Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14894g3.495ON1661668831e-123
Kwal_55.212463.495ON1601586404e-86
NDAI0G009103.495ON1631574243e-53
NCAS0E007803.495ON1711624229e-53
SAKL0F02706g3.495ON1611534173e-52
Kpol_480.133.495ON1571544112e-51
TDEL0D056303.495ON1501504102e-51
YGR133W (PEX4)3.495ON1831594055e-50
Suva_7.4213.495ON1651613871e-47
TPHA0D042603.495ON1581573852e-47
Smik_6.2293.495ON1651603713e-45
Skud_7.4443.495ON1621603671e-44
ZYRO0D09878g3.495ON1531503625e-44
CAGL0I10450g3.495ON1621563611e-43
TBLA0C045003.495ON1651533193e-37
KAFR0C019903.495ON1511573183e-37
KNAG0B007803.495ON1531523141e-36
AFR314W3.495ON1551523114e-36
Ecym_12343.495ON1611522672e-29
KLLA0E04027g3.495ON1581522644e-29
Suva_2.3438.375ON2151692206e-22
Smik_4.4258.375ON2151692206e-22
YDR177W (UBC1)8.375ON2151692153e-21
Ecym_60388.375ON2111642111e-20
ADR169C8.375ON2111642083e-20
TPHA0L008508.375ON2161702075e-20
ZYRO0C03784g8.375ON2181662059e-20
CAGL0E00671g8.375ON2131322032e-19
Skud_4.4418.375ON2151322032e-19
CAGL0E04752g3.308ON1471451974e-19
Kpol_1030.108.375ON2151692005e-19
Suva_2.2183.308ON1481371931e-18
Skud_4.3143.308ON1481371931e-18
YDR059C (UBC5)3.308ON1481371931e-18
Kpol_1065.127.54ON1591241941e-18
SAKL0A00396g8.375ON2151321971e-18
KAFR0C002703.308ON1471451932e-18
Smik_4.2973.308ON1481371922e-18
KNAG0A048108.375ON2141321962e-18
TBLA0H031308.375ON2141321953e-18
NCAS0A108003.308ON1481451904e-18
NDAI0A054903.308ON1471451895e-18
Ecym_74313.308ON1471441896e-18
KLTH0E14300g3.308ON1471441896e-18
SAKL0B06512g3.308ON1471441896e-18
AER173C3.308ON1471441896e-18
TDEL0B065702.569ON1651521897e-18
NDAI0A011608.375ON2161321927e-18
KLLA0E12563g3.308ON1481441888e-18
Kpol_1052.23.308ON1481441888e-18
TDEL0F049908.375ON2171321929e-18
Kwal_23.64858.375ON2151321911e-17
TPHA0A038503.308ON1481441861e-17
TDEL0F021003.308ON1471441862e-17
NCAS0B031508.375ON2141321892e-17
ZYRO0C04950g6.109ON1681121862e-17
KLTH0A07546g8.375ON2151321893e-17
ZYRO0G12870g3.308ON1471441843e-17
TBLA0I021303.308ON1481441843e-17
Smik_7.2226.109ON1711121863e-17
TDEL0G036106.109ON1691121863e-17
Suva_7.2136.109ON1731121863e-17
YGL058W (RAD6)6.109ON1721121853e-17
Kpol_461.86.109ON1671121853e-17
TBLA0F024406.109ON1741121863e-17
KNAG0F025706.109ON1511121843e-17
AAR156C6.109ON1701121853e-17
SAKL0A07260g6.109ON1691121853e-17
NDAI0E038707.54ON1641321853e-17
Suva_4.3263.308ON1481451833e-17
Ecym_30776.109ON1701121854e-17
TPHA0J017506.109ON1691041854e-17
CAGL0I00352g6.109ON1671121844e-17
CAGL0G08063g8.230ON1491011834e-17
Kwal_56.234828.230ON1491011835e-17
ZYRO0B11682g8.230ON1511331825e-17
KLLA0C05632g6.109ON1641121836e-17
KLLA0C18656g8.375ON2281321876e-17
KNAG0J023403.308ON1611291836e-17
KAFR0A047006.109ON1531121826e-17
TDEL0A013408.230ON1571011828e-17
KAFR0B060608.375ON2131321841e-16
NCAS0D032206.109ON1711121811e-16
KLTH0H06732g6.109ON1601121801e-16
Ecym_45782.569ON1651511802e-16
AGR121C8.230ON1541011792e-16
Kpol_1075.1b8.230ON1521011792e-16
TBLA0H026102.569ON1651581802e-16
SAKL0H17930g8.230ON1531011792e-16
Kwal_14.18286.109ON1521121792e-16
Skud_4.3528.230ON1431011782e-16
KLTH0G14366g8.230ON1491011792e-16
CAGL0M07568g2.569ON1651521802e-16
Skud_2.2073.308ON1481451782e-16
Smik_2.2193.308ON1481451782e-16
YBR082C (UBC4)3.308ON1481451782e-16
Skud_7.2226.109ON1701121784e-16
SAKL0D13552g2.569ON1651541784e-16
TBLA0F037908.230ON1511011765e-16
KNAG0H029808.230ON1521011765e-16
Kwal_26.82242.569ON1651541775e-16
KLLA0C17622g8.230ON1591011765e-16
ZYRO0E06358g2.569ON1651511775e-16
Suva_2.2538.230ON1431011756e-16
NCAS0B040108.230ON1531011756e-16
YDR092W (UBC13)8.230ON1531011756e-16
Smik_15.5177.54ON1561261756e-16
Smik_4.3358.230ON1431011747e-16
Ecym_55638.230ON1641011758e-16
NDAI0I016506.109ON1761121768e-16
NDAI0J015408.230ON1541011749e-16
KAFR0A021602.569ON1651521732e-15
YOR339C (UBC11)7.54ON1561261732e-15
KLTH0D01760g7.54ON1611261732e-15
Smik_12.3894.49ON1871211752e-15
KLTH0D07986g2.569ON1651491732e-15
TDEL0H039707.54ON1561261722e-15
KAFR0A024208.230ON1471141712e-15
Kwal_27.124013.308ON2361421763e-15
KLLA0E07745g2.569ON1651511713e-15
ABR059W2.569ON1651521713e-15
TPHA0B034108.230ON1521011695e-15
Suva_13.1892.569ON1651511689e-15
Suva_10.4014.49ON1871581691e-14
Smik_13.1862.569ON1651511671e-14
Suva_8.3897.54ON1561511671e-14
YMR022W (UBC7)2.569ON1651511671e-14
Skud_13.1762.569ON1651511662e-14
TPHA0I024602.569ON1671471652e-14
NCAS0A127402.569ON1651511644e-14
NDAI0B015202.569ON1651521644e-14
Kwal_26.70097.54ON1611261636e-14
KNAG0M021502.569ON1701521627e-14
CAGL0M03399g1.436ON2141241648e-14
ZYRO0D04466g7.54ON1591101601e-13
TPHA0O009201.436ON2261231631e-13
Skud_15.5047.54ON1561041582e-13
YLR306W (UBC12)4.49ON1881171593e-13
Kpol_1056.52.569ON1651631583e-13
SAKL0B10582g7.54ON1611261573e-13
Skud_12.3894.49ON1871441584e-13
Smik_4.1714.249ON1571301574e-13
KLLA0A11198g1.436ON2021241594e-13
KAFR0H012303.308ON1101021526e-13
YDL064W (UBC9)4.249ON1571301556e-13
Kpol_1030.181.436ON2231231579e-13
Suva_4.1864.249ON1571301549e-13
KNAG0H018701.436ON2101121571e-12
NDAI0D011401.436ON2451221581e-12
Skud_4.1914.249ON157941541e-12
SAKL0H03058g4.249ON157941531e-12
TDEL0B056701.436ON2031231551e-12
KAFR0H029601.436ON1871231541e-12
KAFR0F030404.49ON1691591531e-12
CAGL0D00814g4.249ON157941522e-12
YEL012W (UBC8)1.436ON2181231552e-12
ZYRO0E03806g1.436ON2091231542e-12
Suva_5.531.436ON2151231543e-12
KLTH0D14344g4.249ON1571281513e-12
Smik_5.981.436ON2151231543e-12
Ecym_32704.249ON1571301513e-12
Kwal_23.42274.249ON122941483e-12
Kwal_34.161741.436ON2131051525e-12
KLLA0E05039g4.249ON1571281486e-12
NCAS0G031301.436ON2311121526e-12
TBLA0I029604.249ON157941488e-12
TBLA0A012901.436ON2191231501e-11
NCAS0A059404.49ON1931451481e-11
ZYRO0B12386g4.249ON157941462e-11
Skud_5.871.436ON2101231482e-11
AER056C4.249ON1571301442e-11
TDEL0E012204.249ON157941443e-11
Kpol_483.164.249ON122941414e-11
TDEL0E055604.49ON1871201454e-11
NCAS0A024904.249ON157991425e-11
SAKL0D10560g1.436ON2071231446e-11
NDAI0D043804.249ON157941416e-11
KAFR0G032404.249ON157941417e-11
KLTH0H13816g1.436ON2331061447e-11
NDAI0A016507.392ON2511231448e-11
Kwal_27.108377.392ON2461231448e-11
Ecym_13481.436ON2111061439e-11
AEL045W1.436ON2111061439e-11
NCAS0A143907.392ON2401231431e-10
TPHA0F003904.49ON1931821421e-10
KNAG0D043904.249ON1571281401e-10
Ecym_46837.392ON2431261431e-10
ZYRO0G19910g4.49ON179881401e-10
TPHA0B007704.249ON157941392e-10
ZYRO0B03344g7.392ON2501231422e-10
KLTH0C06688g7.392ON2461231403e-10
NDAI0D029104.49ON1891151374e-10
YER100W (UBC6)7.392ON2501261394e-10
Smik_5.2467.392ON2501261395e-10
TBLA0E015704.49ON1941031331e-09
CAGL0I05478g7.392ON2461241352e-09
NDAI0E041707.392ON2571231352e-09
SAKL0F12474g7.392ON2511231342e-09
TDEL0C015507.392ON2481241342e-09
Skud_5.2257.392ON2501261342e-09
Suva_5.2197.392ON2491261324e-09
KLLA0E20395g7.392ON2511241325e-09
TPHA0K008207.392ON2571231315e-09
KLLA0C17248g4.49ON184881296e-09
TBLA0D006007.392ON2561231309e-09
CAGL0D06468g4.49ON1871341271e-08
NCAS0E026007.392ON2551151281e-08
Kpol_1045.397.392ON2531231281e-08
KNAG0I029404.49ON197781262e-08
AGR372W7.392ON2421241272e-08
Kpol_YGOB_414.24.49ON1931001252e-08
Kpol_414.2singletonOFF1921001252e-08
KNAG0B023607.392ON2511231263e-08
Ecym_83714.49ON2671051229e-08
Skud_4.3063.301ON2971531221e-07
Smik_4.2903.301ON2971531221e-07
TBLA0G032703.301ON3301501221e-07
YDR054C (CDC34)3.301ON2951531221e-07
NCAS0A107703.301ON2731501211e-07
NDAI0A055303.301ON2731501202e-07
Suva_2.2113.301ON2971531202e-07
Kpol_1065.453.301ON3231471202e-07
ZYRO0G12650g3.301ON2851501193e-07
KLTH0H09504g4.49ON1841161164e-07
KAFR0L017507.392ON2511231184e-07
KNAG0H010403.301ON2961011184e-07
CAGL0E04598g3.301ON2951501184e-07
KAFR0H012703.301ON2871501174e-07
TPHA0M012803.301ON4351471168e-07
TDEL0D032603.301ON2891001159e-07
AGL203C3.301ON2701501159e-07
SAKL0D02530g3.301ON2721031151e-06
Kwal_27.104443.301ON2781471141e-06
KLTH0C04818g3.301ON2751471132e-06
Ecym_26693.301ON2681031122e-06
TDEL0G015806.187ON1381201049e-06
NCAS0I014303.301ON2581531079e-06
SAKL0H24112g4.49ON185851042e-05
KLLA0D09196g3.301ON2921431043e-05
KLLA0E19119g6.187ON1391181003e-05
Kpol_1002.656.187ON10154984e-05
KNAG0J022803.301ON2171581025e-05
KLTH0H04796g6.187ON13891995e-05
ADL035C4.49ON200881015e-05
ZYRO0G08228g6.187ON138122996e-05
TPHA0J022506.187ON137121979e-05
Suva_7.1826.187ON137119971e-04
CAGL0H03157g6.187ON139122961e-04
NDAI0A075703.301ON239150954e-04
YGL087C (MMS2)6.187ON137119917e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14894g
         (166 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   344   e-123
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   251   4e-86
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   167   3e-53
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   167   9e-53
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   165   3e-52
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   162   2e-51
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   162   2e-51
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   160   5e-50
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   153   1e-47
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   152   2e-47
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   147   3e-45
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   145   1e-44
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   144   5e-44
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   143   1e-43
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   127   3e-37
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   127   3e-37
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   125   1e-36
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   124   4e-36
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   107   2e-29
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   106   4e-29
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    89   6e-22
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    89   6e-22
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    87   3e-21
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    86   1e-20
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    85   3e-20
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    84   5e-20
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    84   9e-20
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    83   2e-19
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    83   2e-19
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    80   4e-19
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    82   5e-19
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    79   1e-18
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    79   1e-18
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    79   1e-18
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    79   1e-18
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    80   1e-18
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    79   2e-18
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    79   2e-18
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    80   2e-18
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    80   3e-18
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    78   4e-18
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    77   5e-18
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    77   6e-18
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    77   6e-18
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    77   6e-18
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    77   6e-18
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    77   7e-18
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      79   7e-18
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    77   8e-18
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    77   8e-18
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    79   9e-18
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    78   1e-17
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    76   1e-17
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    76   2e-17
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      77   2e-17
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    76   2e-17
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    77   3e-17
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    75   3e-17
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    75   3e-17
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    76   3e-17
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    76   3e-17
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    76   3e-17
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    76   3e-17
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    76   3e-17
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    76   3e-17
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    75   3e-17
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    76   3e-17
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    76   3e-17
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    76   3e-17
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    75   3e-17
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    76   4e-17
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    76   4e-17
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    75   4e-17
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    75   4e-17
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    75   5e-17
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    75   5e-17
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    75   6e-17
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    77   6e-17
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    75   6e-17
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    75   6e-17
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    75   8e-17
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    75   1e-16
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      74   1e-16
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    74   1e-16
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    74   2e-16
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    74   2e-16
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    74   2e-16
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    74   2e-16
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    74   2e-16
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    74   2e-16
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    73   2e-16
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    74   2e-16
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    74   2e-16
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    73   2e-16
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    73   2e-16
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    73   2e-16
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    73   4e-16
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    73   4e-16
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    72   5e-16
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    72   5e-16
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    73   5e-16
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    72   5e-16
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    73   5e-16
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    72   6e-16
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    72   6e-16
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    72   6e-16
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    72   6e-16
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    72   7e-16
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    72   8e-16
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      72   8e-16
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    72   9e-16
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    71   2e-15
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    71   2e-15
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    71   2e-15
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    72   2e-15
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    71   2e-15
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    71   2e-15
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    70   2e-15
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    72   3e-15
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    70   3e-15
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    70   3e-15
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    70   5e-15
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    69   9e-15
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    70   1e-14
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    69   1e-14
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    69   1e-14
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    69   1e-14
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    69   2e-14
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    68   2e-14
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    68   4e-14
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    68   4e-14
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    67   6e-14
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    67   7e-14
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    68   8e-14
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    66   1e-13
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    67   1e-13
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    65   2e-13
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    66   3e-13
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    65   3e-13
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    65   3e-13
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    65   4e-13
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    65   4e-13
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    66   4e-13
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    63   6e-13
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    64   6e-13
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    65   9e-13
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    64   9e-13
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    65   1e-12
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    65   1e-12
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    64   1e-12
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    64   1e-12
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    64   1e-12
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    64   1e-12
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    64   1e-12
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    63   2e-12
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    64   2e-12
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    64   2e-12
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    64   3e-12
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    63   3e-12
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    64   3e-12
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    63   3e-12
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    62   3e-12
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    63   5e-12
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    62   6e-12
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                63   6e-12
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    62   8e-12
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    62   1e-11
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     62   1e-11
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    61   2e-11
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    62   2e-11
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    60   2e-11
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    60   3e-11
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    59   4e-11
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    60   4e-11
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    59   5e-11
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    60   6e-11
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    59   6e-11
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    59   7e-11
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    60   7e-11
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    60   8e-11
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    60   8e-11
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    60   9e-11
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    60   9e-11
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    60   1e-10
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    59   1e-10
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    59   1e-10
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    60   1e-10
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    59   1e-10
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    58   2e-10
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    59   2e-10
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    59   3e-10
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       57   4e-10
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    58   4e-10
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    58   5e-10
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    56   1e-09
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    57   2e-09
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    57   2e-09
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    56   2e-09
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    56   2e-09
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    56   2e-09
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    55   4e-09
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    55   5e-09
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    55   5e-09
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    54   6e-09
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    55   9e-09
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    54   1e-08
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    54   1e-08
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    54   1e-08
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    53   2e-08
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    54   2e-08
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    53   2e-08
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    53   2e-08
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    53   3e-08
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    52   9e-08
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    52   1e-07
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    52   1e-07
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    52   1e-07
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    52   1e-07
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    51   1e-07
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    51   2e-07
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    51   2e-07
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    51   2e-07
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    50   3e-07
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    49   4e-07
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    50   4e-07
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                50   4e-07
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    50   4e-07
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                50   4e-07
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    49   8e-07
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    49   9e-07
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    49   9e-07
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    49   1e-06
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    49   1e-06
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    48   2e-06
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    48   2e-06
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    45   9e-06
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                46   9e-06
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    45   2e-05
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    45   3e-05
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    43   3e-05
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    42   4e-05
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    44   5e-05
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    43   5e-05
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    44   5e-05
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    43   6e-05
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    42   9e-05
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    42   1e-04
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    42   1e-04
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    41   4e-04
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    40   7e-04
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    39   7e-04
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    39   0.001
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    39   0.001
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    38   0.002
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    38   0.002
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    38   0.002
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    38   0.003
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    36   0.016
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    35   0.024
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    33   0.19 
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    31   0.55 
AGR116W Chr7 (960581..964084) [3504 bp, 1167 aa] {ON} Syntenic h...    30   2.4  

