbjct: 82  DINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124

>Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {ON}
           YIL051C (MMF1) - Maintenance of Mitochondrial DNA 1
           [contig 11] FULL
          Length = 141

 Score = 57.0 bits (136), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 54/99 (54%), Gaps = 1/99 (1%)

Query: 43  SKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAY 102
           +K+VF SG I        +   +  +A   +QN+RN+LE + S  D+++KV +F+AD   
Sbjct: 39  NKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKD 98

Query: 103 SQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
               N +Y + F  + PARSCV V      + +E+E +A
Sbjct: 99  FAEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEMEVVA 137

>TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.238
           YIL051C
          Length = 142

 Score = 56.6 bits (135), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 58/104 (55%), Gaps = 9/104 (8%)

Query: 42  GSKLVFTSGCI----GSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFV 97
            + LVF SG I     + PV   + +  EQ      QN++N+L+AS S+ D+V+KV +F+
Sbjct: 39  ANNLVFVSGQIPYTKDNVPVKGSISDKTEQ----VFQNVKNILDASNSSFDKVIKVNVFL 94

Query: 98  ADGAYSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
           AD    +  N +Y + F  + PARSCV V+       +E+E IA
Sbjct: 95  ADINNFKEFNEVYAKYFNTHKPARSCVAVAALPLGCDLEMEVIA 138

>YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}
           MMF1Mitochondrial protein required for transamination of
           isoleucine but not of valine or leucine; may regulate
           specificity of branched-chain transaminases Bat1p and
           Bat2p; interacts genetically with mitochondrial
           ribosomal protein genes
          Length = 145

 Score = 55.8 bits (133), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
            +  V+ SG I   P    +   + ++A    QN++N+L  S S+ D ++KV +F+AD  
Sbjct: 42  ANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMK 101

Query: 102 YSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
                N +Y + F  + PARSCV V+     + +E+E IA
Sbjct: 102 NFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIA 141

>NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {ON}
           Anc_7.238
          Length = 128

 Score = 54.7 bits (130), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 59/103 (57%), Gaps = 7/103 (6%)

Query: 42  GSKLVFTSGCIGSDPVT-DELPED--LEQQARNALQNLRNVLEASGSNSDRVLKVLLFVA 98
            + L+F SG I   P+T D  P +  +  +A   +QN++ VLEAS S+ +R++KV +F+A
Sbjct: 25  ANNLIFLSGQI---PLTSDNKPVEGSIADKAEQVIQNVKKVLEASNSSLERIIKVNIFLA 81

Query: 99  DGAYSQTVNRIYREQFP-NSPARSCVVVSFPNPKIKVELECIA 140
           D       N +Y + F  + PARSCV V+       +E+E IA
Sbjct: 82  DINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124

>CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} similar
           to uniprot|P40037 Saccharomyces cerevisiae YER057c HIG1
           Heat-shock induceable Inhibiter of cell Growth
          Length = 142

 Score = 55.1 bits (131), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 56/99 (56%), Gaps = 1/99 (1%)

Query: 43  SKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAY 102
           + L++ SG I        +   +  +A   +QN++N+L+ S S+ +R++KV +F+AD   
Sbjct: 40  NNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNN 99

Query: 103 SQTVNRIYREQFP-NSPARSCVVVSFPNPKIKVELECIA 140
               N++Y + F  + PARSCV V+     + +E+E IA
Sbjct: 100 FAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIA 138

>Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 53.9 bits (128), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 52/100 (52%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
            +  V+ SG I   P    +   +  +A    QN++N+L  S S+ D ++KV +F+AD  
Sbjct: 42  ANNFVYVSGQIPYTPENKPVQGSISDKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMK 101

Query: 102 YSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
                N +Y + F  + PARSCV V+     + +E+E IA
Sbjct: 102 NFGEFNSVYAKYFHTHKPARSCVGVASLPLNVDLEMEVIA 141

>Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON}
           complement(58847..59230) [384 nt, 128 aa]
          Length = 127

