Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14872g3.494ON28028013900.0
Kwal_55.212403.494ON28326712701e-178
SAKL0F02728g3.494ON28228212551e-176
Suva_7.4203.494ON28728311851e-165
Smik_6.2283.494ON28728311781e-164
TPHA0D032903.494ON28528311761e-164
CAGL0I10472g3.494ON28827611751e-163
TDEL0D056203.494ON27927811661e-162
Kpol_1017.53.494ON28328311581e-161
YGR132C (PHB1)3.494ON28728311551e-160
NCAS0E007903.494ON32728111461e-158
Skud_7.4433.494ON28728311321e-157
TBLA0D029503.494ON28227811281e-156
NDAI0G009203.494ON29627911251e-156
Ecym_12353.494ON28328311051e-153
KAFR0C019803.494ON28328111041e-153
ZYRO0D09900g3.494ON28328010861e-150
AFR313C3.494ON28328310741e-148
KNAG0B007903.494ON28428410711e-148
KLLA0D16302g3.494ON2262149921e-137
KAFR0B042505.98ON3102597334e-96
ADL141W5.98ON3072347317e-96
CAGL0L06490g5.98ON3132437318e-96
TBLA0H022205.98ON3072317273e-95
YGR231C (PHB2)5.98ON3102317256e-95
Kwal_27.127475.98ON3072357221e-94
Smik_16.755.98ON3102317212e-94
SAKL0G15510g5.98ON3082317203e-94
Suva_7.5235.98ON3102357194e-94
NDAI0D025305.98ON3162607162e-93
TPHA0A050905.98ON3102317152e-93
Kpol_1050.615.98ON3102537133e-93
Skud_7.5655.98ON3102317133e-93
KLTH0C01672g5.98ON3072317118e-93
NCAS0F006005.98ON3132537083e-92
KNAG0A015805.98ON2882537035e-92
ZYRO0B15136g5.98ON3102317003e-91
TDEL0G012105.98ON3092346979e-91
KLLA0E15731g5.98ON3082356961e-90
TPHA0I013002.117ON37950674.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14872g
         (280 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   540   0.0  
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   493   e-178
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   488   e-176
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   461   e-165
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   458   e-164
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   457   e-164
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   457   e-163
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   453   e-162
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   450   e-161
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   449   e-160
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     446   e-158
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   440   e-157
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   439   e-156
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     437   e-156
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   430   e-153
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   429   e-153
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   422   e-150
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   418   e-148
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   417   e-148
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   386   e-137
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   286   4e-96
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   286   7e-96
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   286   8e-96
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   284   3e-95
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   283   6e-95
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   282   1e-94
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   282   2e-94
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   281   3e-94
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   281   4e-94
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   280   2e-93
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   280   2e-93
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   279   3e-93
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   279   3e-93
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   278   8e-93
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   277   3e-92
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   275   5e-92
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   274   3e-91
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   273   9e-91
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   272   1e-90
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    30   4.5  

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/280 (95%), Positives = 268/280 (95%)

Query: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60
           MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL
Sbjct: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60

Query: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120
           QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS
Sbjct: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYIS            IRRI
Sbjct: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIAKTLANSSNVTYLPSSHSASEQGSPNSLLLNLGR 280
           EASKEIAKTLANSSNVTYLPSSHSASEQGSPNSLLLNLGR
Sbjct: 241 EASKEIAKTLANSSNVTYLPSSHSASEQGSPNSLLLNLGR 280

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  493 bits (1270), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/267 (91%), Positives = 250/267 (93%)

Query: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60
           MSR ADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFL+PWL
Sbjct: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60

Query: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120
           QKAVL+DVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLP IYQNLGLDYDERVLPS
Sbjct: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLK+IVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGR+FTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180

Query: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVEQKQIAQQDAERAR+VVELAEQERQASVIRAEGEAESAEYIS            IRRI
Sbjct: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIAKTLANSSNVTYLPSSHSASE 267
           EASKEIAKTLANSSNVTYLPS+   +E
Sbjct: 241 EASKEIAKTLANSSNVTYLPSNQQGAE 267