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  344 bits (883), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 166/166 (100%), Positives = 166/166 (100%)

Query: 1   MSQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60
           MSQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI
Sbjct: 1   MSQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120
           EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA
Sbjct: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120

Query: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGHCGHVSER 166
           SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGHCGHVSER
Sbjct: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGHCGHVSER 166

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  251 bits (640), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 118/158 (74%), Positives = 135/158 (85%)

Query: 1   MSQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60
           MSQRLAKEY+ L KTL  DP Y++I  L PVS++NL  WE+ ITGP DTPY GHEF+L I
Sbjct: 1   MSQRLAKEYKTLLKTLKEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLI 60

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120
               AYPLEPPKVQF ARC+PHCNVDF+SGRIC+++L+ AHW+PAWDLLH+VHAIWLLLA
Sbjct: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLA 120

Query: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRG 158
           +PEPDSPLDVDLACL RAGD SAHN L+AYYLNGGSRG
Sbjct: 121 NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRG 158

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  167 bits (424), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 80/157 (50%), Positives = 106/157 (67%), Gaps = 7/157 (4%)

Query: 4   RLAKEYRALSKTLG-----RDPEYAYII-SLAPVS-EENLRKWESLITGPPDTPYFGHEF 56
           R+ KEY+ + K L      +D E+  II SLAP+  +++L KWE++I GP  TPY+G  F
Sbjct: 3   RIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNF 62

Query: 57  TLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIW 116
            L I   + YP  PP  +FQ R MPHCNV++++G ICL +L   HWTP W+L+  + AIW
Sbjct: 63  ILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAIW 122

Query: 117 LLLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLN 153
           LLL  P P+SPL+VDLA L+R GD SA+N LI YYLN
Sbjct: 123 LLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLN 159

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  167 bits (422), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 104/162 (64%), Gaps = 10/162 (6%)

Query: 4   RLAKEYRALSKTL---------GRDPEYAYIIS-LAPVSEENLRKWESLITGPPDTPYFG 53
           RL KEY+ +  TL           D E+  II+ L P+S  +L  W++ I GP  TPY  
Sbjct: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62

Query: 54  HEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVH 113
           HEF LQIE    YP+EPP + FQ   MPHCNV+F +G ICL +L+  HWTPAW+L+  + 
Sbjct: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMK 122

Query: 114 AIWLLLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGG 155
           AIW+LL  P PDSPL+VD+A ++R  D+SA+N L+ YYL+  
Sbjct: 123 AIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSAS 164

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  165 bits (417), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 103/153 (67%), Gaps = 3/153 (1%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           QR+ KE++++ KTL  DP Y +I+ L P    N+  W + I+GPP+TPY    F L +E 
Sbjct: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63

Query: 63  SEAYPLEPPKVQF---QARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLL 119
              YPLEPP+V+F       + HCNVDF +G ICL +L   HW+P WDL+HV+HAIW+LL
Sbjct: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123

Query: 120 ASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYL 152
             P P+SPL+VD+A +++AGD  A+  LI YY+
Sbjct: 124 GEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  162 bits (411), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 75/154 (48%), Positives = 105/154 (68%), Gaps = 2/154 (1%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ + K LG       I SL P+  ++L  W + I GPP+TPY GH F L+I  
Sbjct: 4   RRLLKEYQVVKKELGNHKNI--ISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
           +  YPL+PP+V F A  MPHCN++F +G+ICL++LD A+W+P W+LL VV AI+ LL+ P
Sbjct: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121

Query: 123 EPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGS 156
             DSPL++DL+ +++  D SA+  LI YYLN  S
Sbjct: 122 VTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  162 bits (410), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 76/150 (50%), Positives = 106/150 (70%), Gaps = 3/150 (2%)

Query: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEAS 63
           R+A+EY+ +  TLG   E + ++SL P+ + +L +W   I GP  TPY GH F+L++   
Sbjct: 3   RIAREYKHIQATLGS--ESSLVVSLEPI-DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLG 59

Query: 64  EAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPE 123
           + YP  PP+V F  R MPHCNV++++G ICL++L   HW+PAWDLLHV+ AI  LL+ PE
Sbjct: 60  DRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPE 119

Query: 124 PDSPLDVDLACLVRAGDRSAHNSLIAYYLN 153
           PDSPLD+DLA ++RA DRSA+  L+ YYL 
Sbjct: 120 PDSPLDIDLANILRAQDRSAYYGLVNYYLQ 149

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  160 bits (405), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 74/159 (46%), Positives = 99/159 (62%), Gaps = 5/159 (3%)

Query: 4   RLAKEYRALSKTLGRD-----PEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTL 58
           R+ KEY+ + KTL  D     P    I SL P+ E +L KWE++I+GP DTPY  H+F +
Sbjct: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80

Query: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLL 118
            IE   +YP+ PPK+ F    + HCNV   +G ICL++L    WTP WDLLH VHA+W L
Sbjct: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140

Query: 119 LASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSR 157
           L  P  DSPLDVD+  ++R GD SA+  ++ Y+L    R
Sbjct: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERER 179

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  153 bits (387), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 98/161 (60%), Gaps = 5/161 (3%)

Query: 4   RLAKEYRALSKTLGRD-----PEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTL 58
           R+ KEYR + KTL  D     P    I SL P  E +L KWE+ I GP  TPY  ++F +
Sbjct: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62

Query: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLL 118
            I+  ++YP+ PPK+ F+   + HCN++  +G ICL +L    WTP WDLLH VHA+W L
Sbjct: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122

Query: 119 LASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGH 159
           L  P  DSPLDVD+  ++R GD+ A+  ++ Y+L    R +
Sbjct: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNN 163

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  152 bits (385), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 102/157 (64%), Gaps = 2/157 (1%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE R + K L    E   I  L PV+ EN  KW +++ GP +TPY  H F L IE 
Sbjct: 4   KRLLKEKRLIEKELSGYSES--IELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
              YPL PP + F+   MPHCNV+F +G+ICL++L+  HW+P W+L++V+ A++ LL  P
Sbjct: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121

Query: 123 EPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGH 159
             DSPL++DLA ++RAGD SA++ LI YYL   +  H
Sbjct: 122 VVDSPLNIDLANILRAGDTSAYHGLINYYLQEDTATH 158

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  147 bits (371), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 95/160 (59%), Gaps = 5/160 (3%)

Query: 4   RLAKEYRALSKTLGRD-----PEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTL 58
           R+ KEYR + KTL  D     P    I SL P+ E +L +WE+ I GP  TPY  ++F +
Sbjct: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62

Query: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLL 118
            I+   +YP+ PP++ F+   + HCNV   +G ICL +L    WTP WDLLH VHA+W L
Sbjct: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122

Query: 119 LASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRG 158
           L  P  DSPLDVD+  ++R  D SA+  ++ Y+L    R 
Sbjct: 123 LREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERS 162

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  145 bits (367), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 94/160 (58%), Gaps = 5/160 (3%)

Query: 4   RLAKEYRALSKTLGRD-----PEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTL 58
           R+AKEY  + KTL  +     P    I SL P+ E +L KWE++I GP  TPY  + F +
Sbjct: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62

Query: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLL 118
            I+   +YP+ PP ++F    + HCN+   +G ICL +L    WTP WDLLH VHAIW L
Sbjct: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122

Query: 119 LASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRG 158
           L  P  DSPLDVD+  ++R GD  A+  +I Y+L    R 
Sbjct: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN 162

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  144 bits (362), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 94/150 (62%)

Query: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEAS 63
           R AKEY+ ++K L    E    + +    +E+L +WE+LI GP  TPY G  F L +   
Sbjct: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62

Query: 64  EAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPE 123
           + YP+ PP V+F+   MPH NVDF +G ICL +L   HW+PAWDLLHVV AI  LL  P 
Sbjct: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPV 122

Query: 124 PDSPLDVDLACLVRAGDRSAHNSLIAYYLN 153
             SPL+VD+A +++A D +A+  L+ YY+ 
Sbjct: 123 SSSPLNVDIANILKANDMNAYYGLVHYYIK 152

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  143 bits (361), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 100/156 (64%), Gaps = 7/156 (4%)

Query: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEAS 63
           R++KE   + K L    +  +++ LAPV + +L +W ++I GP +TPY+ +EF L IE  
Sbjct: 3   RISKELLKIRKALEHG-DSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVP 61

Query: 64  EAYPLEPPKVQFQA------RCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWL 117
            +YP+ PP ++F +      R  PHCNVD  +G ICL +L    W+P WD+LHVV AI +
Sbjct: 62  ASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHI 121

Query: 118 LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLN 153
           LL  P PDSPLDVD+A +++  D SA+N +I Y+L 
Sbjct: 122 LLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLT 157

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  127 bits (319), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 93/153 (60%), Gaps = 6/153 (3%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSE--ENLRKWESLITGPPDTPYFGHEFTLQI 60
            R+ KEY  + K L   P+   + +L PVS    +L  W S+I GP D+PY    F L+I
Sbjct: 2   SRIIKEYNHIRK-LNALPDN--MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEI 58

Query: 61  EASEAYPLEPPKVQFQARCMP-HCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLL 119
                YP  PP ++F    +P HCNV+F +G ICL++L   +W+P W+LL+ V AI  LL
Sbjct: 59  HIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLL 118

Query: 120 ASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYL 152
           A P+P SPL++DL+ L+   D  A+NSLI YYL
Sbjct: 119 AYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  127 bits (318), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 97/157 (61%), Gaps = 6/157 (3%)

Query: 1   MSQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60
           M  R+ KEY+       R  +  YI++L P+S ++L  WE  I GP  +P+  H F L+I
Sbjct: 1   MESRILKEYKD-----SRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRI 55

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120
           +  + YPL  P  +F+   MPH NV+F++G ICL +LD  +W+P +++ ++V AI  LL 
Sbjct: 56  DIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLN 114

Query: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSR 157
            P   SPL++DLA L+R  D  A++ LI+Y+LN  ++
Sbjct: 115 EPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  125 bits (314), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 88/152 (57%), Gaps = 5/152 (3%)

Query: 1   MSQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60
           MSQR+ +EYR L    G   E     +L P    +L  WE+ + GP  TPY GH F L++
Sbjct: 1   MSQRVLREYRRLVAAGGAANES----NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120
              + YP  PP V F  R MPH NV +D+G +CL  L A  WTP  DL + V A+  LLA
Sbjct: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL-AGGWTPVMDLQYAVMAVRRLLA 115

Query: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYL 152
            P P+SPL+++LA L R GD  A++ +I Y L
Sbjct: 116 EPNPESPLNLELAALSRLGDHKAYDGIIKYRL 147

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  124 bits (311), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 93/152 (61%), Gaps = 6/152 (3%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEEN--LRKWESLITGPPDTPYFGHEFTLQI 60
           +R+ +EY+ L K L   P    ++SLAPV EEN  L +WE+   GP +TPY G  FTL+I
Sbjct: 2   RRILREYKQLQKQLALHPA---VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRI 58

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120
              E YP EPPK  F    + H N+ + +G +CL +L    W+P ++LL VV AI  LLA
Sbjct: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLA 118

Query: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYL 152
            P  DSPLDVDL+ L    DR+A++ ++ Y L
Sbjct: 119 EPGVDSPLDVDLSRLY-TTDRAAYDGVVNYRL 149

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  107 bits (267), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 85/152 (55%), Gaps = 5/152 (3%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEE-NLRKWESLITGPPDTPYFGHEFTLQI 60
           + R+  EY+ + + L     +  I+ L P  +  +L KWE+   GP +TPY    FTL I
Sbjct: 9   ASRMLAEYKQIREQLQ---SHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSI 65

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120
           E  E YP EPP  +F    + H N+ + +G +CL +L    W+P ++LL VV AI  LLA
Sbjct: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125

Query: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYL 152
            P  DSPLDVDLA L    D+ A+  L+ Y L
Sbjct: 126 EPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRL 156

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  106 bits (264), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 91/152 (59%), Gaps = 5/152 (3%)

Query: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEAS 63
           R+ KEY  L K L + PE+++I  LAPV +++L +W     GP ++P+ G E  L I   
Sbjct: 3   RIVKEYMGLQKRL-QTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITID 61

Query: 64  -EAYPLEP-PKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
            E YP+   P+V F+ R + H NV +D+G ICL +L  A WTP + LL VV AI  LLA 
Sbjct: 62  LEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA-WTPIYTLLDVVGAIRDLLAD 120

Query: 122 PEPDSPLDVDLACLVRAGDRSAHNSLIAYYLN 153
           P  DSPLD+D+A +  A D  A+  ++ Y L 
Sbjct: 121 PGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLE 151

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 89.4 bits (220), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 89/169 (52%), Gaps = 15/169 (8%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DP  A  I+L  VSE ++   +    GPP TPY G +F + IE
Sbjct: 4   AKRIMKEIQAVKD----DP--AAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+QF  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLAC-LVRAGDRSAHNSLIA----YYLNGGSRGHCGHVSE 165
           PEP+ P D ++A   +R  DR + N   A     Y + G+ G  G+V E
Sbjct: 116 PEPNDPQDAEVAQHYLR--DRESFNKTAALWTRLYASEGANGQKGNVEE 162

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 89.4 bits (220), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 89/169 (52%), Gaps = 15/169 (8%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DP  A  I+L  VSE ++   +    GPP TPY G +F + IE
Sbjct: 4   AKRIMKEIQAVKD----DP--AAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+QF  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLAC-LVRAGDRSAHNSLIA----YYLNGGSRGHCGHVSE 165
           PEP+ P D ++A   +R  DR + N   A     Y + G+ G  G+V E
Sbjct: 116 PEPNDPQDAEVAQHYLR--DRESFNKTAALWTRLYASEGANGQKGNVEE 162

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 87.4 bits (215), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 88/169 (52%), Gaps = 15/169 (8%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DP  A  I+L  VSE ++   +    GPP TPY G +F + IE
Sbjct: 4   AKRIMKEIQAVKD----DP--AAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+QF  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLAC-LVRAGDRSAHNSLIA----YYLNGGSRGHCGHVSE 165
           PEP+ P D ++A   +R  DR + N   A     Y +  S G  G+V E
Sbjct: 116 PEPNDPQDAEVAQHYLR--DRESFNKTAALWTRLYASETSNGQKGNVEE 162

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 85.9 bits (211), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 87/164 (53%), Gaps = 9/164 (5%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++RL KE +++      DP+    ISL+ VSE ++   +    GPP TPY G +F + I+
Sbjct: 4   AKRLMKEIQSVKD----DPDAN--ISLSFVSESDIHHLKGTFLGPPGTPYHGGKFVVDIQ 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+QF  +   H N+   +G ICL +L  + W+P   L   + ++  LL S
Sbjct: 58  VPLEYPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNS-WSPVLTLKTSLISLQALLQS 115

Query: 122 PEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGHCGHVSE 165
           PEP+ P D ++A    + DRS+ +   A +    + G  G+  E
Sbjct: 116 PEPNDPQDAEVAKHYLS-DRSSFDKTAALWTKTYASGETGNDEE 158

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 86/164 (52%), Gaps = 9/164 (5%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++RL KE +++      DP+    ISLA VSE ++   +    GPP TPY G  F + I+
Sbjct: 4   AKRLMKEIQSVKD----DPDAN--ISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQ 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+QF  +   H N+   +G ICL +L  + W+P   L   + ++  LL S
Sbjct: 58  VPLEYPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNS-WSPVLTLKTSLISLQALLQS 115

Query: 122 PEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGHCGHVSE 165
           PEP+ P D ++A    + DR++ +   A +    + G  G+  E
Sbjct: 116 PEPNDPQDAEVAKHYLS-DRASFDRTAALWTKTYASGQTGNDEE 158

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 84.3 bits (207), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 87/170 (51%), Gaps = 19/170 (11%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE  A+      DPE    I L  VSE ++   +    GPP+TPY G +F + IE
Sbjct: 4   AKRIMKEMEAVRD----DPEAN--IDLEFVSEADIHHLKGSFLGPPETPYEGGKFIVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK++F  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLAC-LVRAGDRSAHNSLIA----YYLNGG----SRGHCGH 162
           PEP+ P D ++A   +R  DR + N   A     Y NGG    S+G+   
Sbjct: 116 PEPNDPQDAEVAQHYLR--DRESFNKTAALWTKLYANGGDANSSKGNVDQ 163

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 83.6 bits (205), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 86/166 (51%), Gaps = 9/166 (5%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++RL KE +A+      DP  A  I+L  +SE ++ + +    GPP+TPY G  F + IE
Sbjct: 4   AKRLMKELQAVRD----DP--AANITLEFISESDIHRLKGSFLGPPETPYQGGRFIIDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK++F  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLAC-LVRAGDRSAHNSLIAYYLNGGSRGHCGHVSER 166
           PEP+ P D ++A   +R  +  +  + +   L   S G  G   E+
Sbjct: 116 PEPNDPQDAEVAQHYLRDKESFSKTAALWTRLYASSNGGSGAPVEK 161