 Score = 52.8 bits (125), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 57/98 (58%), Gaps = 3/98 (3%)

Query: 45  LVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQ 104
           +++ SG I        +   +  QA   +QN++N+LE++ S+ ++++KV +F+ D  + Q
Sbjct: 28  MIYVSGQIPYTKENKPIGGTVSDQAEQMIQNVKNILESANSSLNKIVKVNVFLTDMNHFQ 87

Query: 105 TVNRIYREQFP-NSPARSCV-VVSFPNPKIKVELECIA 140
             N +Y + F  + PARSCV V + P   I +E+E +A
Sbjct: 88  EFNVVYAKYFSEHKPARSCVAVAALPLDNI-MEMEVVA 124

>KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {ON}
           Anc_7.238 YIL051C
          Length = 131

 Score = 52.8 bits (125), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
            + LVF SG +        L   + ++A   + N++ +L AS S  DRV+K  +F+AD  
Sbjct: 27  ANNLVFVSGQVPLTADNKMLEGSIAEKAEQVITNIKTILAASNSALDRVVKCNIFLADIN 86

Query: 102 YSQTVNRIYREQFPNS-PARSCVVVSFPNPKIKVELECIA 140
                N +Y + F +  PARSCV V+       +E+E IA
Sbjct: 87  NFAEFNTVYAKHFHDHKPARSCVAVAALPLNADLEMEVIA 126

>TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7.238
           YIL051C
          Length = 155

 Score = 52.8 bits (125), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 57/105 (54%), Gaps = 1/105 (0%)

Query: 40  TSGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVAD 99
           T  ++L++ SG I   P    +   +  +A    QN+ N+L++  S+ + V+KV +F+ D
Sbjct: 48  TQFNELLYVSGQIPFTPDNKPVEGSISDKAEQVFQNVENILKSGNSSLNEVVKVNVFLKD 107

Query: 100 GAYSQTVNRIYREQFP-NSPARSCVVVSFPNPKIKVELECIAEVQ 143
                  N++Y + F  + PARSCV V+     + +E+E IA V+
Sbjct: 108 IDNFAEFNKVYAKYFTVHKPARSCVAVAALPLNVDLEMEVIAAVK 152

>KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {ON}
           Anc_7.238 YIL051C
          Length = 128

 Score = 52.0 bits (123), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 45  LVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQ 104
           +++ SG I   P    +   +  +    L+N++ VL+AS S+ + ++KV +F+AD  Y  
Sbjct: 28  MIYLSGQIPLTPDGKPVEGSIADKTTQVLENIKTVLKASNSSLENIVKVNIFLADIKYFS 87

Query: 105 TVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
            +N +Y + F  + PARSCV V+       +E+E +A
Sbjct: 88  ELNVVYAKYFKAHKPARSCVAVAALPLNADLEIEVVA 124

>Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 51/100 (51%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
            +  V+ SG I        +   +  +A    QN++N+L  S S+ D ++KV +F+AD  
Sbjct: 42  ANSFVYVSGQIPYTAANKPVQGSISDKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMK 101

Query: 102 YSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
                N +Y + F  + PARSCV V+     + +E+E IA
Sbjct: 102 NFAEFNSVYAKYFHTHKPARSCVGVASLPLNVDLEMEVIA 141

>SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 144

 Score = 51.6 bits (122), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 57/102 (55%), Gaps = 7/102 (6%)

Query: 43  SKLVFTSGCIGSDPVTDE---LPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVAD 99
           + +VF SG I   P T E   +   +  +A   +QN++N+LE + S+ ++++KV +F+AD
Sbjct: 42  NNMVFVSGQI---PYTHENKPVEGSIADKAEQVIQNVKNILEEANSSLNKIVKVNVFLAD 98

Query: 100 GAYSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
                  N +Y + F  + PARSCV V      + +E+E IA
Sbjct: 99  INDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEMEVIA 140

>KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar to
           uniprot|P40185 Saccharomyces cerevisiae YIL051C MMF1
           Mitochondrial protein involved in maintenance of the
           mitochondrial genome and similar to YER057C
           uniprot|P40037 Saccharomyces cerevisiae YER057C HMF1
           Member of the p14.5 protein family with similarity to
           Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 140

 Score = 51.2 bits (121), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 1/99 (1%)

Query: 43  SKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAY 102
           + L+F SG I        +   +  +A   +QN++N+L  + S+ D+++KV +F+AD   
Sbjct: 38  NNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINS 97

Query: 103 SQTVNRIYREQFP-NSPARSCVVVSFPNPKIKVELECIA 140
               N +Y + F  + PARSCV        + +E+E IA
Sbjct: 98  FAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEMEVIA 136

>KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 141

 Score = 50.8 bits (120), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 43  SKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAY 102
           + +VF SG I        +   +  +A   +QN++N+LE + S  ++++KV +F+AD   
Sbjct: 39  NNMVFVSGQIPYTAENKRVEGTMTDKAEQVIQNVKNILEEANSALNKIVKVNIFLADIND 98

Query: 103 SQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
               N +Y + F  + PARSCV V      + +E+E +A
Sbjct: 99  FAEFNGVYGKYFNEHKPARSCVAVKDLPLNVDLEMEVVA 137

>Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 50.4 bits (119), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 51/100 (51%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
            +  V+ SG I        +   +  +A    QN++N+L  S S+ + V+KV +F+AD  
Sbjct: 42  ANNFVYVSGQIPYTAENKPVQGSISDKAEQVFQNVKNILAESNSSLNSVVKVNVFLADMK 101

Query: 102 YSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
                N +Y + F  + PARSCV V+     + +E+E IA
Sbjct: 102 NFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIA 141

>TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.238
           YIL051C
          Length = 126

 Score = 49.3 bits (116), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 53/100 (53%), Gaps = 1/100 (1%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
           G+  ++ SG I   P    +   +  +A    +N+  +LE +GS+ ++++KV +F+A+  
Sbjct: 25  GNGFIYVSGQIALLPDGTRVEGSISDKAHQIFKNISAILETAGSSLNKIIKVNIFLANIK 84

Query: 102 YSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
             +  N  Y + F  + PARSCV V+       VE+E +A
Sbjct: 85  DFEEFNATYIKYFNTHKPARSCVAVAALPLGADVEVEVVA 124

>TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.238
           YIL051C
          Length = 128

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 52/107 (48%), Gaps = 3/107 (2%)

Query: 35  SPAFVTSGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVL 94
           SPA        ++ SG I  +     +   +  +A    +N++ VL A+ S+ D V+K  
Sbjct: 20  SPAM--KAGDTIYLSGQIHLNEDNKLVGGSIADKAEQIFENVQKVLAAANSDLDHVVKCN 77

Query: 95  LFVADGAYSQTVNRIYREQF-PNSPARSCVVVSFPNPKIKVELECIA 140
           +F+ D       N +Y + F  + PARSCV V+       VE+ECIA
Sbjct: 78  VFLKDIKDFAEFNTVYAKYFNSHKPARSCVAVAALPLNADVEMECIA 124

>Kpol_1036.86 s1036 (225185..227278) [2094 bp, 697 aa] {ON}
           (225185..227278) [2094 nt, 698 aa]
          Length = 697

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 6/69 (8%)

Query: 61  LPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQF------ 114
           + ED+E+Q  N    L ++L     +  +VL   L++ + +    VN+IY   F      
Sbjct: 334 IEEDIERQVENVFNQLDSILGEKTYSRAQVLNSSLYLFNMSDFSKVNKIYNNYFDIQKFG 393

Query: 115 PNSPARSCV 123
           P  P+R+CV
Sbjct: 394 PLPPSRACV 402

>AGL164W Chr7 (388842..390902) [2061 bp, 686 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR143W
          Length = 686

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 6/83 (7%)