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  488 bits (1255), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 238/282 (84%), Positives = 262/282 (92%), Gaps = 2/282 (0%)

Query: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60
           MS+LADSLA+IALP+G+A SALQYSMYDVKGG+RAVIFDRLSGVQQQV+GEGTHFLVPWL
Sbjct: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60

Query: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120
           Q+A++YDVRTKPKNIATNTGTKDLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPS
Sbjct: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLKAIVAQFDAAELITQRE VSQRIR+ELSLRA+EFNIRLEDVSITHMTFGREFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVEQKQIAQQDAERA+++VE AEQERQA+VIRAEGEAESA+YIS            IRR+
Sbjct: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240

Query: 241 EASKEIAKTLANSSNVTYLPSSHS--ASEQGSPNSLLLNLGR 280
           EASKEIA+TLANSSNVTYLPS+ +  A +QGSPNSLLLNLGR
Sbjct: 241 EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  461 bits (1185), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 222/283 (78%), Positives = 250/283 (88%), Gaps = 4/283 (1%)

Query: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61
           SR  D + K+ALP+GL AS LQYSMYDVKGGSR VIFDR++GV+QQVVGEGTHFLVPWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121
           KA++YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V++LP+IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLK+IVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+++VE AEQERQASVIRAEGEAESAEYIS            IRR+E
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAKTLANSSNVTYLPSSHSASEQ----GSPNSLLLNLGR 280
           ASK+IA+TLANSSNV YLPS H+ S      GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  458 bits (1178), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/283 (77%), Positives = 250/283 (88%), Gaps = 4/283 (1%)

Query: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61
           SRL D + K+ALP+G+ AS +QYSMYDVKGGSR VIFDR++GV+QQVVGEGTHFLVPWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121
           KA++YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLK+IVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+++VE AEQERQASVIRAEGEAESAE+IS            IRR+E
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAKTLANSSNVTYLPSSHSAS----EQGSPNSLLLNLGR 280
           ASK+IA+TLANSSNV YLPS HS +      GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  457 bits (1176), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/283 (78%), Positives = 251/283 (88%), Gaps = 4/283 (1%)

Query: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61
           +++ D L KIA+PLG+A S +QY+MYDVKGGSRAVIFDRLSGV+QQV+GEGTHFL PWLQ
Sbjct: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62

Query: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121
           KA+++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV +LPTIYQNLGLDYDERVLPSI
Sbjct: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLKAIVAQFDAAELITQRE VS +IR+ELS+R++EF I+LEDVSITHMTFG+EFTKA
Sbjct: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182

Query: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+++VE AEQERQA+VIRAEGEAESAEYIS            IRR+E
Sbjct: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIAKTLANSSNVTYLPSSHSAS----EQGSPNSLLLNLGR 280
           ASKEIAKTL+ SSNVTYLPS  S++      G+PNSLLLNLGR
Sbjct: 243 ASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  457 bits (1175), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 221/276 (80%), Positives = 246/276 (89%), Gaps = 3/276 (1%)

Query: 8   LAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYD 67
           + K+A+P+G+A S LQYSMYDV+GGSR VIFDRL GV+  VVGEGTHFLVPWLQKA++YD
Sbjct: 12  ITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYD 71

Query: 68  VRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLK 127
           VRTKPK+IATNTGTKDLQMVSLTLRVLHRPDVM+LP IYQNLGLDYDERVLPSIGNEVLK
Sbjct: 72  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLK 131

Query: 128 AIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQI 187
           +IVAQFDAAELITQRE VSQ+IRQELS RA+EF IRLEDVSITHMTFG EFTKAVEQKQI
Sbjct: 132 SIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 191

Query: 188 AQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIA 247
           AQQDAERAR++VE AEQERQASVIRAEGEAESAEYIS            IRR+EASKEIA
Sbjct: 192 AQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIA 251

Query: 248 KTLANSSNVTYLPSSHSAS---EQGSPNSLLLNLGR 280
           +TLANS+N+TYLPS+H+     ++GSPN+LLLNLGR
Sbjct: 252 QTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  453 bits (1166), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 220/278 (79%), Positives = 245/278 (88%)