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 82.8 bits (203), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 74/132 (56%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DPE    ISL  VSE ++   +    GPP TPY G +F + IE
Sbjct: 4   AKRIMKELQAVKD----DPEAN--ISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK++F ++   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMKFDSKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D ++A
Sbjct: 116 PEPNDPQDAEVA 127

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 82.8 bits (203), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DP  A  I+L  VSE ++   +    GPP TPY G +F + IE
Sbjct: 4   AKRIMKEIQAVKD----DP--AAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+QF  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D ++A
Sbjct: 116 PEPNDPQDAEVA 127

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 80.5 bits (197), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 79/145 (54%), Gaps = 11/145 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+AKE       LGRDP  +   S  PV ++ L  W++ I GPPD+PY G  F L I 
Sbjct: 3   SKRIAKEL----SDLGRDPPTS--CSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+ F  +   H N++ + G ICL +L    W+PA  L  V+ +I  LL  
Sbjct: 56  FPTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTLSKVLLSICSLLTD 112

Query: 122 PEPDSPLDVDLACLVRAGDRSAHNS 146
             PD PL  ++A + +  DR+ + +
Sbjct: 113 ANPDDPLVPEIAHIYKT-DRAKYEA 136

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 81.6 bits (200), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 85/169 (50%), Gaps = 15/169 (8%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DP  A  I+L  VSE ++   +    GPP+TPY G  F + IE
Sbjct: 4   AKRIMKEMQAVKD----DP--AANINLEFVSESDIHHLKGSFLGPPETPYQGGRFIVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK++F  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLAC-LVRAGDRSAHNSL----IAYYLNGGSRGHCGHVSE 165
           PEP+ P D ++A   +R  DR + N         Y  GG      +V E
Sbjct: 116 PEPNDPQDAEVAQHYLR--DRESFNKTATLWTTLYAEGGEEVANPNVDE 162

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 79.0 bits (193), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 73/137 (53%), Gaps = 10/137 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+AKE       LGRDP  +   S  PV ++ L  W++ I GP D+PY G  F L I 
Sbjct: 4   SKRIAKELS----DLGRDPPAS--CSAGPVGDD-LYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPKV F  +   H N++  SG ICL +L    W+PA  L  V+ +I  LL  
Sbjct: 57  FPTDYPFKPPKVNFTTKIY-HPNIN-SSGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLVRA 138
             PD PL  ++A + + 
Sbjct: 114 ANPDDPLVPEIAQIYKT 130

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 79.0 bits (193), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 73/137 (53%), Gaps = 10/137 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+AKE       LGRDP  +   S  PV ++ L  W++ I GP D+PY G  F L I 
Sbjct: 4   SKRIAKELS----DLGRDPPAS--CSAGPVGDD-LYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPKV F  +   H N++  SG ICL +L    W+PA  L  V+ +I  LL  
Sbjct: 57  FPTDYPFKPPKVNFTTKIY-HPNIN-SSGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLVRA 138
             PD PL  ++A + + 
Sbjct: 114 ANPDDPLVPEIAQIYKT 130

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 79.0 bits (193), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 73/137 (53%), Gaps = 10/137 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+AKE       LGRDP  +   S  PV ++ L  W++ I GP D+PY G  F L I 
Sbjct: 4   SKRIAKELS----DLGRDPPAS--CSAGPVGDD-LYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPKV F  +   H N++  SG ICL +L    W+PA  L  V+ +I  LL  
Sbjct: 57  FPTDYPFKPPKVNFTTKIY-HPNIN-SSGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLVRA 138
             PD PL  ++A + + 
Sbjct: 114 ANPDDPLVPEIAQIYKT 130

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 79.3 bits (194), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 68/124 (54%), Gaps = 4/124 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S  P  EENL KW   ITGP D+PY G  F + +   + YP EPPKV+F    M H NV
Sbjct: 32  LSAFPDHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKF-VSPMWHPNV 90

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHN 145
           D  SG ICL VL    W+  +++  ++ ++  LL  P   SPL+  +A  +  GD+  + 
Sbjct: 91  DL-SGNICLDVL-KEKWSAVYNVQTILLSLQALLGEPNNSSPLNA-IAAELWDGDKEEYA 147

Query: 146 SLIA 149
             +A
Sbjct: 148 RKLA 151

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 72/132 (54%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A       DPE    I+L+ VSE ++   +    GPP TPY G  F + I+
Sbjct: 4   AKRIIKEIQAAKD----DPEAN--ITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQ 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+QF  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPLEYPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D ++A
Sbjct: 116 PEPNDPQDAEVA 127

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 79.0 bits (193), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 79/145 (54%), Gaps = 11/145 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R++KE   L K    DP  ++  S  PV ++ L  W++ I GPPD+PY G  F L I 
Sbjct: 3   SKRISKELNDLRK----DPITSF--SAGPVGDD-LFHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+ F  +   H N++ + G ICL +L    W+PA  L  V+ +I  LL  
Sbjct: 56  FPTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTLSKVLLSICSLLTD 112

Query: 122 PEPDSPLDVDLACLVRAGDRSAHNS 146
             PD PL  ++A + +  DRS + +
Sbjct: 113 ANPDDPLVPEIAHIYKT-DRSKYET 136

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 73/137 (53%), Gaps = 10/137 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+AKE       LGRDP  +   S  PV ++ L  W++ I GP D+PY G  F L I 
Sbjct: 4   SKRIAKELS----DLGRDPPAS--CSAGPVGDD-LYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPKV F  +   H N++  SG ICL +L    W+PA  L  V+ ++  LL  
Sbjct: 57  FPTDYPFKPPKVNFTTKIY-HPNIN-SSGNICLDIL-KDQWSPALTLSKVLLSVCSLLTD 113

Query: 122 PEPDSPLDVDLACLVRA 138
             PD PL  ++A + + 
Sbjct: 114 ANPDDPLVPEIAQIYKT 130

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 80.1 bits (196), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 73/132 (55%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DPE    I+L  V+E ++   +    GPP+TPY   +F + IE
Sbjct: 4   AKRIMKEMQAVKD----DPEAH--ITLEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK++F  +   H NV   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D ++A
Sbjct: 116 PEPNDPQDAEVA 127

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 79.7 bits (195), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 72/132 (54%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DP  A  I+L  V+E ++   +    GPP TPY G  F + IE
Sbjct: 4   AKRIMKEMQAVKD----DP--AANITLDFVNESDIHHLKGSFLGPPGTPYEGGRFMIDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK++F  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D ++A
Sbjct: 116 PEPNDPQDAEVA 127

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 77/145 (53%), Gaps = 11/145 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+ KE       +GRDP  +   S  PV ++ L  W++ I GPPD+PY G  F L I 
Sbjct: 4   SKRITKEL----SDMGRDPPTS--CSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIH 56

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+ F  +   H N++ + G ICL +L    W+PA  L  V+ +I  LL  
Sbjct: 57  FPTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLVRAGDRSAHNS 146
             PD PL  ++A + +  DR  + +
Sbjct: 114 ANPDDPLVPEIAHIYKT-DRPKYEA 137

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 77.4 bits (189), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 77/145 (53%), Gaps = 11/145 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+ KE       +GRDP  +   S  PV ++ L  W++ I GPPD+PY G  F L I 
Sbjct: 3   SKRITKEL----SDMGRDPPTS--CSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+ F  +   H N++ + G ICL +L    W+PA  L  V+ +I  LL  
Sbjct: 56  FPTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTLSKVLLSICSLLTD 112

Query: 122 PEPDSPLDVDLACLVRAGDRSAHNS 146
             PD PL  ++A + +  DR  + +
Sbjct: 113 ANPDDPLVPEIAHIYKT-DRPKYEA 136

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 77.4 bits (189), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 11/144 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +R+ KE       LGRDP  +   S  PV ++ L  W++ I GPPD+PY G  F L I  
Sbjct: 4   KRITKELN----DLGRDPPTS--CSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
              YP +PPK+ F  +   H N++ + G ICL +L    W+PA  +  V+ +I  LL   
Sbjct: 57  PTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTISKVLLSICSLLTDA 113

Query: 123 EPDSPLDVDLACLVRAGDRSAHNS 146
            PD PL  ++A + +  DR+ + +
Sbjct: 114 NPDDPLVPEIAHIYKT-DRAKYEA 136

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 77.4 bits (189), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 11/144 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +R+ KE       LGRDP  +   S  PV ++ L  W++ I GPPD+PY G  F L I  
Sbjct: 4   KRITKELN----DLGRDPPTS--CSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
              YP +PPK+ F  +   H N++ + G ICL +L    W+PA  +  V+ +I  LL   
Sbjct: 57  PTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTISKVLLSICSLLTDA 113

Query: 123 EPDSPLDVDLACLVRAGDRSAHNS 146
            PD PL  ++A + +  DR+ + +
Sbjct: 114 NPDDPLVPEIAHIYKT-DRAKYEA 136

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 77.4 bits (189), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 11/144 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +R+ KE       LGRDP  +   S  PV ++ L  W++ I GPPD+PY G  F L I  
Sbjct: 4   KRITKELN----DLGRDPPTS--CSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
              YP +PPK+ F  +   H N++ + G ICL +L    W+PA  +  V+ +I  LL   
Sbjct: 57  PTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTISKVLLSICSLLTDA 113

Query: 123 EPDSPLDVDLACLVRAGDRSAHNS 146
            PD PL  ++A + +  DR+ + +
Sbjct: 114 NPDDPLVPEIAHIYKT-DRAKYEA 136

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 77.4 bits (189), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 11/144 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +R+ KE       LGRDP  +   S  PV ++ L  W++ I GPPD+PY G  F L I  
Sbjct: 4   KRITKELN----DLGRDPPTS--CSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
              YP +PPK+ F  +   H N++ + G ICL +L    W+PA  +  V+ +I  LL   
Sbjct: 57  PTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTISKVLLSICSLLTDA 113

Query: 123 EPDSPLDVDLACLVRAGDRSAHNS 146
            PD PL  ++A + +  DR+ + +
Sbjct: 114 NPDDPLVPEIAHIYKT-DRAKYEA 136

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 77.4 bits (189), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 21/152 (13%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+RL KEY+ L     RDP     I  AP SE NL  W+ LI GPPDTPY G  F  +++
Sbjct: 6   SRRLLKEYQQLI----RDPPPG--ILAAPKSESNLFLWDCLIQGPPDTPYEGGIFNARLD 59

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLL 109
             + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   + 
Sbjct: 60  FPKDYPLSPPKLTFTPSIL-HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVE 117

Query: 110 HVVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
            ++ ++  +L+ P  +S  +VD AC++   +R
Sbjct: 118 KILLSVMSMLSEPNIESGANVD-ACILWRDNR 148

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 78.6 bits (192), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 71/132 (53%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DP     I L  V+E ++   +    GPP TPY G +F + IE
Sbjct: 4   AKRIMKELQAVKD----DPTAK--IGLEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK++F  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D ++A
Sbjct: 116 PEPNDPQDAEVA 127

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 77.0 bits (188), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 11/144 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +R+ KE       LGRDP  +   S  PV ++ +  W++ I GPPD+PY G  F L I  
Sbjct: 5   KRITKELN----DLGRDPPTS--CSAGPVGDD-VYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
              YP +PPK+ F  +   H N++ + G ICL +L    W+PA  +  V+ +I  LL   
Sbjct: 58  PTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTISKVLLSICSLLTDA 114

Query: 123 EPDSPLDVDLACLVRAGDRSAHNS 146
            PD PL  ++A L +  DR+ + +
Sbjct: 115 NPDDPLVPEIAHLYKT-DRAKYEA 137

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 77.0 bits (188), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 11/144 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +R+ KE       LGRDP  +   S  PV ++ +  W++ I GPPD+PY G  F L I  
Sbjct: 5   KRITKELN----DLGRDPPTS--CSAGPVGDD-VYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
              YP +PPK+ F  +   H N++ + G ICL +L    W+PA  +  V+ +I  LL   
Sbjct: 58  PTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTISKVLLSICSLLTDA 114

Query: 123 EPDSPLDVDLACLVRAGDRSAHNS 146
            PD PL  ++A L +  DR+ + +
Sbjct: 115 NPDDPLVPEIAHLYKT-DRAKYEA 137

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 78.6 bits (192), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 72/132 (54%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DP  A  I+L  V+E ++   +    GPP TPY G  F + IE
Sbjct: 4   AKRIMKEMQAVKD----DP--AAKINLEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK++F  +   H NV   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D ++A
Sbjct: 116 PEPNDPQDAEVA 127

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 72/132 (54%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DPE    + L  V+E ++   +    GPP TPY   ++ + IE
Sbjct: 4   AKRVMKELQAIKD----DPEAR--VDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK++FQ +   H NV   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMKFQTKVY-HPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D ++A
Sbjct: 116 PEPNDPQDAEVA 127

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 76/144 (52%), Gaps = 11/144 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +R+ KE       LGRDP  +   S  PV ++ +  W++ I GPPD+PY G  F L I  
Sbjct: 5   KRITKELN----DLGRDPPTS--CSAGPVGDD-IYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
              YP +PPK+ F  +   H N++ + G ICL +L    W+PA  +  V+ +I  LL   
Sbjct: 58  PTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTISKVLLSICSLLTDA 114

Query: 123 EPDSPLDVDLACLVRAGDRSAHNS 146
            PD PL  ++A L +  DR  + +
Sbjct: 115 NPDDPLVPEIAHLYKT-DRPKYEA 137

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 77/144 (53%), Gaps = 11/144 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +R+ KE       LGRDP  +   S  PV ++ +  W++ I GPPD+PY G  F L I  
Sbjct: 4   KRITKELN----DLGRDPPTS--CSAGPVGDD-IYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
              YP +PPK+ F  +   H N++ + G ICL +L    W+PA  +  V+ +I  LL   
Sbjct: 57  PTDYPFKPPKIAFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTISKVLLSICSLLTDA 113

Query: 123 EPDSPLDVDLACLVRAGDRSAHNS 146
            PD PL  ++A + +  DR+ + +
Sbjct: 114 NPDDPLVPEIAHIYKT-DRAKYEA 136

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 71/132 (53%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DPE    I L  V+E ++   +    GPP TPY G +F + IE
Sbjct: 4   AKRIMKELQAVKD----DPEAR--IELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PP ++F  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPMMKFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D ++A
Sbjct: 116 PEPNDPQDAEVA 127

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 77.4 bits (189), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 71/132 (53%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DPE    + L  V+E ++   +    GPP TPY   +F + IE
Sbjct: 4   AKRVMKELQAIKD----DPEAK--VDLQLVNENDIHLLKGSFLGPPGTPYENGKFIVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK++F  +   H NV   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPKMKFDTKVY-HPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D ++A
Sbjct: 116 PEPNDPQDAEVA 127

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 75.5 bits (184), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 77/144 (53%), Gaps = 11/144 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +R+ KE       LGRDP  +   S  PV ++ +  W++ I GPPD+PY G  F L I  
Sbjct: 4   KRITKELN----DLGRDPPTS--CSAGPVGDD-VYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
              YP +PPK+ F  +   H N++ + G ICL +L    W+PA  +  V+ +I  LL   
Sbjct: 57  PTDYPFKPPKIAFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTISKVLLSICSLLTDA 113

Query: 123 EPDSPLDVDLACLVRAGDRSAHNS 146
            PD PL  ++A + +  DR+ + +
Sbjct: 114 NPDDPLVPEIAHIYKT-DRAKYEA 136

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 75.5 bits (184), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 76/144 (52%), Gaps = 11/144 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +R+ KE       LGRDP  +   S  PV ++ +  W++ I GPPD+PY G  F L I  
Sbjct: 5   KRITKELN----DLGRDPPTS--CSAGPVGDD-IYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
              YP +PPK+ F  +   H N++ + G ICL +L    W+PA  +  V+ +I  LL   
Sbjct: 58  PTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTISKVLLSICSLLTDA 114

Query: 123 EPDSPLDVDLACLVRAGDRSAHNS 146
            PD PL  ++A + +  DR  + +
Sbjct: 115 NPDDPLVPEIAHIYKT-DRPKYEA 137

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 76.3 bits (186), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 76.3 bits (186), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 76.3 bits (186), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFVSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 76.3 bits (186), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           IS +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  ISASPLPD-NVMLWNAMIIGPSDTPYEDGTFRLVLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDIL-QNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 131

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 75.5 bits (184), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 9   VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSE-MFHPNV 66

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 67  -YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 3/132 (2%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S  P  EE+L  W ++ITGP DTPY G  F L  + S++YP  PP V+F    M H NV
Sbjct: 36  LSAFPNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKF-ISPMWHPNV 94

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHN 145
           D  SG ICL +L    W+  +++  ++ ++  LL  P   SPL+   A L          
Sbjct: 95  DM-SGNICLDIL-KDQWSAVYNVETILLSLQALLEEPNNSSPLNAVAAELWDDDMNEYKK 152

Query: 146 SLIAYYLNGGSR 157
            L+A Y + G +
Sbjct: 153 RLLARYEDIGDQ 164

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 75.1 bits (183), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 77/145 (53%), Gaps = 11/145 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+AKE   L     RDP  +   S  PV ++ L  W++ I GP D+PY G  F L I 
Sbjct: 4   SKRIAKELSDLE----RDPPTS--CSAGPVGDD-LYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+ F  +   H N++ + G ICL +L    W+PA  L  V+ +I  LL  
Sbjct: 57  FPTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLVRAGDRSAHNS 146
             PD PL  ++A + +  DRS + +
Sbjct: 114 ANPDDPLVPEIAHIYKT-DRSKYEA 137