Query: 65  LEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQF------PNSP 118
           LE+QAR+    L   L   G    +VL  +L +AD      +N  Y   F      P  P
Sbjct: 329 LEKQARDVFDQLNESLTRHGVVKAQVLSSVLLLADMGTFAEINTAYNGYFSIQEIGPLPP 388

Query: 119 ARSCVVVSFPNPKIKVELECIAE 141
           +R+C+      P I ++L  + +
Sbjct: 389 SRACIESKSLAPGIGLQLSVVIQ 411

>NCAS0C03150 Chr3 complement(617756..619825) [2070 bp, 689 aa] {ON}
           Anc_8.349 YLR143W
          Length = 689

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 12/88 (13%)

Query: 42  GSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGA 101
           G+ L  ++ C    P   EL  ++EQQA+   Q L  +++ +     ++L   L +A+ +
Sbjct: 321 GNLLYISNLC----PKDSEL--NVEQQAKQVFQQLDKIMKENSLFPSQILFSSLILANMS 374

Query: 102 YSQTVNRIYREQF------PNSPARSCV 123
              TVN++Y + F      P  P+R+CV
Sbjct: 375 NFATVNQVYNDFFRINKWGPLPPSRACV 402

>CAGL0M04521g Chr13 (496157..498223) [2067 bp, 688 aa] {ON} similar
           to uniprot|Q12429 Saccharomyces cerevisiae YLR143w
          Length = 688

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 6/83 (7%)

Query: 65  LEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQF------PNSP 118
           +++Q ++ LQ L N+L+ +   +  VL   L + D +   +VN+ Y + F      P  P
Sbjct: 337 VQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPP 396

Query: 119 ARSCVVVSFPNPKIKVELECIAE 141
           AR+C+  +  N    ++L  + +
Sbjct: 397 ARACIESNIINDGSALQLSVVVK 419

>KLTH0G11594g Chr7 complement(975378..977432) [2055 bp, 684 aa] {ON}
           similar to uniprot|Q07261 Saccharomyces cerevisiae
           YLR143W Hypothetical ORF
          Length = 684

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 65  LEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQF------PNSP 118
           ++++A+N L  L  +L     +  +++   L ++D +    VN IY   F      P  P
Sbjct: 335 VKEKAQNILDELGTLLADQKVSPSQIMASSLLLSDMSDFHQVNEIYSAFFQVKHVGPLPP 394

Query: 119 ARSCVVVSFPNPKIKVELECIAEV 142
           AR+CV  S    K  ++L  + ++
Sbjct: 395 ARACVGSSLIGEKNSLQLSVVIDL 418

>KLTH0G09130g Chr7 complement(746572..754329) [7758 bp, 2585 aa] {ON}
            similar to uniprot|P40468 Saccharomyces cerevisiae
            YIL129C TAO3 Identified in a hunt for mutants that
            activate OCH1 transcription Transcriptional Activator of
            OCH1
          Length = 2585

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 38/78 (48%), Gaps = 14/78 (17%)

Query: 31   IDLLSPAFVTSGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNSDR- 89
            IDL  P FV  G+ L+         PV   L  + E QA   L  +RNV   SGS  D+ 
Sbjct: 2067 IDLRRPEFVGVGADLI--------SPVLRLLLTEYESQALELLNCIRNV---SGSKMDKD 2115

Query: 90   VLKVLLFVADG--AYSQT 105
            VL++ +   D   AYS+T
Sbjct: 2116 VLRISMGNKDAKIAYSRT 2133

>SAKL0E11154g Chr5 complement(938270..941041) [2772 bp, 923 aa]
          {ON} similar to uniprot|P53917 Saccharomyces cerevisiae
          YNL127W FAR11 Protein involved in G1 cell cycle arrest
          in response to pheromone in a pathway different from
          the Far1p-dependent pathway interacts with Far3p Far7p
          Far8p Far9p and Far10p
          Length = 923

 Score = 30.8 bits (68), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 55 DPVTDELPEDLEQQARNALQNLRNVLEASGSNSDRVL 91
          DPVT ++P+   Q   N LQ+L N+L      SD  L
Sbjct: 35 DPVTYDIPDQTTQSEENLLQDLDNILHKKLHMSDTSL 71