Query: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60
           MSRL ++LA++A+PLG+  S +QYSMYDV+GGSRAVIFDRLSGVQ+QVVGEGTHFLVPWL
Sbjct: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60

Query: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120
           QKA++YD+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV++LP IYQNLGLDYDERVLPS
Sbjct: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLKAIVAQFDAAELITQRE VSQRIR ELS RASEF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180

Query: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVEQKQIAQQDAERA+++VE AEQ R+ASVIRAEGEAESAEYIS            IRR+
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240

Query: 241 EASKEIAKTLANSSNVTYLPSSHSASEQGSPNSLLLNL 278
           EASKEIA+TLA SSN+TYLP     + +GS NSLLLN+
Sbjct: 241 EASKEIAQTLAASSNITYLPGKAHGNTEGSQNSLLLNI 278

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  450 bits (1158), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 215/283 (75%), Positives = 245/283 (86%), Gaps = 3/283 (1%)

Query: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60
           MS++ D++AK+ALP+G+  S +Q+SMYDVKGGSRAVIFDR+SGV+Q ++GEGTHFL+PWL
Sbjct: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60

Query: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120
           QKA++YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV++LPTIYQNLGLDYDERVLPS
Sbjct: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180
           I NEVLKAIVAQFDAAELITQRE VS RIR EL  R++EF IRLEDVSITHMTFG EFTK
Sbjct: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180

Query: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVE KQIAQQDAERA+++VE AEQERQA+VIRAEGEAESAEYIS            IRR+
Sbjct: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240

Query: 241 EASKEIAKTLANSSNVTYLPSSHS---ASEQGSPNSLLLNLGR 280
           EASKEIA TL+ SSNVTYLP+ H        G+PN+LLLNLGR
Sbjct: 241 EASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  449 bits (1155), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 218/283 (77%), Positives = 250/283 (88%), Gaps = 4/283 (1%)

Query: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61
           ++L D + K+ALP+G+ AS +QYSMYDVKGGSR VIFDR++GV+QQVVGEGTHFLVPWLQ
Sbjct: 5   AKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121
           KA++YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLK+IVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+++VE AEQERQASVIRAEGEAESAE+IS            IRR+E
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAKTLANSSNVTYLPSSH----SASEQGSPNSLLLNLGR 280
           ASK+IA+TLANSSNV YLPS H    ++   GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  446 bits (1146), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 215/281 (76%), Positives = 245/281 (87%), Gaps = 2/281 (0%)

Query: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61
           ++L + + ++ALPLG+ A+ L+YSMYDVKGGSR VIFDRLSGVQ++V+GEGTHFLVPWLQ
Sbjct: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106

Query: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121
           KAV+YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP++ +LP IYQNLGLDYDE+VLPSI
Sbjct: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166

Query: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLK+IVAQFDAAELITQRE VSQRI+ ELS RA EF IRLEDVSITHMTFG EFTKA
Sbjct: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226

Query: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+++VE AEQERQASVIRAEGEAESAEYIS            IRR+E
Sbjct: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286

Query: 242 ASKEIAKTLANSSNVTYLPSSHS--ASEQGSPNSLLLNLGR 280
           ASK+IA+TLANS N+TYLP       ++ GSPNSLLLN+GR
Sbjct: 287 ASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNIGR 327

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  440 bits (1132), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 218/283 (77%), Positives = 250/283 (88%), Gaps = 4/283 (1%)

Query: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61
           SRL D + K+ALP+G+ A+ +QY+MYDVKGGSR VIFDR++GV+QQVVGEGTHFLVPWLQ
Sbjct: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121
           KA++YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V++LP+IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLK+IVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+++VE AEQERQASVIRAEGEAESAE+IS            IRR+E
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAKTLANSSNVTYLPSSH----SASEQGSPNSLLLNLGR 280
           ASK+IA+TLANSSNV YLPS H    S    GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  439 bits (1128), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 212/278 (76%), Positives = 241/278 (86%)

Query: 3   RLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQK 62
           ++A+ LAKIA+PLG+  S + YSMYDVKGGSRAVIFDR+ GV+Q VVGEGTHFLVPWLQK
Sbjct: 5   KIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQK 64