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 75.9 bits (185), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 75.9 bits (185), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 60/104 (57%), Gaps = 3/104 (2%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           +N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV + +G IC
Sbjct: 31  DNVMIWNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFISE-MFHPNV-YANGEIC 88

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
           L +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 89  LDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 75.5 bits (184), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 75.1 bits (183), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           E+NLR ++  I GP  +PY    F L++   E YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  EDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 75.1 bits (183), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           EENLR ++  I GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ ++  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 74.7 bits (182), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 75/133 (56%), Gaps = 10/133 (7%)

Query: 1   MSQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60
           + +R+ KE    ++ L  DP     IS  P  E+NLR +   I GP ++PY    F L++
Sbjct: 4   LPKRIIKE----TERLASDPVPG--ISAEP-HEDNLRYFAVTIEGPEESPYENGVFELEL 56

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120
              + YP+E PKV+F  R   H N+D   GRICL VL   +W+PA  +  V+ +I  LLA
Sbjct: 57  YLPDDYPMEAPKVRFLTRIY-HPNID-RLGRICLDVL-KNNWSPALQIRTVLLSIQALLA 113

Query: 121 SPEPDSPLDVDLA 133
           SP P+ PL  D+A
Sbjct: 114 SPNPNDPLANDVA 126

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 75.1 bits (183), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQ 131

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 76.6 bits (187), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 70/132 (53%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+ KE +A+ +    DPE    I L  V+E ++   +    GP  TPY G +F + I 
Sbjct: 4   SKRILKEIQAVKE----DPEAQ--IELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDIN 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PP+++F  +   H NV   +G ICL +L  A WTP   L   + ++  LL S
Sbjct: 58  IPVEYPYKPPQMKFDTKVY-HPNVSSVTGAICLDILKNA-WTPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D  +A
Sbjct: 116 PEPNDPQDAQVA 127

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 75.1 bits (183), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 7/129 (5%)

Query: 18  RDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQA 77
           RDP  ++  S  PV ++ L  W++ I GPPD+PY G  F L I     YP +PPK+ F  
Sbjct: 29  RDPISSF--SAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT 85

Query: 78  RCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
           +   H N++ + G ICL +L    W+PA  L  V+ +I  LL    PD PL  ++A + +
Sbjct: 86  KIY-HPNINAN-GNICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 142

Query: 138 AGDRSAHNS 146
             DRS + +
Sbjct: 143 T-DRSKYEA 150

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 74.7 bits (182), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DTPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 9   VSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSE-MFHPNV 66

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 67  -YANGEICLDIL-QNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 74.7 bits (182), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           E+NLR ++  I GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRFLTKIY-HPNID-KLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ ++  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 75.5 bits (184), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 70/132 (53%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++R+ KE +A+      DPE    I+L  V E ++   +    GPP TPY    F + IE
Sbjct: 4   AKRIMKELQAVKD----DPEAK--ITLEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIE 57

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PP+++F  +   H N+   +G ICL +L  A W+P   L   + ++  LL S
Sbjct: 58  VPMEYPFKPPQMKFDTKVY-HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D ++A
Sbjct: 116 PEPNDPQDAEVA 127

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 74.3 bits (181), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP +TPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP +TPY    F L +E  E YP +PP V+F +  M H NV
Sbjct: 20  VSASPLPD-NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 77

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 78  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 21/151 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L K     PE    I   PV+EEN+  W+ LI GPPD+PY G  F  +++ 
Sbjct: 7   KRLMKEMQQLLKDC---PEG---IVAGPVNEENMFLWDCLIAGPPDSPYEGGIFNARLQF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
              YPL PPK+ F    + H NV + +G +C+S+L A              W+P   +  
Sbjct: 61  PTDYPLSPPKLTFTPSIL-HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
           ++ ++  +L+ P  +S  ++D AC++   +R
Sbjct: 119 ILLSVMSMLSEPNVESGANID-ACILWRDNR 148

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 62/101 (61%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           E+NLR ++  I GP  +PY    F L++   + YP+EPPKV+F  +   H N+D   GRI
Sbjct: 29  EDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLA+P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++NLR +E  I GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  DDNLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 79/158 (50%), Gaps = 21/158 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L+    RDP    I   AP +E +L  W+ L+ GPPDTPY G  F  Q++ 
Sbjct: 7   KRLLKELQQLT----RDPPPGIIA--APKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAA------------HWTPAWDLLH 110
              YPL PP + F    + H NV + +G +C+S+L A              W+P   +  
Sbjct: 61  PTDYPLSPPTLTFTPSIL-HPNV-YPNGEVCISILHAPGSDPNMYELPEERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHNSLI 148
           ++ ++  +L+ P  +S  ++D AC++    R   N  +
Sbjct: 119 ILLSVVSMLSEPNVESGANID-ACILWRDHRDDFNKKV 155

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++NLR ++  I GP  +PY    F L++   E YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  DDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 64/112 (57%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP +TPY    F L +E  E YP +PP V+F +    H NV
Sbjct: 9   VSASPLPD-NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIF-HPNV 66

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 67  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++NLR ++  I GP  +PY    F L++   + YP+E PKV+F  R   H N+D   GRI
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFLTRIY-HPNID-RLGRI 76

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLASP P+ PL  D+A
Sbjct: 77  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           E+NLR ++  I GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  EDNLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ ++  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 79/152 (51%), Gaps = 21/152 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L K      +    I   P S++NL  W+ LI GPPDTPY G  F  Q+E 
Sbjct: 7   KRLYKELQQLIK------DSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
            + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDRS 142
           ++ ++  +L+ P  +S  ++D AC++   +R+
Sbjct: 119 ILLSVMSMLSEPNIESGANID-ACILWRDNRA 149

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 76/145 (52%), Gaps = 11/145 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+AKE   L     RDP  +   S  PV ++ L  W++ I GP D+PY G  F L I 
Sbjct: 4   SKRIAKELSDLE----RDPPTS--CSAGPVGDD-LYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+ F  +   H N++ + G ICL +L    W+PA  L  V+ +I  LL  
Sbjct: 57  FPTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLVRAGDRSAHNS 146
             PD PL  ++A + +  DR  + +
Sbjct: 114 ANPDDPLVPEIAHIYKT-DRPKYEA 137

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 76/145 (52%), Gaps = 11/145 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+AKE   L     RDP  +   S  PV ++ L  W++ I GP D+PY G  F L I 
Sbjct: 4   SKRIAKELSDLE----RDPPTS--CSAGPVGDD-LYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+ F  +   H N++ + G ICL +L    W+PA  L  V+ +I  LL  
Sbjct: 57  FPTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLVRAGDRSAHNS 146
             PD PL  ++A + +  DR  + +
Sbjct: 114 ANPDDPLVPEIAHIYKT-DRPKYEA 137

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 76/145 (52%), Gaps = 11/145 (7%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S+R+AKE   L     RDP  +   S  PV ++ L  W++ I GP D+PY G  F L I 
Sbjct: 4   SKRIAKELSDLE----RDPPTS--CSAGPVGDD-LYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
               YP +PPK+ F  +   H N++ + G ICL +L    W+PA  L  V+ +I  LL  
Sbjct: 57  FPTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLVRAGDRSAHNS 146
             PD PL  ++A + +  DR  + +
Sbjct: 114 ANPDDPLVPEIAHIYKT-DRPKYEA 137

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 64/112 (57%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP DT Y    F L +E  E YP +PP V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 81/154 (52%), Gaps = 21/154 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L++     PE    I   P SE+NL  W+ LITGPPD+PY G  F   +E 
Sbjct: 7   KRLLKELQQLARD---SPEG---IVAGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
            + YPL PP++ F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 61  PKDYPLSPPRLTFTPSIL-HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAH 144
           ++ ++  +L+ P  +S  ++D AC++   +R  +
Sbjct: 119 ILLSVTSMLSEPNVESGANID-ACILWRDNRPEY 151

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 72.4 bits (176), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 60/101 (59%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           E+NLR +   I GP D+ Y    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  EDNLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 72.4 bits (176), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++NLR +E  + GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  DDNLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 72.8 bits (177), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 80/154 (51%), Gaps = 19/154 (12%)

Query: 1   MSQRLAKE-YRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQ 59
           MS+   K  ++ L + L   PE    I   P SE+NL  W+ LI+GPPD+PY G  F   
Sbjct: 1   MSKTAQKRLFKELQQLLKDSPEG---IVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNAT 57

Query: 60  IEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWD 107
           +E  + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   
Sbjct: 58  LEFPKDYPLSPPKLLFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQS 115

Query: 108 LLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
           +  ++ ++  +L+ P  +S  ++D AC++   +R
Sbjct: 116 VEKILLSVMSMLSEPNVESGANID-ACILWRDNR 148

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 72.4 bits (176), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           E+NLR ++  I GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ ++  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KNNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 72.8 bits (177), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 78/151 (51%), Gaps = 21/151 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L K      + +  I   P SE +L  W+ LI GPPDTPY G  F  ++E 
Sbjct: 7   KRLLKELQQLMK------DSSTGIVAGPRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
            + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
           ++ ++  +L+ P  +S  +VD AC++   +R
Sbjct: 119 ILLSVMSMLSEPNVESGANVD-ACILWRDNR 148

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++NLR ++  I GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 76

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLASP P+ PL  D+A
Sbjct: 77  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 60/101 (59%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           E+NLR +   + GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ ++  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++NLR ++  I GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 63/126 (50%), Gaps = 3/126 (2%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           IS  PV + +L  W   ITGP  TPY G +F + +   E YP  PPK++F    M H NV
Sbjct: 28  ISAFPVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKF-VSPMWHPNV 86

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHN 145
           D  SG ICL +L    W+  +++  ++ ++  LL  P   SPL+   A L          
Sbjct: 87  D-KSGNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNKSPLNAVAAELWDTNMVEYRK 144

Query: 146 SLIAYY 151
            L+A Y
Sbjct: 145 KLLACY 150

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 71.6 bits (174), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++NLR ++  I GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 76

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLASP P+ PL  D+A
Sbjct: 77  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 72.0 bits (175), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           E+NLR ++  I GP  + Y    F L++   + YP+EPPKV+F  +   H N+D   GRI
Sbjct: 29  EDNLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLA+P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 72.4 bits (176), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 64/112 (57%), Gaps = 4/112 (3%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S +P+ + N+  W ++I GP +TPY    F L +E  E YP+  P V+F +  M H NV
Sbjct: 24  VSASPLPD-NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFLSE-MFHPNV 81

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            + +G ICL +L    WTP +D+  ++ +I  L   P P SP +V+ A L +
Sbjct: 82  -YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 60/101 (59%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++NLR +   + GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  DDNLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 79/152 (51%), Gaps = 21/152 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L K      +    I   P +E+N+ +W+ L+ GPPD+PY G  F  Q++ 
Sbjct: 7   KRLLKELQQLMK------DSPPGIVAGPKTEDNIFQWDCLVQGPPDSPYEGGVFNAQLDF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
            + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDRS 142
           ++ ++  +L+ P  +S  ++D AC++   +R 
Sbjct: 119 ILLSVMSMLSEPNIESGANID-ACILWRDNRK 149

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           IS  PV + +L  W   ITGP DTPY G +F + ++  + YP  PP ++F +  M H NV
Sbjct: 28  ISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLSP-MWHPNV 86

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHN 145
           D  SG ICL +L    W+  +++  ++ ++  LL  P   SPL+   A L  A       
Sbjct: 87  D-KSGNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDADMEEYRK 144

Query: 146 SLIAYY 151
            ++A Y
Sbjct: 145 KVLACY 150

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S  P  EE+L KW  +ITGP  TPY G  F + +E ++ YP   PKV+F    M H NV
Sbjct: 34  LSAFPEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRF-VSPMWHPNV 92

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHN 145
           D  SG ICL +L    W+  +++  ++ ++  LL  P   SPL+   A L     R    
Sbjct: 93  DM-SGNICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKDMREYKK 150

Query: 146 SLIAYY 151
            LIA Y
Sbjct: 151 KLIARY 156

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 61/121 (50%), Gaps = 5/121 (4%)

Query: 43  ITGPPDTPYFGH-EFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH 101
           IT  PD  Y+ H      ++ +E YP+EPPKV    R   H N+DF  G +CL++L    
Sbjct: 65  ITVNPDEGYYTHGSINFSLDFNEVYPIEPPKVACLKRIF-HPNIDF-KGNVCLNIL-RED 121

Query: 102 WTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGHCG 161
           W+PA DL  +V  +  L   P P+ PL+ D A L+   D       +   ++GGS  H  
Sbjct: 122 WSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLL-CQDEKEFAEAVRSTMSGGSINHVK 180

Query: 162 H 162
           +
Sbjct: 181 Y 181

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 78/149 (52%), Gaps = 19/149 (12%)

Query: 1   MSQRLAKE-YRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQ 59
           MS+   K  ++ L + L   PE    I   P SE+NL  W+ LI+GPPD+PY G  F   
Sbjct: 1   MSKTAQKRLFKELQQLLKDSPEG---IVAGPRSEDNLFLWDCLISGPPDSPYQGGVFNAT 57

Query: 60  IEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWD 107
           +E  + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   
Sbjct: 58  LEFPKDYPLSPPKLLFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQS 115

Query: 108 LLHVVHAIWLLLASPEPDSPLDVDLACLV 136
           +  ++ ++  +L+ P  +S  ++D AC++
Sbjct: 116 VEKILLSVMSMLSEPNVESGANID-ACIL 143

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 65/126 (51%), Gaps = 3/126 (2%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S  P SE++L +W  +I GP  TPY   +F L ++ ++ YP +PPKV F    M H NV
Sbjct: 29  LSAFPASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTF-VSPMWHPNV 87

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHN 145
           D  SG ICL +L    W+  +++  ++ ++  LL  P   SPL+   A L          
Sbjct: 88  DM-SGNICLDIL-KDQWSAVYNVQTILLSLQALLEEPNNGSPLNAIAAELWDTDMDEYKK 145

Query: 146 SLIAYY 151
            L A Y
Sbjct: 146 RLFARY 151

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 65/114 (57%), Gaps = 3/114 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++NLR ++  I GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 25  DDNLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 82

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHNS 146
           CL +L   +W+PA  +  V+ ++  LLASP P+ PL  D+A      +  A N+
Sbjct: 83  CLDIL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEEGAKNT 135

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 72.4 bits (176), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 74/142 (52%), Gaps = 7/142 (4%)

Query: 5   LAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASE 64
           L+      +    RDP  +   S  PV ++ L  W++ I GPPD+PY G  F L I    
Sbjct: 91  LSNVLNCFANVCLRDPPTS--CSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPT 147

Query: 65  AYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEP 124
            YP +PPK+ F  + + H N++  +G ICL +L    W+PA  +  V+ +I  LL    P
Sbjct: 148 DYPFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANP 204

Query: 125 DSPLDVDLACLVRAGDRSAHNS 146
           D PL  ++A + +  DR+ + +
Sbjct: 205 DDPLVPEIAHIYKT-DRAKYEA 225

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 80/151 (52%), Gaps = 21/151 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE   L+K     PE    I  +P+ + NL +W+ LI GPPD+ Y G  F  +++ 
Sbjct: 7   KRLLKELEKLTKD---SPEG---ILASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL------------DAAHWTPAWDLLH 110
            + YPL PPK+ FQ   + H N+ + +G +C+S+L            +   W+P   +  
Sbjct: 61  PKDYPLNPPKLTFQPSIL-HPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEM 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
           ++ ++  +L+ P  +S  ++D AC++   +R
Sbjct: 119 ILLSVMSILSEPNIESGANID-ACILWRDNR 148

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 79/152 (51%), Gaps = 21/152 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE   L + L   P+    I   PVSE+NL  W+ LI GP D+PY G  F  +++ 
Sbjct: 7   KRLMKE---LQQLLRDSPDG---IVAGPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
              YPL PPK+ F    + H NV + +G +C+S+L A              W+P   +  
Sbjct: 61  PRDYPLSPPKLTFTPSIL-HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDRS 142
           ++ ++  +L+ P  +S  ++D AC++   +R+
Sbjct: 119 ILLSVMSMLSEPNVESGANID-ACILWRDNRA 149

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 69.7 bits (169), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 60/101 (59%), Gaps = 3/101 (2%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++NLR +   I GP  +PY    F L++   + YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  DDNLRYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMESPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLA 133
           CL VL   +W+PA  +  V+ +I  LLASP P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 69.3 bits (168), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 76/151 (50%), Gaps = 21/151 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L K      +    I   P SE N+  W+ LI GPPDTPY    F  ++E 
Sbjct: 7   KRLLKELQQLIK------DSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGVFNTKLEF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
            + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
           ++ ++  +L+ P  +S  ++D AC++   +R
Sbjct: 119 ILLSVMSMLSEPNIESGANID-ACILWRDNR 148

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 69.7 bits (169), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 75/158 (47%), Gaps = 9/158 (5%)

Query: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGH-EFTLQIEA 62
           RL K+      +L   P     I  +P S + ++  +  +   PD  Y+ H   +  ++ 
Sbjct: 30  RLVKDL----DSLDLPPTVTLSIKASPQSTDRMQPPKLEVVVSPDEGYYNHGSISFSLDF 85

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
           +E YP+EPPKV    +   H N+D + G +CL++L    W+PA DL  ++  +  L   P
Sbjct: 86  NEVYPIEPPKVTCLKKIF-HPNIDLN-GNVCLNIL-REDWSPALDLQSIIIGLLFLFLEP 142