>YLR143W Chr12 (427329..429386) [2058 bp, 685 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-tagged protein localizes to the cytoplasm; YLR143W
           is not an essential gene
          Length = 685

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 41/91 (45%), Gaps = 6/91 (6%)

Query: 63  EDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQF------PN 116
           E +E+Q+ +    L ++L ++    + +L   L + D +    +N+IY E        P 
Sbjct: 333 ETVEKQSEDIFTELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPL 392

Query: 117 SPARSCVVVSFPNPKIKVELECIAEVQPKAR 147
            P+R+CV          V+L  + +V+   +
Sbjct: 393 PPSRACVGSKCLPEDCHVQLSVVVDVKNTGK 423

>Suva_10.239 Chr10 (436127..438196) [2070 bp, 689 aa] {ON} YLR143W
           (REAL)
          Length = 689

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 65  LEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQF------PNSP 118
           +E+Q+++    L ++L ++      +L   L V D +    +N+IY E        P  P
Sbjct: 335 VEEQSKDIFTELADILRSNRIPRSHILSSSLLVKDMSNFGKINKIYNEFLNVTKYGPLPP 394

Query: 119 ARSCVVVSFPNPKIKVELECIAEVQ 143
           +R+CV   +      V+L  + + +
Sbjct: 395 SRACVGSGYLPEGCHVQLSVVIDTE 419

>Kpol_1003.23 s1003 (59536..61590) [2055 bp, 684 aa] {ON}
           (59536..61590) [2055 nt, 685 aa]
          Length = 684

 Score = 29.6 bits (65), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 94  LLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNP 130
           L FV D   S+ V  IY  Q+ N P   C++V+  +P
Sbjct: 67  LTFVTDTNISKVVTCIYSPQYQNLPIHLCLLVANDSP 103

>Kpol_1027.3 s1027 complement(3956..7066) [3111 bp, 1036 aa] {ON}
           complement(3956..7066) [3111 nt, 1037 aa]
          Length = 1036

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 16/31 (51%)

Query: 105 TVNRIYREQFPNSPARSCVVVSFPNPKIKVE 135
           T+N    E  PNSP RS    S PN  I +E
Sbjct: 588 TLNNTEDESIPNSPVRSIASSSRPNISISIE 618

>Ecym_3063 Chr3 complement(120315..122144) [1830 bp, 609 aa] {ON}
           similar to Ashbya gossypii AAR170W
          Length = 609

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 2   IQTLHPLLTSCVRKMAKKVTWQEVGATKGIDLLSPAFVTSGSKLVFTSGCIGSDPVTDEL 61
           +Q L  LL + ++   K + W +V  ++ +D +  + +T  S L+FT   I S P  + +
Sbjct: 401 LQDLAHLLITYLKGNIKCLPWSDVPLSREVDEILDSLLTLNSNLIFT---INSQPKVNGV 457

Query: 62  P 62
           P
Sbjct: 458 P 458

>KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {ON}
           Anc_8.349 YLR143W
          Length = 702

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 6/86 (6%)

Query: 63  EDLEQQARNALQNLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQF------PN 116
           E +E QA +  + L  VL     +  ++L   L +++ +   TVN+IY E F      P 
Sbjct: 331 ETVESQATDIFEQLFMVLNEYKLSQSQILSSSLILSNMSNFGTVNKIYNEFFNISKWGPL 390

Query: 117 SPARSCVVVSFPNPKIKVELECIAEV 142
            P+RSCV  +     ++++L  + ++
Sbjct: 391 PPSRSCVGSNLLGDNVQLQLSVVIDI 416

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,309,129
Number of extensions: 580001
Number of successful extensions: 1882
Number of sequences better than 10.0: 60
Number of HSP's gapped: 1841
Number of HSP's successfully gapped: 60
Length of query: 151
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 51
Effective length of database: 42,014,799
Effective search space: 2142754749
Effective search space used: 2142754749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)