Query: 123 EPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGHC 160
            P+ PL+ D A L    D+      +   ++GGS  H 
Sbjct: 143 NPNDPLNKDAAKLF-CQDQKKFAETVILAMSGGSVDHV 179

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 68.9 bits (167), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 76/151 (50%), Gaps = 21/151 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L K      +    I   P SE N+  W+ LI GPPDTPY    F  ++E 
Sbjct: 7   KRLLKELQQLIK------DSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGVFNAKLEF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
            + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
           ++ ++  +L+ P  +S  ++D AC++   +R
Sbjct: 119 ILLSVMSMLSEPNIESGANID-ACILWRDNR 148

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 68.9 bits (167), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 72/151 (47%), Gaps = 9/151 (5%)

Query: 1   MSQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60
           +++RL  E   L  +  R       IS  P  + +L  W   ITGP  TPY   +F + +
Sbjct: 9   VTKRLQNELLQLLSSTTRS------ISAFPEDDNDLTYWTGYITGPQGTPYSDLKFKISL 62

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120
              E+YP  PPKV+F +  M H NVD  SG ICL +L    W+  +++  ++ ++  LL 
Sbjct: 63  NFPESYPFHPPKVKFVSP-MWHPNVDM-SGNICLDIL-KEKWSAVYNVETILLSLQSLLG 119

Query: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYY 151
            P   SPL+   A L           ++A Y
Sbjct: 120 EPNNRSPLNAVAAELWDKDMEEYKKKVLACY 150

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 68.9 bits (167), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 76/151 (50%), Gaps = 21/151 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L K      +    I   P SE N+  W+ LI GPPDTPY    F  ++E 
Sbjct: 7   KRLLKELQQLIK------DSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
            + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
           ++ ++  +L+ P  +S  ++D AC++   +R
Sbjct: 119 ILLSVMSMLSEPNIESGANID-ACILWRDNR 148

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 68.6 bits (166), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 76/151 (50%), Gaps = 21/151 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L K      +    I   P SE N+  W+ LI GPPDTPY    F  ++E 
Sbjct: 7   KRLLKELQQLIK------DSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGIFNAKLEF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
            + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
           ++ ++  +L+ P  +S  ++D AC++   +R
Sbjct: 119 ILLSVMSMLSEPNIESGANID-ACILWRDNR 148

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 73/147 (49%), Gaps = 20/147 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ L +      E    I   P  E N+ +W+ LI+GPP+TPY    F   +  
Sbjct: 9   KRLLKEYQQLIR------ESPPGIVAGPSDENNMFEWDCLISGPPETPYENGVFNATLLF 62

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
            + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 63  PKDYPLSPPKLTFTPSLL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 120

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVR 137
           ++ ++  +L+ P  +S  ++D + L R
Sbjct: 121 ILLSVMSMLSEPNIESGANIDASILYR 147

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 67.8 bits (164), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 77/151 (50%), Gaps = 21/151 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L+K      +    I   P +E NL  W+ L+ GPPDT Y G  F  ++E 
Sbjct: 7   RRLLKELQQLTK------DSPPGIVACPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
            + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
           ++ ++  +L+ P  +S  ++D AC++   +R
Sbjct: 119 ILLSVMSMLSEPNIESGANID-ACILWRDNR 148

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 67.8 bits (164), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 77/152 (50%), Gaps = 21/152 (13%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KE + L+K      +    I   P +E NL  W+ L+ GPPDT Y G  F  +++ 
Sbjct: 7   RRLLKELQQLNK------DSPPGIVAGPANENNLFVWDCLVQGPPDTAYEGGIFNARLDF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
            + YPL PPK+ F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDRS 142
           ++ ++  +L+ P  +S  ++D AC++   +R 
Sbjct: 119 ILLSVMSMLSEPNIESGANID-ACILWRDNRK 149

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 67.4 bits (163), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S  P SE++L KW  +ITGP  TPY G  F + +E ++ YP   PKV+F    M H NV
Sbjct: 34  LSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRF-VSPMWHPNV 92

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHN 145
           D  SG ICL +L    W+  +++  ++ ++  LL  P   SPL+   A L     +    
Sbjct: 93  DM-SGNICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDTDMQEYKK 150

Query: 146 SLIAYY 151
            L A Y
Sbjct: 151 KLYARY 156

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 67.0 bits (162), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 75/152 (49%), Gaps = 21/152 (13%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
            +RL KE + L     RDP     I   P  E +L  W+ L+ GPPD+PY G  F  Q+ 
Sbjct: 6   QRRLLKELQQLM----RDPPPG--IVAGPQDESDLFLWDCLVQGPPDSPYEGGVFEAQLR 59

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLL 109
               YPL PPK+ F    + H NV + +G +C+S+L A              W+P   + 
Sbjct: 60  FPRDYPLSPPKLTFVPSVL-HPNV-YPNGEVCISILHAPGEDPNQYELAEERWSPVQSVE 117

Query: 110 HVVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
            ++ ++  +L+ P  +S  ++D AC++   +R
Sbjct: 118 KILLSVVSMLSEPNVESGANID-ACVLWRDNR 148

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 67.8 bits (164), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 68/124 (54%), Gaps = 8/124 (6%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           E++++++     GP DTPY G  + L +E  + YP + P + F  +   H N+D  SG I
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSI 85

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIA 149
           CL V+++  W+P +DLL++V   W+   LL  P    PL+ + A L +  D+  +   + 
Sbjct: 86  CLDVINST-WSPLYDLLNIVE--WMLPGLLKEPNGSDPLNNEAANL-QLKDKKVYEEKVR 141

Query: 150 YYLN 153
            Y++
Sbjct: 142 EYID 145

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 60/110 (54%), Gaps = 3/110 (2%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S  P +E++LR W  +I GP  TPY   +F + +   ++YP  PPKV+F    M H NV
Sbjct: 32  LSAFPNNEDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKF-ISPMWHPNV 90

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACL 135
           D  SG ICL +L    W+  +++  ++ ++  L   P   SPL+   A L
Sbjct: 91  DM-SGNICLDIL-KDQWSAVYNVQTILLSLQSLFEEPNNSSPLNAVAAEL 138

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 67/123 (54%), Gaps = 8/123 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           +N++++     GP DTPY G  + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 29  DNMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSIC 87

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DLL+++   W+   LL  P    PL+ + A L +  D+  +   I  
Sbjct: 88  LDVINST-WSPLYDLLNIIE--WMIPGLLKEPNGSDPLNNEAAGL-QLHDKKIYEEKIKE 143

Query: 151 YLN 153
           Y++
Sbjct: 144 YID 146

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 55/104 (52%), Gaps = 3/104 (2%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           I   PV + +L  W   I GP  TPY   +F + +   E YP  PPKV+F +  M H NV
Sbjct: 28  IGAFPVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKFVSP-MWHPNV 86

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLD 129
           D  SG ICL +L    W+  +++  ++ ++  LL  P   SPL+
Sbjct: 87  D-KSGNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLN 128

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 65.9 bits (159), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 61/117 (52%), Gaps = 5/117 (4%)

Query: 47  PDTPYFGH-EFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPA 105
           PD  Y+ +      ++ +E YP+EPPKV    +   H N+D   G +CL++L    W+PA
Sbjct: 70  PDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIF-HPNIDL-KGNVCLNIL-REDWSPA 126

Query: 106 WDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGHCGH 162
            DL  ++  +  L   P P+ PL+ D A L+  G++    + +   ++GGS  H  +
Sbjct: 127 LDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEA-VRLTMSGGSIEHVKY 182

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 65.5 bits (158), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 76/163 (46%), Gaps = 24/163 (14%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ L +      +    I   P +E +L  W+ LI GPPDTPY    F  Q+  
Sbjct: 7   KRLFKEYQQLIR------DSPPGIVAGPANENDLFLWDCLIQGPPDTPYEHGVFNAQLRF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA------------AHWTPAWDLLH 110
              YPL PP + F    + H N+ + +G +C+S+L +              W+P   +  
Sbjct: 61  PRDYPLSPPTLTFTPAIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAG----DRSAHNSLIA 149
           ++ ++  +L+ P  +S  ++D   L R      +R    S++A
Sbjct: 119 ILLSVMSMLSEPNVESGANIDACILWRDNRPEFERQVKRSIVA 161

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 65.1 bits (157), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (51%), Gaps = 3/126 (2%)

Query: 26  ISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNV 85
           +S  P +E++L KW  +ITGP  TPY G  F + ++  ++YP   P+V F    M H NV
Sbjct: 34  LSAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTF-VSPMWHPNV 92

Query: 86  DFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHN 145
           D  SG ICL +L    W+  +++  ++ ++  LL  P   SPL+   A L          
Sbjct: 93  DM-SGNICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKNMEEYKR 150

Query: 146 SLIAYY 151
            L+A Y
Sbjct: 151 KLMARY 156

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 65.5 bits (158), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 68/144 (47%), Gaps = 5/144 (3%)

Query: 20  PEYAYIISLAPVSEENLRKWESLITGPPDTPYFGH-EFTLQIEASEAYPLEPPKVQFQAR 78
           P     +   P S + ++  +  +T  PD  Y+ H      ++ +E YP+EPPKV    +
Sbjct: 42  PTVTLNVITPPDSTDRMQSPKLEVTVSPDEGYYNHGSINFGLDFNEVYPIEPPKVACLKK 101

Query: 79  CMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRA 138
              H N+D   G +CL++L    W+PA DL  ++  +  L   P P+ PL+ D A L   
Sbjct: 102 IF-HPNIDL-KGNVCLNIL-REDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLFCQ 158

Query: 139 GDRSAHNSLIAYYLNGGSRGHCGH 162
            ++     ++   ++GGS     +
Sbjct: 159 NEKK-FAEIVRSTMSGGSVNQVQY 181

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 65.1 bits (157), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 67/130 (51%), Gaps = 13/130 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEEN----LRKWESLITGPPDTPYFGHEFTL 58
           QRL +E +   K      ++ +     PV + +    L+KWE+ I G   T + G  + +
Sbjct: 7   QRLQEERKKWRK------DHPFGFYAKPVKKSDGSMDLQKWEAGIPGKEGTNWAGGVYPI 60

Query: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH-WTPAWDLLHVVHAIWL 117
            +E    YP +PPKV+F A    H NV + SG ICLS+L+    W PA  L  +V  +  
Sbjct: 61  SVEYPNEYPSKPPKVKFPAGFY-HPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQD 118

Query: 118 LLASPEPDSP 127
           LL SP P+SP
Sbjct: 119 LLDSPNPNSP 128

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 65.9 bits (159), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 66/124 (53%), Gaps = 8/124 (6%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           E+ ++++     GP DTPY    + L +E  + YP + P + F  +   H N+D  SG I
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSI 85

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIA 149
           CL V+++  W+P +DLL++V   W+   LL  P    PL+ + A L +  D+  +   I 
Sbjct: 86  CLDVINST-WSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAATL-QLKDKDMYEQKIH 141

Query: 150 YYLN 153
            Y+N
Sbjct: 142 EYIN 145

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 63.2 bits (152), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 55/102 (53%), Gaps = 4/102 (3%)

Query: 45  GPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTP 104
           GPPD+PY G  F L I     YP +PPK+ F  +   H N++ + G ICL +L    W+P
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICLDIL-KDQWSP 58

Query: 105 AWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHNS 146
           A  L  V+ +I  LL    PD PL  ++A + +  DR  + +
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEA 99

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 64.3 bits (155), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 67/130 (51%), Gaps = 13/130 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEEN----LRKWESLITGPPDTPYFGHEFTL 58
           QRL +E +   K      ++ +     PV + +    L+KWE+ I G   T + G  + +
Sbjct: 7   QRLQEERKKWRK------DHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPI 60

Query: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH-WTPAWDLLHVVHAIWL 117
            +E    YP +PPKV+F A    H NV + SG ICLS+L+    W PA  L  +V  +  
Sbjct: 61  TVEYPNEYPSKPPKVKFPAGFY-HPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQD 118

Query: 118 LLASPEPDSP 127
           LL SP P+SP
Sbjct: 119 LLDSPNPNSP 128

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 65.1 bits (157), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 67/123 (54%), Gaps = 8/123 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           +N++++     GP DTPY    + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 28  DNMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSIC 86

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DLL++V   W+   LL  P    PL+ + A L +  D++ +   I  
Sbjct: 87  LDVINST-WSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAAGL-QLHDKTLYEQKIKE 142

Query: 151 YLN 153
           Y++
Sbjct: 143 YID 145

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 63.9 bits (154), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 67/130 (51%), Gaps = 13/130 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEEN----LRKWESLITGPPDTPYFGHEFTL 58
           QRL +E +   K      ++ +     PV + +    L+KWE+ I G   T + G  + +
Sbjct: 7   QRLQEERKKWRK------DHPFGFYAKPVKKADGSMDLQKWEAGIPGREGTNWAGGVYPI 60

Query: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH-WTPAWDLLHVVHAIWL 117
            +E    YP +PPKV+F A    H NV + SG ICLS+L+    W PA  L  +V  +  
Sbjct: 61  TVEYPNEYPSKPPKVKFPAGFY-HPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQD 118

Query: 118 LLASPEPDSP 127
           LL SP P+SP
Sbjct: 119 LLDSPNPNSP 128

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 60/112 (53%), Gaps = 8/112 (7%)

Query: 45  GPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTP 104
           GP DTPY    + L +E  + YP + P + F  +   H N+D  SG ICL V+++  W+P
Sbjct: 39  GPKDTPYENGVWRLHVELPDNYPFKSPSIGFVNKIY-HPNIDIASGSICLDVINST-WSP 96

Query: 105 AWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLN 153
            +DLL++V   W+   LL  P    PL+ + A L +  D+  +   I  Y++
Sbjct: 97  LYDLLNIVE--WMIPGLLKEPNGSDPLNNEAATL-QLRDKKMYEEKIKEYID 145

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 64/122 (52%), Gaps = 8/122 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           +N++++     GP DTPY    + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 45  DNMQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSIC 103

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DLL++V   W+   LL  P    PL+ + A L    D+  +   I  
Sbjct: 104 LDVINST-WSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAATL-ELKDKKLYEERIKE 159

Query: 151 YL 152
           Y+
Sbjct: 160 YI 161

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 3/94 (3%)

Query: 35  NLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICL 94
           +L+KWE+ I G   T + G  + + +E    YP +PPKV+F A    H NV + SG ICL
Sbjct: 37  DLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKFPAGFY-HPNV-YPSGTICL 94

Query: 95  SVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           S+L+    W PA  L  +V  +  LL SP P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 3/94 (3%)

Query: 35  NLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICL 94
           NL+KWE+ I G   T +    + + IE  + YP +PPKV+F A    H N+ + SG +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  SVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           S+L+    W PA  L  +V  +  LL SP PDSP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 64.3 bits (155), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 66/123 (53%), Gaps = 8/123 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           +N++++     GP DTPY    + L +E  + YP + P + F  + + H N+D  SG IC
Sbjct: 15  DNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIL-HPNIDVASGSIC 73

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DL ++V   W+   LL  P    PL+ + A L +  D+  +   I  
Sbjct: 74  LDVINST-WSPLYDLKNIVE--WMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIKE 129

Query: 151 YLN 153
           Y++
Sbjct: 130 YID 132

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 66/123 (53%), Gaps = 8/123 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           +N++++     GP DTPY    + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 27  DNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDVASGSIC 85

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DL+++V   W+   LL  P    PL+ + A L +  D+  +   I  
Sbjct: 86  LDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL-QLRDKVLYEQKIKE 141

Query: 151 YLN 153
           Y++
Sbjct: 142 YID 144

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 76/159 (47%), Gaps = 10/159 (6%)

Query: 2   SQRLAKEYRALSKTLGR--DPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQ 59
           SQ+L+   R L+  L     P    + +L P  + +      +   P +  Y G  F   
Sbjct: 7   SQQLSAPRRRLTVDLNSLDVPPTVSLTTLVPPEDTSRSPLLQITICPDEGFYNGGRFKFN 66

Query: 60  IEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLL 119
           +  SE+YP++PP V    +   H N+D + G+ICL++L    W+PA D+  V+  +  L 
Sbjct: 67  LTTSESYPIDPPSVVCLQKIY-HPNIDLN-GKICLNIL-REDWSPALDIQSVIVGLLFLF 123

Query: 120 ASPEPDSPLDVDLACLVRAGDRSAHN--SLIAYYLNGGS 156
             P P  PL+ D A  +    R++H+   L+   + GG+
Sbjct: 124 LEPNPRDPLNKDAASTLI---RNSHDFARLVEKTMQGGN 159

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 63.2 bits (152), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 3/94 (3%)

Query: 35  NLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICL 94
           NL+KWE+ I G   T +    F + +E  + YP +PPKV+F A    H N+ + SG +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  SVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           S+L+    W PA  L  +V  +  LL SP P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 64.3 bits (155), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 66/123 (53%), Gaps = 8/123 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           ++++++     GP DTPY    + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 27  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSIC 85

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DL+++V   W+   LL  P    PL+ + A L +  D+  +   I  
Sbjct: 86  LDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIKE 141

Query: 151 YLN 153
           Y++
Sbjct: 142 YID 144

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 63.9 bits (154), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 65/123 (52%), Gaps = 8/123 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           +N++++     GP DTPY    + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 29  DNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSIC 87

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DL ++V   W+   LL  P    PL+ + A L +  D+  +   I  
Sbjct: 88  LDVINST-WSPLYDLKNIVE--WMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIKE 143

Query: 151 YLN 153
           Y++
Sbjct: 144 YID 146

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 63.9 bits (154), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 66/123 (53%), Gaps = 8/123 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           ++++++     GP DTPY    + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 27  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSIC 85

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DL+++V   W+   LL  P    PL+ + A L +  D+  +   I  
Sbjct: 86  LDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIKE 141

Query: 151 YLN 153
           Y++
Sbjct: 142 YID 144

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 62.8 bits (151), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 65/128 (50%), Gaps = 9/128 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYII--SLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60
           QRL +E +   K    D  + +    +  P    NL+KWE+ I G   T +    F + I
Sbjct: 7   QRLQEERKKWRK----DHPFGFFAKPTKKPDGSMNLQKWEAGIPGKEGTIWKDGVFPITI 62

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH-WTPAWDLLHVVHAIWLLL 119
           E  + YP +PPKV+F A    H N+ + SG +CLS+L+    W PA  L  +   +  LL
Sbjct: 63  EYPDDYPSKPPKVKFPAGFY-HPNI-YPSGTVCLSILNEDQDWRPAITLKQIALGVQDLL 120

Query: 120 ASPEPDSP 127
            SP P+SP
Sbjct: 121 DSPNPNSP 128

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 63.9 bits (154), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 66/123 (53%), Gaps = 8/123 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           ++++++     GP DTPY    + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 27  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSIC 85

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DL+++V   W+   LL  P    PL+ + A L +  D+  +   I  
Sbjct: 86  LDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIKE 141

Query: 151 YLN 153
           Y++
Sbjct: 142 YID 144

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 62.8 bits (151), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 67/130 (51%), Gaps = 13/130 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEE----NLRKWESLITGPPDTPYFGHEFTL 58
           QRL +E +   K      ++ +     P  +E    NL+KWE+ I G   T +    + +
Sbjct: 7   QRLQEERKKWRK------DHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDAVYPI 60

Query: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH-WTPAWDLLHVVHAIWL 117
            IE  + YP +PPKV+F A    H N+ + SG +CLS+L+    W PA  +  ++  +  
Sbjct: 61  TIEYPDDYPSKPPKVKFPAGFY-HPNI-YPSGTVCLSILNEDQDWKPAITMKQILLGVQD 118

Query: 118 LLASPEPDSP 127
           LL SP PDSP
Sbjct: 119 LLTSPNPDSP 128

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 61.6 bits (148), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 3/94 (3%)

Query: 35  NLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICL 94
           NL+KWE+ I G   T +    F + IE  + YP +PPKV+F A    H N+ + SG +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 59

Query: 95  SVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           S+L+    W PA  L  +   +  LL SP P+SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 63.2 bits (152), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 7/105 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           +N++++     GP +TPY G  + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 15  DNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSIC 73

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACL 135
           L V+++A W+P +DLL+++   W+   LL  P    PL+ + A L
Sbjct: 74  LDVINSA-WSPLYDLLNILE--WMIPGLLKEPNGSDPLNNEAATL 115

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 61.6 bits (148), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 66/128 (51%), Gaps = 9/128 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEE--NLRKWESLITGPPDTPYFGHEFTLQI 60
           QRL +E +   K    D  Y +       ++   NL+KWE+ I G   T +    + L I
Sbjct: 7   QRLQEERKKWRK----DHPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPLTI 62

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH-WTPAWDLLHVVHAIWLLL 119
           E  + YP +PPKV+F A    H NV + SG ICLS+L+    W PA  L  ++  +  LL
Sbjct: 63  EYPDDYPSKPPKVKFPAGFY-HPNV-YPSGTICLSILNEDQDWRPAITLKQLLLGVQDLL 120

Query: 120 ASPEPDSP 127
            SP P+SP
Sbjct: 121 DSPNPNSP 128

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 63.2 bits (152), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 59/112 (52%), Gaps = 8/112 (7%)

Query: 45  GPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTP 104
           GP DTPY    + L +E  + YP + P + F  +   H N+D  SG ICL V+++  W+P
Sbjct: 61  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICLDVINST-WSP 118

Query: 105 AWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLN 153
            +DLL++V   W+   LL  P    PL+ + A L    D+  +   I  Y++
Sbjct: 119 LYDLLNIVE--WMIPGLLKEPNGSDPLNNEAATL-ELRDKKLYEEKIREYID 167

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 61.6 bits (148), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 3/94 (3%)

Query: 35  NLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICL 94
           NL+ WE+ I G   T + G  + + IE  + YP +PPKV+F A    H N+ + SG +CL
Sbjct: 37  NLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  SVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           S+L+    W PA  L  +V  +  LL +P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 66/123 (53%), Gaps = 8/123 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           +N++++     GP +TPY    + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 27  DNMQEFFIKFFGPDETPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSIC 85

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DL+++V   W+   LL  P    PL+ + A L +  D+  +   I  
Sbjct: 86  LDVINST-WSPLYDLINIVE--WMIPGLLKEPNGTDPLNNEAAGL-QLRDKKLYEEKIKE 141

Query: 151 YLN 153
           Y++
Sbjct: 142 YID 144

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 61.6 bits (148), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 68/145 (46%), Gaps = 7/145 (4%)

Query: 20  PEYAYIISLAPVSEENLRKWESLITGPPDTPYF--GHEFTLQIEASEAYPLEPPKVQFQA 77
           P  +  I ++P    +L      +   PD  Y+  GH F   +E ++ YP+EPPKV  + 
Sbjct: 50  PTVSLTICISPTDPSSLDNPLLDVIISPDEGYYKNGH-FRFSLEFNDNYPMEPPKVVCRN 108

Query: 78  RCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
           R   H N+D   G++CL++L    W+PA DL  ++  +  L   P    PL+ D A  V 
Sbjct: 109 RIY-HPNIDV-QGKVCLNIL-REDWSPALDLQSIIVGLLFLFLEPNAKDPLNTD-AAAVF 164

Query: 138 AGDRSAHNSLIAYYLNGGSRGHCGH 162
           + D +A    +   + G S     +
Sbjct: 165 SKDSNAFAKFVRKTMEGYSLNSVSY 189

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 3/94 (3%)

Query: 35  NLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICL 94
           NL+KWE+ I G   T +    + + IE  + YP +PPKV+F A    H N+ + SG +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  SVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           S+L+    W PA  L  +   +  LL SP P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 66/123 (53%), Gaps = 8/123 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           ++++++     GP DTPY    + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 26  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSIC 84

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DL++++   W+   LL  P    PL+ + A L +  D+  +   I  
Sbjct: 85  LDVINST-WSPLYDLINILE--WMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIKE 140

Query: 151 YLN 153
           Y++
Sbjct: 141 YID 143

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 67/130 (51%), Gaps = 13/130 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEE----NLRKWESLITGPPDTPYFGHEFTL 58
           QRL +E +   K      ++ +     P  +E    NL+KWE+ I G   T +    + +
Sbjct: 7   QRLQEERKKWRK------DHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDGVYPI 60

Query: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH-WTPAWDLLHVVHAIWL 117
            IE  + YP +PP+V+F A    H N+ + SG +CLS+L+    W PA  +  ++  +  
Sbjct: 61  TIEYPDDYPSKPPRVKFPAGFY-HPNI-YPSGTVCLSILNEDQDWKPAITMKQILLGVQD 118

Query: 118 LLASPEPDSP 127
           LL SP P+SP
Sbjct: 119 LLTSPNPNSP 128

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 3/94 (3%)

Query: 35  NLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICL 94
           NL+KWE+ I G   T +    + + IE  + YP +PPKV+F A    H N+ + SG +CL
Sbjct: 37  NLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRFPAGFY-HPNI-YPSGTVCL 94

Query: 95  SVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           S+L+    W PA  L  +V  +  LL +P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 58.9 bits (141), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 3/94 (3%)

Query: 35  NLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICL 94
           +L++WE+ I G   T +    + + IE  + YP +PPKV F  +   H NV + SG ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMF-PKGFYHPNV-YPSGTICL 59

Query: 95  SVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           S+L+    W PA  L  +V  +  LL SP P+SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 60.5 bits (145), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 57/120 (47%), Gaps = 13/120 (10%)

Query: 42  LITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMP---HCNVDFDSGRICLSVLD 98
           LI  P +  Y    FT ++  +E YP+EPP+V    RCM    H N+D   G+ICL++L 
Sbjct: 66  LIVSPDEGFYRKGHFTFEMTFTEKYPIEPPQV----RCMNQIFHPNIDL-QGKICLNIL- 119

Query: 99  AAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAG----DRSAHNSLIAYYLNG 154
              W+PA DL  V+  I  L        PL+   A L+        R    ++  Y L+G
Sbjct: 120 REDWSPALDLQSVIIGILFLFLEVSGRDPLNKQAASLLDENPNKFSRLVQQTMAGYSLDG 179

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 59.3 bits (142), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 52/99 (52%), Gaps = 3/99 (3%)

Query: 30  PVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDS 89
           P    NL+KWE+ I G   T +    + + IE    YP +PPKV+  A    H NV + S
Sbjct: 32  PDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKLPANFY-HPNV-YPS 89

Query: 90  GRICLSVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           G ICLS+L+    W PA  L  +   I  LL SP P+SP
Sbjct: 90  GTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 60.1 bits (144), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 66/123 (53%), Gaps = 8/123 (6%)

Query: 34  ENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRIC 93
           ++++++     GP DTPY    + L +E  + YP + P + F  +   H N+D  SG IC
Sbjct: 15  DSMQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSIC 73

Query: 94  LSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAY 150
           L V+++  W+P +DL+++V   W+   LL  P    PL+ + A L +  ++  +   I  
Sbjct: 74  LDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL-QLKNKELYEEKIQE 129

Query: 151 YLN 153
           Y++
Sbjct: 130 YID 132

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 58.9 bits (141), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 35  NLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICL 94
           NL+KWE+ I G   T +    + + IE    YP +PPKV+  A    H NV + SG ICL
Sbjct: 37  NLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKLPAGFY-HPNV-YPSGTICL 94

Query: 95  SVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           S+L+    W PA  L  +   I  LL SP P+SP
Sbjct: 95  SILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 58.9 bits (141), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 52/94 (55%), Gaps = 3/94 (3%)

Query: 35  NLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICL 94
           NL++WE+ I G   T +    + L IE  + YP +PPKV+  A    H NV + SG ICL
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKLPAGFY-HPNV-YPSGTICL 94

Query: 95  SVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           S+L+    W PA  L  +   I  LL SP P+SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 60.1 bits (144), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 58/106 (54%), Gaps = 7/106 (6%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++N++++     GP  TPY    + L +E  + YP + P + F  +   H N+D  SG I
Sbjct: 26  DDNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSI 84

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACL 135
           CL V+++  W+P +DL+++V   W+   LL  P    PL+ + A L
Sbjct: 85  CLDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 60.1 bits (144), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ L ++    P +     LA  +E+N+ +W  +ITGPPDTPY G ++   +  
Sbjct: 8   KRLTKEYKLLVES---SPPFI----LARPNEDNILEWHYIITGPPDTPYDGGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P+     ++ R+CLS+ D     W P W +  +++ +   + 
Sbjct: 61  PNDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

Query: 121 SPE 123
             E
Sbjct: 117 GNE 119

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 60.1 bits (144), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 65/123 (52%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL+KEY    K++  +P   +II  A  +E+N+ +W  +ITGPPDTPY G ++   +  
Sbjct: 8   KRLSKEY----KSMVENPP-PFII--AQPNEDNVLEWHYVITGPPDTPYMGGQYHGTLVF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P      D+ R+CLS+ D     W P+W +  ++  +   + 
Sbjct: 61  PSDYPFKPPAIRM---VTPSGRFKEDT-RLCLSMSDYHPDTWNPSWSVSTILTGLLSFMT 116

Query: 121 SPE 123
           S E
Sbjct: 117 SEE 119

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 59.7 bits (143), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 58/106 (54%), Gaps = 7/106 (6%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++N++++     GP  TPY    + L +E  + YP + P + F  +   H N+D  SG I
Sbjct: 26  DDNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSI 84

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACL 135
           CL V+++  W+P +DL+++V   W+   LL  P    PL+ + A L
Sbjct: 85  CLDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 59.7 bits (143), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 7/106 (6%)

Query: 33  EENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
           ++N++++     GP  TPY    + L +E  + YP + P + F  +   H N+D  SG I
Sbjct: 26  DDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSI 84

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWL---LLASPEPDSPLDVDLACL 135
           CL V+++  W+P +DLL++V   W+   LL  P    PL+ + A L
Sbjct: 85  CLDVINST-WSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 64/123 (52%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL+KEY+ + +    +P   YI  LA  +E N+ +W  +ITGPPDTPY G ++   +  
Sbjct: 8   KRLSKEYKLIIE----NPT-PYI--LARPNENNILEWHYIITGPPDTPYVGGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P+     ++ R+CLS+ D     W P W +  +++ +   + 
Sbjct: 61  PSDYPFKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDLWNPGWSVATILNGLLSFMT 116

Query: 121 SPE 123
             E
Sbjct: 117 GDE 119

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 59.3 bits (142), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 78/182 (42%), Gaps = 35/182 (19%)

Query: 1   MSQRLAKEYRALSKTLGRDPEYAYIISLAP-------------------------VSEEN 35
           + +R  +E + L KT G       +ISL+P                         +S+ N
Sbjct: 7   LKERKKRETQFLEKTGGATTGEPNLISLSPGRIRLQNDLDHLNLPPQCTLELQSSLSDMN 66

Query: 36  LRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMP---HCNVDFDSGRI 92
            +   +L   P + PY G  F   ++ +E YP+EPP     A C+    H N+D + G+I
Sbjct: 67  EQPLITLCISPREGPYLGGAFKFNLKFNEMYPIEPPS----AICLNKIFHPNIDLN-GKI 121

Query: 93  CLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYL 152
           CL++L    W+PA DL  +V  +  L        PL+   A  V A DR+    L+   +
Sbjct: 122 CLNIL-REDWSPALDLTSIVIGLLYLFLDFTSTDPLNQQ-AAEVLANDRNRFCELVQRAM 179

Query: 153 NG 154
            G
Sbjct: 180 LG 181

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 9/128 (7%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYII--SLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60
           QRL +E +   K    D  + +    +  P    +L++WE+ I G   T +    + L I
Sbjct: 7   QRLQEERKKWRK----DHPFGFFAKPTRKPDGTMDLQRWEAGIPGKQGTLWADGLYPLTI 62

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH-WTPAWDLLHVVHAIWLLL 119
           E  + YP +PPKV+  A    H NV + SG ICLS+L+    W PA  L  +   I  LL
Sbjct: 63  EYPDEYPSKPPKVKLPANFY-HPNV-YPSGTICLSILNEDQDWRPAITLKQICLGIQDLL 120

Query: 120 ASPEPDSP 127
            SP P+SP
Sbjct: 121 DSPNPNSP 128

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 19/126 (15%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL+KEY+ + +         YII++   ++EN+ +W  +ITGPPDTPY G ++   +  
Sbjct: 8   KRLSKEYKMIMENTP-----PYIIAVP--NDENILEWHYVITGPPDTPYEGGQYHGTLHF 60

Query: 63  SEAYPLEPPKVQF---QARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWL 117
              YP +PP ++      R   H        R+CLS+ D     W P+W +  +++ +  
Sbjct: 61  PPEYPFKPPAIRISTPNGRFKQHT-------RLCLSMSDYHPDTWNPSWSVATILNGLLS 113

Query: 118 LLASPE 123
            +   E
Sbjct: 114 FMTGDE 119

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 48/88 (54%), Gaps = 4/88 (4%)

Query: 47  PDTPYF-GHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPA 105
           PD  Y+ G  FT ++  +E YP+EPPKV+   R   H N+D D GR+CL++L    WTPA
Sbjct: 61  PDEGYYKGGNFTFELLFNEQYPMEPPKVKCLNRIY-HPNIDTD-GRVCLNIL-RQDWTPA 117

Query: 106 WDLLHVVHAIWLLLASPEPDSPLDVDLA 133
            DL  V+  +  L        PL+   A
Sbjct: 118 LDLQSVIIGLLFLFLEISGVDPLNKQAA 145

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 3/94 (3%)

Query: 35  NLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICL 94
           +L+ WE+ I G   T +    + + IE  + YP +PPKV+F A    H N+ + SG +CL
Sbjct: 37  DLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  SVLDAAH-WTPAWDLLHVVHAIWLLLASPEPDSP 127
           S+L+    W PA  L  +V  +  LL SP P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RLAKE++A+++    DP   YI  +A  +E N+  W  +ITGPP TPY   ++   +  
Sbjct: 8   KRLAKEFKAMTE----DPP-PYI--MARPNESNILDWHYIITGPPGTPYENGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P      ++ R+CLS+ D     W P W +  +++ +   + 
Sbjct: 61  PSDYPFQPPAIRM---VTPSGRFQ-ENTRLCLSMSDYHPTTWNPGWSVSTILNGLLSFMT 116

Query: 121 SPE 123
           S E
Sbjct: 117 SEE 119

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+++   +   P +     +A  +E+N+ +W  +ITGPPDTPY G ++   +  
Sbjct: 8   KRLTKEYKSM---VENPPPFI----IAQPNEDNILEWHYVITGPPDTPYEGGQYHGTLVF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P      D+ R+CLS+ D     W P+W +  ++  +   + 
Sbjct: 61  PSDYPFKPPAIRM---VTPSGRFKEDT-RLCLSMSDYHPDTWNPSWSVSTILTGLLSFMT 116

Query: 121 SPE 123
           S E
Sbjct: 117 SDE 119

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 57.4 bits (137), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 65/115 (56%), Gaps = 5/115 (4%)

Query: 43  ITGPPDTPYF-GHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH 101
           IT  PD  ++ G  FT ++E ++AYP+EPP V   ++   H N+D D G++CL++L    
Sbjct: 69  ITAYPDEGFYKGGHFTFKLEFNDAYPIEPPTVICTSKLY-HPNIDID-GKVCLNIL-RED 125

Query: 102 WTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGS 156
           W+PA D+  ++  +  LL  P    PL+ D A ++ + D +   SL+   + G S
Sbjct: 126 WSPALDVQSIIIGLLFLLLEPNAKDPLNKD-AAMMLSTDTARFASLVNRSMAGYS 179

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 58.2 bits (139), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 19/126 (15%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ +   +   P Y     LA  +E+N+ +W  +ITGP DTPY G ++   +  
Sbjct: 8   KRLTKEYKLM---VENPPPYI----LARPNEDNILEWHYIITGPADTPYKGGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQF---QARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWL 117
              YP +PP ++      R  P+        R+CLS+ D     W P W +  +++ +  
Sbjct: 61  PSDYPYKPPAIRMITPNGRFKPNT-------RLCLSMSDYHPDTWNPGWSVSTILNGLLS 113

Query: 118 LLASPE 123
            + S E
Sbjct: 114 FMTSDE 119

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 58.2 bits (139), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 19/126 (15%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ +   +   P Y     LA  +E+N+ +W  +ITGP DTPY G ++   +  
Sbjct: 8   KRLTKEYKLM---VENPPPYI----LARPNEDNILEWHYIITGPADTPYKGGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQF---QARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWL 117
              YP +PP ++      R  P+        R+CLS+ D     W P W +  +++ +  
Sbjct: 61  PSDYPYKPPAIRMVTPNGRFKPNT-------RLCLSMSDYHPDTWNPGWSVSTILNGLLS 113

Query: 118 LLASPE 123
            + S E
Sbjct: 114 FMTSDE 119

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 4/103 (3%)

Query: 40  ESLITGPPDTP-YFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD 98
           E LIT  PD   Y    F   +   ++YP+EPP V+F  +   H N+D + G+ICL++L 
Sbjct: 68  ELLITIHPDEGIYKDGYFPFSMVFKDSYPIEPPVVKFLKKIY-HPNIDLN-GKICLNIL- 124

Query: 99  AAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDR 141
              W+P  DL  ++  +  L   P P  PL++    L++   +
Sbjct: 125 REDWSPVLDLQSIIIGLMFLFLEPNPRDPLNLKAGELLKENKQ 167

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
            +RL KEY+ +   +   P +     +A  +EEN+ +W  +I+GPPDTPY G ++   + 
Sbjct: 7   QKRLTKEYKMM---VENPPPFI----IARPNEENILEWHYVISGPPDTPYDGGQYHGTLT 59

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLL 119
               YP +PP ++      P+     ++ R+CLS+ D     W P W +  +++ +   +
Sbjct: 60  FPSDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

Query: 120 ASPE 123
              E
Sbjct: 116 TGDE 119

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ L++T    P Y     LA  +E+N+ +W  +ITGPPD+PY   ++   +  
Sbjct: 8   KRLTKEYKTLTET---PPPYI----LARPNEDNILEWHYIITGPPDSPYSEGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P+     ++ R+CLS+ D     W P+W +  ++  +   + 
Sbjct: 61  PTDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDLWNPSWSVSTILTGLLSFMT 116

Query: 121 SPE 123
             E
Sbjct: 117 GDE 119

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 64/123 (52%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+A+   +   P++   I+  P +E+N+ +W  +ITGPPDTPY   ++   +  
Sbjct: 8   KRLTKEYKAI---IENPPQF---INAQP-NEDNILEWHYIITGPPDTPYTDGQYHGTLVF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P+     ++ R+C+++ D     W PAW +  ++  +   + 
Sbjct: 61  PADYPFKPPAIRM---ITPNGRFK-ENTRLCMTMSDYHPDTWNPAWSVATILMGLLSFMT 116

Query: 121 SPE 123
             E
Sbjct: 117 GDE 119

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 15/124 (12%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ +   +   P Y     LA  +E N+ +W  +ITGP DTPYF  ++   +  
Sbjct: 8   KRLTKEYKLM---VENPPPYI----LARPNENNILEWHYIITGPADTPYFEGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDF-DSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLL 119
              YP +PP ++     M   N  F ++ R+CLS+ D     W P+W +  +++ +   +
Sbjct: 61  PSDYPYKPPAIR-----MVTPNGRFRENTRLCLSMSDYHPNTWNPSWSVSTILNGLLSFM 115

Query: 120 ASPE 123
              E
Sbjct: 116 TGDE 119

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 19/126 (15%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ +   +   P Y     LA  +E+N+ +W  +ITGP +TPY G ++   +  
Sbjct: 8   KRLTKEYKLM---VENPPPYI----LARPNEDNILEWHYIITGPAETPYKGGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQF---QARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWL 117
              YP +PP ++      R  P+        R+CLS+ D     W P W +  +++ +  
Sbjct: 61  PSDYPYKPPAIRMVTPNGRFKPNT-------RLCLSMSDYHPDTWNPGWSVSTILNGLLS 113

Query: 118 LLASPE 123
            + S E
Sbjct: 114 FMTSDE 119

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 60/126 (47%), Gaps = 19/126 (15%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ +   +   P Y     LA  +E+N+ +W  +ITGP DTPY   ++   +  
Sbjct: 8   KRLTKEYKLM---VENPPPYI----LARPNEDNILEWHYIITGPADTPYKAGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQF---QARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWL 117
              YP +PP ++      R  P+        R+CLS+ D     W P W +  +++ +  
Sbjct: 61  PSDYPYKPPAIRMITPNGRFKPNT-------RLCLSMSDYHPDTWNPGWSVSTILNGLLS 113

Query: 118 LLASPE 123
            + S E
Sbjct: 114 FMTSDE 119

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           ++RL KEY+ +   +   P +     +A   E+N+ +W  +ITGPP TPY   ++   + 
Sbjct: 7   NKRLTKEYKNI---VNNPPPFI----IAAPHEDNILEWHYVITGPPSTPYENGQYHGTLT 59

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLL 119
               YP  PP ++      P+     ++ R+CLS+ D     W PAW ++ +++ +   +
Sbjct: 60  FPSDYPFNPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFM 115

Query: 120 ASPE 123
              E
Sbjct: 116 TGDE 119

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 55.1 bits (131), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ ++       E      +A  +E N+ +W  +I GPPD+PYF  ++   +  
Sbjct: 8   KRLTKEYKMMN-------ENPTPFIMARPNEANILEWHYIINGPPDSPYFEGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P+     ++ R+CLS+ D     W P W +  +++ +   + 
Sbjct: 61  PSDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMT 116

Query: 121 SPE 123
             E
Sbjct: 117 GDE 119

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 54.3 bits (129), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 4/88 (4%)

Query: 47  PDTPYF-GHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPA 105
           PD  Y+ G  +   +   + YP+EPP V+   R   H N+D D G +CL++L    WTPA
Sbjct: 67  PDIGYYAGGTYYFNVFIKDTYPMEPPVVKCMHRIY-HPNIDID-GNVCLNLL-REDWTPA 123

Query: 106 WDLLHVVHAIWLLLASPEPDSPLDVDLA 133
            D+  ++  I  L   P    PL+ D A
Sbjct: 124 LDIQSIIIGILFLFHEPNGRDPLNKDAA 151

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 54.7 bits (130), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ + +T    P Y   I+  P +E N+ +W  +I GP DTPY G ++   +  
Sbjct: 8   KRLTKEYKMMVET---PPPY---ITARP-NESNILEWHYIIIGPQDTPYDGGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P+     ++ R+CLS+ D     W P W +  +++ +   + 
Sbjct: 61  PSDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMT 116

Query: 121 SPE 123
             E
Sbjct: 117 GNE 119

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 53.5 bits (127), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (48%), Gaps = 8/134 (5%)

Query: 25  IISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCN 84
           IISL    E +L    ++I  P +  Y G +F       E YP++PPKV    +   H N
Sbjct: 54  IISLDNHKEMSL----NIIIIPDEGFYKGGKFRFTATFLETYPIDPPKVICNNKIF-HPN 108

Query: 85  VDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAH 144
           +D   G+ICL++L    W+PA DL  +V  +  L   P  + PL+ + A  V   D+   
Sbjct: 109 ID-PHGKICLNIL-REDWSPALDLQCIVLGLLSLFQEPNGNDPLNKE-AAEVLNKDKLEF 165

Query: 145 NSLIAYYLNGGSRG 158
            +L+   ++G   G
Sbjct: 166 GNLVRLAMSGAMVG 179

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 59/115 (51%), Gaps = 13/115 (11%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ +   +   P Y     LA  +E+N+ +W  +ITGPPDTPY   ++   +  
Sbjct: 8   KRLTKEYKLM---VENPPPYI----LARPNEDNILEWHYIITGPPDTPYKDGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAI 115
              YP +PP ++      P+     ++ R+CLS+ D     W P W +  +++ +
Sbjct: 61  PSDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDLWNPGWSVNTILNGL 111

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 61/123 (49%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY    K +  +P   YII  A  +E N+ +W  +ITGPPD+PY   ++   +  
Sbjct: 8   KRLTKEY----KMMMENPT-PYII--ARPNESNILEWHYVITGPPDSPYHDGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P+     ++ R+CLS+ D     W P W +  +++ +   + 
Sbjct: 61  PSDYPYKPPAIRM---VTPNGRFK-ENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMT 116

Query: 121 SPE 123
             E
Sbjct: 117 GDE 119

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 52  FGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHV 111
            GH F  Q   +E YP+EPPKV    +   H N++  +G ICL++L    W+PA DL  V
Sbjct: 88  LGH-FRFQFTINENYPIEPPKVVCLTKIY-HPNIN-RTGEICLNIL-REDWSPALDLQSV 143

Query: 112 VHAIWLLLASPEPDSPLD 129
           +  +  L   P P  PL+
Sbjct: 144 IIGLLFLFIEPNPKDPLN 161

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 15/124 (12%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL+KEY+ +++     P Y   I  AP  E+N+  W  +ITGPP+TPY   ++   +  
Sbjct: 8   KRLSKEYKMMTEN---PPPY---IVAAP-KEDNILVWHYVITGPPETPYEDGQYHGTLVF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDF-DSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLL 119
              YP  PP ++     M   N  F ++ R+CLS+ D     W P+W +  ++  +   +
Sbjct: 61  PNDYPFNPPAIR-----MLTPNGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFM 115

Query: 120 ASPE 123
            + E
Sbjct: 116 TTDE 119

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 52/100 (52%), Gaps = 3/100 (3%)

Query: 41  SLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAA 100
           +L+  P +  Y   +F   ++ +E YP+EPP V    +   H N+D D G+ICL++L   
Sbjct: 72  TLLISPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNKIF-HPNIDLD-GKICLNIL-RE 128

Query: 101 HWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGD 140
            W+PA DL  ++  +  L        PL+ + A ++ + +
Sbjct: 129 DWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 168

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 52/100 (52%), Gaps = 3/100 (3%)

Query: 41  SLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAA 100
           +L+  P +  Y   +F   ++ +E YP+EPP V    +   H N+D D G+ICL++L   
Sbjct: 71  TLLISPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNKIF-HPNIDLD-GKICLNIL-RE 127

Query: 101 HWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGD 140
            W+PA DL  ++  +  L        PL+ + A ++ + +
Sbjct: 128 DWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 167

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 60/123 (48%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ + +     P Y      A  +E+N+ +W  +ITGPP+TPY G ++   +  
Sbjct: 8   KRLTKEYKLIVEN---PPPYV----TARPNEDNILEWHYVITGPPETPYEGGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P+     ++ R+CLS+ D     W P W +  ++  +   + 
Sbjct: 61  PSDYPYKPPAIRM---VTPNGRFK-ENTRLCLSMSDYHPDLWNPGWSVSTILTGLLSFMT 116

Query: 121 SPE 123
             E
Sbjct: 117 GDE 119

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 51.6 bits (122), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 52/105 (49%), Gaps = 5/105 (4%)

Query: 47  PDTPYFGH-EFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPA 105
           PD  ++ H  F   +   ++YP++PP V+       H N+D++ G ICL+VL    WTP 
Sbjct: 150 PDEGFYKHGHFGFSVSFKDSYPIDPPIVKCLTTIY-HPNIDYN-GNICLNVLRED-WTPV 206

Query: 106 WDLLHVVHAIWLLLASPEPDSPLDVDLA-CLVRAGDRSAHNSLIA 149
            DL  +V  +  L   P P  PL+   A  +V+   R   N L +
Sbjct: 207 LDLQTIVIGLLFLFLEPNPKDPLNKHAAHTMVKDPFRFERNVLAS 251

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 70/153 (45%), Gaps = 24/153 (15%)

Query: 2   SQRLAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFT 57
           S  L ++YR L+     DP+ A   + I L    + N+  W   ++    D+ Y G  F 
Sbjct: 9   SSLLLRQYRELT-----DPKKAIPSFHIELE--DDSNIFTWNIGVMVLNEDSIYHGGFFK 61

Query: 58  LQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAW 106
            Q+   E +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P  
Sbjct: 62  AQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 107 DLLHVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            +  V+ +I  LL  P  +SP +VD A   R  
Sbjct: 120 TVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 70/153 (45%), Gaps = 24/153 (15%)

Query: 2   SQRLAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFT 57
           S  L ++YR L+     DP+ A   + I L    + N+  W   ++    D+ Y G  F 
Sbjct: 9   SSLLLRQYRELT-----DPKKAIPSFHIELE--DDSNIFTWNIGVMVLNEDSIYHGGFFK 61

Query: 58  LQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAW 106
            Q+   E +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P  
Sbjct: 62  AQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 107 DLLHVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            +  V+ +I  LL  P  +SP +VD A   R  
Sbjct: 120 TVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 67/150 (44%), Gaps = 24/150 (16%)

Query: 5   LAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQI 60
           L ++YR L+     DP  A   + I L    E NL  W   ++    D+ Y G  F  Q+
Sbjct: 12  LLRQYRELT-----DPRKAIPSFHIELE--DESNLFIWNIGVMVLNEDSIYHGGYFKSQM 64

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLL 109
              E +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P   + 
Sbjct: 65  RFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTTDEPDAETWSPVQTVE 122

Query: 110 HVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            V+ +I  LL  P   SP +VD A   R  
Sbjct: 123 SVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 70/153 (45%), Gaps = 24/153 (15%)

Query: 2   SQRLAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFT 57
           S  L ++YR L+     DP+ A   + I L    + N+  W   ++    D+ Y G  F 
Sbjct: 9   SSLLLRQYRELT-----DPKKAIPSFHIELE--DDSNIFTWNIGVMVLNEDSIYHGGFFK 61

Query: 58  LQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAW 106
            Q+   E +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P  
Sbjct: 62  AQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 107 DLLHVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            +  V+ +I  LL  P  +SP +VD A   R  
Sbjct: 120 TVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 68/150 (45%), Gaps = 24/150 (16%)

Query: 5   LAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQI 60
           L ++YR L+     DP+ A   + I L    + NL  W   ++    D+ Y G  F  Q+
Sbjct: 12  LLRQYRELT-----DPKKAIPSFHIELD--DDSNLFVWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLL 109
              E +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P   + 
Sbjct: 65  RFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWSPVQTVE 122

Query: 110 HVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            V+ +I  LL  P   SP +VD A   R  
Sbjct: 123 SVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 68/150 (45%), Gaps = 24/150 (16%)

Query: 5   LAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQI 60
           L ++YR L+     DP+ A   + I L    + NL  W   ++    D+ Y G  F  Q+
Sbjct: 12  LLRQYRELT-----DPKKAIPSFHIELD--DDSNLFVWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLL 109
              E +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P   + 
Sbjct: 65  RFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWSPVQTVE 122

Query: 110 HVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            V+ +I  LL  P   SP +VD A   R  
Sbjct: 123 SVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 70/153 (45%), Gaps = 24/153 (15%)

Query: 2   SQRLAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFT 57
           S  L ++YR L+     DP+ A   + I L    + N+  W   ++    D+ Y G  F 
Sbjct: 9   SSLLLRQYRELT-----DPKKAIPSFHIELE--DDSNIFIWNIGVMVLNEDSIYHGGFFK 61

Query: 58  LQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAW 106
            Q+   E +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P  
Sbjct: 62  AQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 107 DLLHVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            +  V+ +I  LL  P  +SP +VD A   R  
Sbjct: 120 TVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 67/147 (45%), Gaps = 18/147 (12%)

Query: 5   LAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQIEAS 63
           L ++YR L+      P  ++ I+L    + N+  W   ++    D+ Y G  F  Q+   
Sbjct: 12  LLRQYRELTNPKKAIP--SFHINLE--DDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFP 67

Query: 64  EAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLLHVV 112
           + +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P   +  V+
Sbjct: 68  DDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDAETWSPVQTVESVL 125

Query: 113 HAIWLLLASPEPDSPLDVDLACLVRAG 139
            +I  LL  P   SP +VD A   R  
Sbjct: 126 ISIVSLLEDPNISSPANVDAAVDYRKN 152

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 68/150 (45%), Gaps = 24/150 (16%)

Query: 5   LAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQI 60
           L ++YR L+     DP+ A   + I L    + N+  W   ++    D+ Y G  F  Q+
Sbjct: 12  LLRQYRELT-----DPKKAIPSFHIELE--DDSNIFVWNIGVMVLNEDSIYHGGFFKAQM 64

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLL 109
              E +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P   + 
Sbjct: 65  RFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVE 122

Query: 110 HVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            V+ +I  LL  P   SP +VD A   R  
Sbjct: 123 SVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 54/116 (46%), Gaps = 7/116 (6%)

Query: 43  ITGPPDTPYF--GHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAA 100
           I   PD  Y+  GH F       + YP+EPPKV   ++   H N+D   G +CL++L   
Sbjct: 64  INITPDEGYYKCGH-FKFCATFKDTYPIEPPKVTLLSKIF-HPNIDL-QGNVCLNIL-RE 119

Query: 101 HWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGS 156
            W+P  D+  ++  + +L   P    PL+  +A  V A +       +A  L GG 
Sbjct: 120 DWSPVLDVQSILIGLLMLFLEPNATDPLN-KVAADVLAANPHQFRRDVATSLRGGQ 174

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 13/123 (10%)

Query: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62
           +RL KEY+ +   +   P Y     +A  +E+N+ +W  +ITGP DTPY   ++   +  
Sbjct: 8   KRLTKEYKLI---VENPPPYI----VARPNEDNILEWHYVITGPSDTPYSSGQYHGTLTF 60

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLD--AAHWTPAWDLLHVVHAIWLLLA 120
              YP +PP ++      P+     ++ R+CLS+ D     W P W +  ++  +   + 
Sbjct: 61  PSDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDLWNPGWSVSTILTGLLSFMT 116

Query: 121 SPE 123
             E
Sbjct: 117 GDE 119

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 48/101 (47%), Gaps = 13/101 (12%)

Query: 48  DTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL---------- 97
           D+ Y G  F  Q+   E +P  PP+ +F    + H NV +  GR+C+S+L          
Sbjct: 52  DSLYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDE 109

Query: 98  -DAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVR 137
            DA  W+P   +  V+ +I  LL  P   SP +VD A   R
Sbjct: 110 PDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYR 150

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 68/150 (45%), Gaps = 24/150 (16%)

Query: 5   LAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQI 60
           L ++YR L+     DP+ A   + I L    + N+  W   ++    D+ Y G  F  Q+
Sbjct: 12  LLRQYRELT-----DPKKAIPSFHIELE--DDSNIFVWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLL 109
              + +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P   + 
Sbjct: 65  RFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVE 122

Query: 110 HVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            V+ +I  LL  P   SP +VD A   R  
Sbjct: 123 SVLISIVSLLEDPNISSPANVDAAVDFRKN 152

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 68/150 (45%), Gaps = 24/150 (16%)

Query: 5   LAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQI 60
           L ++YR L+     DP+ A   + I L    + N+  W   ++    D+ Y G  F  Q+
Sbjct: 12  LLRQYRELT-----DPKKAIPSFNIELD--DDSNIFVWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLL 109
              + +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P   + 
Sbjct: 65  RFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVE 122

Query: 110 HVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            V+ +I  LL  P   SP +VD A   R  
Sbjct: 123 SVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 67/147 (45%), Gaps = 18/147 (12%)

Query: 5   LAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQIEAS 63
           L ++YR L+      P  ++ I+L    + N+  W   ++    ++ Y G  F  Q+   
Sbjct: 12  LLRQYRELTDPKKSIP--SFHINLE--DDSNIFVWNIGVMVLNEESIYHGGYFKAQMRFP 67

Query: 64  EAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLLHVV 112
           + +P  PP+ +F    + H NV +  GR+C+S+L           DA  W+P   +  V+
Sbjct: 68  DDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDAETWSPVQSVESVL 125

Query: 113 HAIWLLLASPEPDSPLDVDLACLVRAG 139
            +I  LL  P   SP +VD A   R  
Sbjct: 126 ISIVSLLEDPNISSPANVDAAVDYRKN 152

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 46/100 (46%), Gaps = 13/100 (13%)

Query: 51  YFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DA 99
           Y G  F  Q+   E +P  PP+ +F    + H NV +  GR+C+S+L           DA
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 100 AHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
             W+P   +  V+ +I  LL  P   SP +VD A   R  
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 67/150 (44%), Gaps = 24/150 (16%)

Query: 5   LAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQI 60
           L ++YR L+     DP+ A   + I L    + N+  W   ++    D+ Y G  F  Q+
Sbjct: 12  LLRQYRELT-----DPKKAIPSFHIELD--DDSNIFSWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLL 109
              E +P  PP  +F    + H NV +  GR+C+S+L           D+  W+P   + 
Sbjct: 65  RFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSPVQTVE 122

Query: 110 HVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            V+ +I  LL  P   SP +VD A   R  
Sbjct: 123 SVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (46%), Gaps = 13/103 (12%)

Query: 48  DTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL---------- 97
           D+ Y G  F  Q++  E +P  PP  +F    + H NV +  GR+C+S+L          
Sbjct: 52  DSIYHGGYFKAQMKFPEDFPFSPPNFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDE 109

Query: 98  -DAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            D+  W+P   +  V+ +I  LL  P   SP +VD A   R  
Sbjct: 110 PDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 63/147 (42%), Gaps = 18/147 (12%)

Query: 5   LAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQIEAS 63
           L ++YR L+      P +   +      + N+  W   ++    D+ Y G  F  Q+   
Sbjct: 12  LLRQYRELTDAKKAIPSFHIELD----DDSNIFLWNVGVMVLNEDSIYHGGYFKAQMRFP 67

Query: 64  EAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLLHVV 112
           E +P  PP  +F    + H NV +  GR+C+S+L           D+  W+P   +  V+
Sbjct: 68  EDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWSPVQTVESVL 125

Query: 113 HAIWLLLASPEPDSPLDVDLACLVRAG 139
            +I  LL  P   SP +VD A   R  
Sbjct: 126 ISIVSLLEDPNISSPANVDAAVDYRKN 152

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 65/147 (44%), Gaps = 18/147 (12%)

Query: 5   LAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQIEAS 63
           L ++YR L+      P  ++ I L    + N+  W   ++    D+ Y G  F  Q+   
Sbjct: 12  LLRQYRELTDAKKAIP--SFHIELD--DDSNIFLWNIGVMVLNEDSIYHGGYFKAQMRFP 67

Query: 64  EAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLLHVV 112
           E +P  PP  +F    + H NV +  GR+C+S+L           D+  W+P   +  V+
Sbjct: 68  EDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWSPVQTVESVL 125

Query: 113 HAIWLLLASPEPDSPLDVDLACLVRAG 139
            +I  LL  P   SP +VD A   R  
Sbjct: 126 ISIVSLLEDPNISSPANVDAAVDYRKN 152

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 47/103 (45%), Gaps = 13/103 (12%)

Query: 48  DTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL---------- 97
           D+ Y G  F  Q+   E +P  PP  +F    + H NV +  GR+C+S+L          
Sbjct: 52  DSIYHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDE 109

Query: 98  -DAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            D+  W+P   +  V+ +I  LL  P   SP +VD A   R  
Sbjct: 110 PDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 56/120 (46%), Gaps = 5/120 (4%)

Query: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEAS 63
           RL +E     K LG  PE +    LA   +  +  W   I GPP + +    +++ IE  
Sbjct: 9   RLLEELEKGEKGLG--PE-SCSYGLADSDDITMTNWNGTILGPPHSNHENRIYSVSIECG 65

Query: 64  EAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH-WTPAWDLLHVVHAIWLLLASP 122
             YP EPPK++F ++    C VD  +G +  SV      W  A+ +  ++  +   +A+P
Sbjct: 66  PNYPDEPPKIKFVSKVNVPC-VDSTTGEVKSSVFHTLRDWKRAYTMETLLLDLRKEMATP 124

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 45.8 bits (107), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 30/153 (19%)

Query: 5   LAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQI 60
           L ++YR L+     DP+ A   + I L    + N+  W   ++    D+ Y G  F  Q+
Sbjct: 19  LLRQYRELT-----DPKRAIPSFHIELE--DDSNIFTWNIGVMVLNKDSIYHGGYFQSQM 71

Query: 61  EASEAYPLEPPKVQFQARCMP---HCNVDFDSGRICLSVL-----------DAAHWTPAW 106
           +  + +P  PP+ +F    +P   H NV +  G++C+S+L           D   W+P  
Sbjct: 72  KFPKDFPFSPPQFKF----IPPIYHPNV-YRDGKLCISILHQSGDAMTSEPDNETWSPVQ 126

Query: 107 DLLHVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            +  V+ +I  LL  P   SP +VD A   R  
Sbjct: 127 SVESVLISIVSLLEDPNVSSPANVDAAVEYRKN 159

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 47  PDTPYF--GHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTP 104
           PD  Y+  G+ F   +   + YP+EPP V+   +   H N+D   G +CL++L    W+P
Sbjct: 68  PDEGYYKPGY-FRFSLFFKDTYPIEPPAVKCVNKIY-HPNID-TQGNVCLNIL-REDWSP 123

Query: 105 AWDLLHVVHAIWLLLASPEPDSPLD 129
             DL  VV  +  L   P    PL+
Sbjct: 124 VLDLQSVVIGLLFLFLEPNDKDPLN 148

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 65/143 (45%), Gaps = 20/143 (13%)

Query: 5   LAKEYRALSKTLGRDPEYAY-IISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQIEA 62
           L ++YR L+     DP+ A     +A   + N+  W   ++    ++ Y G  F  Q++ 
Sbjct: 11  LLRQYRELT-----DPKKAIPSFHIALEDDSNIFLWNIGVMVLNEESIYHGGYFKAQMKF 65

Query: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLLHV 111
            + +P  PP  +F    + H NV +  GR+C+S+L           D   W+P   +  V
Sbjct: 66  PDDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHQSGNPTSDEPDEETWSPVQTVESV 123

Query: 112 VHAIWLLLASPEPDSPLDVDLAC 134
           + +I  LL  P   SP +VD A 
Sbjct: 124 LISIVSLLEDPNISSPANVDAAV 146

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 55/118 (46%), Gaps = 7/118 (5%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S RL +E     K LG  PE +    L+   +  + KW   I GPP + +    +++ IE
Sbjct: 7   SFRLLEELEKGEKGLG--PE-SCSYGLSDSDDITMTKWNGTILGPPHSNHENRIYSVLIE 63

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLL 119
              +YP EPPKV+F ++    C V+  +G +   V +  H    W   + +  + L L
Sbjct: 64  CGPSYPDEPPKVKFVSKINLPC-VNSTTGEV---VKEKFHTLKEWKRSYTMETVLLEL 117

>Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON}
          (176569..176874) [306 nt, 102 aa]
          Length = 101

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 39 WESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
          W   I GPP + +    ++L IE    YP EPPK++F +R    C VD ++G +
Sbjct: 4  WNGTILGPPHSNHANRIYSLSIECGPNYPDEPPKIKFISRVNLPC-VDVNTGEV 56

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 68/158 (43%), Gaps = 22/158 (13%)

Query: 5   LAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQIEAS 63
           L +++R L     R P   + I L  V + N+ +WE   +    D+ Y G   T  +   
Sbjct: 13  LLRQFRELRDPRRRMP--CFHIEL--VEKSNIFEWEVGFMVTNEDSIYHGAYLTGLLCFP 68

Query: 64  EAYPLEPPKVQFQARCMP--HCNVDFDSGRICLSVL-----------DAAHWTPAWDLLH 110
             +P  PP   F   C P  H NV F +G +C+S+L           D+  W+P   +  
Sbjct: 69  RNFPFSPPTFLF---CPPIYHPNV-FSNGSLCISILHECGDDTNEEPDSETWSPVQTVET 124

Query: 111 VVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHNSLI 148
           V+ +I  LL  P   SP +VD A   +   +  +  +I
Sbjct: 125 VLISIISLLDDPNVSSPANVDAAVEYKNARQEYNKRVI 162

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138
          aa] {ON} highly similar to uniprot|P53152 Saccharomyces
          cerevisiae YGL087C MMS2 Protein involved in error-free
          postreplication DNA repair forms a heteromeric complex
          with Ubc13p that has a ubiquitin-conjugating activity
          cooperates with chromatin-associated RING finger
          proteins Rad18p and Rad5p
          Length = 138

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 2  SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
          S RL +E     K +G  PE +    LA   +  +  W   I GPP + +    +++ IE
Sbjct: 7  SFRLLEELEKGEKGMG--PE-SCSYGLAHSDDITMTHWNGTILGPPHSNHENRIYSVAIE 63

Query: 62 ASEAYPLEPPKVQFQARCMPHCNVDFDSGRI 92
            EAYP +PPK++F ++    C VD ++G +
Sbjct: 64 CGEAYPDQPPKIRFLSKVNLPC-VDQNTGEV 93

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 43/88 (48%), Gaps = 3/88 (3%)

Query: 42  LITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH 101
           L   P +  Y G  F   +   + YP+EPP V+     + H N+D+ SG ICL+VL    
Sbjct: 79  LRISPEEGVYRGGHFRFSVVFRDTYPIEPPTVKC-LNTIYHPNIDY-SGNICLNVL-RED 135

Query: 102 WTPAWDLLHVVHAIWLLLASPEPDSPLD 129
           W+P  DL  VV  +  L   P    PL+
Sbjct: 136 WSPVMDLQTVVLGLLFLFLEPNGSDPLN 163

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S RL +E     K LG  PE +    LA   + ++  W   I GPP + +    ++L IE
Sbjct: 7   SFRLLEELEKGEKGLG--PE-SCSYGLADSDDISMTTWNGTILGPPHSNHENRIYSLSIE 63

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAH-WTPAWDLLHVVHAIWLLLA 120
               YP  PP ++F ++    C VD  +G++  S       W  A+++  ++  +   +A
Sbjct: 64  CGPNYPDHPPTIKFISKINLPC-VDSKTGQVTPSTFHTLRDWKRAYNMETILLELRKEMA 122

Query: 121 SP 122
           +P
Sbjct: 123 TP 124

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 42.0 bits (97), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 4/121 (3%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S RL +E     K +G  PE +    LA   + ++  W   I GPP + +    ++L IE
Sbjct: 7   SFRLLEELEKGEKGMG--PE-SCSYGLADSDDISMTNWNGTILGPPHSNHSNRIYSLSIE 63

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121
              +YP EPP ++F ++   +C VD  +G +        +W  ++ +  ++  +   +A 
Sbjct: 64  CGPSYPDEPPTLKFISKINLNC-VDSATGVVKPDFNPIKNWKRSYTMETILLELRKEMAH 122

Query: 122 P 122
           P
Sbjct: 123 P 123

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 52/119 (43%), Gaps = 4/119 (3%)

Query: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEAS 63
           RL +E     K  G  PE +    LA   +  + KW   I GPP + +    ++L IE  
Sbjct: 9   RLLEELEKGEKGFG--PE-SCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIECG 65

Query: 64  EAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
             YP  PPKV F ++    C V+  +G I         W  A+ +  ++  +   +A+P
Sbjct: 66  PNYPDSPPKVTFISKINLPC-VNQTTGEIQTDFHTLRDWKRAYTMETLLLDLRKEMATP 123

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIE 61
           S RL +E     K LG  PE +    LA   +  + +W   I GPP + +    +++ IE
Sbjct: 7   SFRLLEELEKGEKGLG--PE-SCSYGLADADDITMTRWNGTILGPPHSNHENRIYSVSIE 63

Query: 62  ASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDA-AHWTPAWDLLHVVHAIWLLLA 120
               YP EPP + F ++    C VD  +G +     +    W   +++  ++  +   +A
Sbjct: 64  CGPKYPDEPPTITFISKINLPC-VDQSTGEVNKEKFNTLKDWKRLYNMETILLDLRKEMA 122

Query: 121 SP 122
           SP
Sbjct: 123 SP 124

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 66/150 (44%), Gaps = 24/150 (16%)

Query: 5   LAKEYRALSKTLGRDPEYA---YIISLAPVSEENLRKWE-SLITGPPDTPYFGHEFTLQI 60
           L ++YR L+     DP+ A   + I L   ++ N+  W    I    D+ Y G  F  ++
Sbjct: 13  LLRQYRELT-----DPKRAIPSFHIELE--NDSNIFVWHIGFIILNEDSIYNGGYFKSEM 65

Query: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVL-----------DAAHWTPAWDLL 109
           +    +P  PP  +F    + H NV +  G++C+S+L           D   W+P   + 
Sbjct: 66  KFPSNFPYSPPHFKF-VPPIYHPNV-YKDGKLCISILHQSGDSMTSEPDNETWSPVQSVE 123

Query: 110 HVVHAIWLLLASPEPDSPLDVDLACLVRAG 139
            V+ +I  LL  P   SP +VD +   R  
Sbjct: 124 SVLISIISLLEDPNISSPANVDASVEYRKN 153

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 52/119 (43%), Gaps = 4/119 (3%)

Query: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEAS 63
           RL +E     K  G  PE +    LA   +  + KW   I GPP + +    ++L I+  
Sbjct: 9   RLLEELEKGEKGFG--PE-SCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCG 65

Query: 64  EAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122
             YP  PPKV F ++    C V+  +G +         W  A+ +  ++  +   +A+P
Sbjct: 66  PNYPDSPPKVTFISKINLPC-VNPTTGEVQTDFHTLRDWKRAYTMETLLLDLRKEMATP 123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,916,007
Number of extensions: 700157
Number of successful extensions: 1662
Number of sequences better than 10.0: 264
Number of HSP's gapped: 1460
Number of HSP's successfully gapped: 264
Length of query: 166
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 65
Effective length of database: 41,900,133
Effective search space: 2723508645
Effective search space used: 2723508645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)