Query: 63  AVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIG 122
           +V++D+RTKPKNI TNTGT+DLQMVSLTLR+LHRPD+++LP IYQNLGLDYDERVLPSIG
Sbjct: 65  SVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIG 124

Query: 123 NEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAV 182
           NEVLK+IVAQFDAAELITQRE VSQRIR+EL+ RA+EF IRLEDVSITHMTFG EFTKAV
Sbjct: 125 NEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAV 184

Query: 183 EQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEA 242
           EQKQIAQQDAERA+++VE AEQERQASVIRAEGEAESAE IS            IRR+E 
Sbjct: 185 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLET 244

Query: 243 SKEIAKTLANSSNVTYLPSSHSASEQGSPNSLLLNLGR 280
           SKEIA+TLA S +VTYLP   + +E  S NSLLLNLGR
Sbjct: 245 SKEIAETLAGSPHVTYLPGGGNQAEDASKNSLLLNLGR 282

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  437 bits (1125), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 215/279 (77%), Positives = 239/279 (85%), Gaps = 6/279 (2%)

Query: 8   LAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYD 67
           L K+ALP+GL  + + YSMYDVKGGSR VIFDRLSGV+  VVGEGTHFLVPWLQKAV+YD
Sbjct: 18  LTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYD 77

Query: 68  VRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLK 127
           VRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V +LP IYQNLGLDYDE+VLPSIGNEVLK
Sbjct: 78  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLK 137

Query: 128 AIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQI 187
           +IVAQFDAAELITQRE VSQRI+ ELS+RA+EF +RLEDVSITHMTFG EFTKAVEQKQI
Sbjct: 138 SIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQI 197

Query: 188 AQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIA 247
           AQQDAERA+++VE AEQERQASVIRAEGEAESAE+IS            IRR+EASK+IA
Sbjct: 198 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIA 257

Query: 248 KTLANSSNVTYLPSSHSASEQG------SPNSLLLNLGR 280
           +TLANS NVTYLP  +  S  G      SPNSLLLN+GR
Sbjct: 258 QTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  430 bits (1105), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/283 (73%), Positives = 243/283 (85%), Gaps = 3/283 (1%)

Query: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60
           MSR  +++A IA+P+G+A  A Q  +YDV+GG+RAVIFDRLSGVQQ+VVGEGTHFL+PWL
Sbjct: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60

Query: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120
           QKAV+YDVRTKPKNIATNTGTKDLQ+V+LTLRVLHRPDV+ LP IYQ LGLDYDERVLPS
Sbjct: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLKAIVAQFDAAELITQRE VSQ+IRQEL+ RA  F+I+LEDV+ITHM FG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180

Query: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           +VE+KQIAQQ++ERA+Y+V+LAEQER A+VIRAEG+AE+AEYIS            IRR+
Sbjct: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240

Query: 241 EASKEIAKTLANSSNVTYLPSSHSASEQ---GSPNSLLLNLGR 280
           EASK+IA+TLA SSN+TYLPSS         G+P+SLLLNLGR
Sbjct: 241 EASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  429 bits (1104), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 208/281 (74%), Positives = 241/281 (85%), Gaps = 2/281 (0%)

Query: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61
           +R  + + K+A+P GL  +A+ YSMYDVKGGSR VIFDR+SGV++ V+GEGTHFLVPWLQ
Sbjct: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62

Query: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121
           KA++YDVRTKPK+I+TNTGTKDLQMVSLTLR+LHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLK+IVAQFDAAELITQRE VSQRIR+E+S RA+EF I+LEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182

Query: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERAR++VE AEQERQASVIRAEGEAESAE IS            IRR+E
Sbjct: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242

Query: 242 ASKEIAKTLANSSNVTYLPSSHS--ASEQGSPNSLLLNLGR 280
           ASK+IA+TL+ SSN+TYLP        E+  PNSLLLN+GR
Sbjct: 243 ASKDIARTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR 283

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  422 bits (1086), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 219/280 (78%), Positives = 245/280 (87%), Gaps = 1/280 (0%)

Query: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61
           SRLA+++AK+A+PLG+ AS +QYSMYDV+GGSRAVIFDRLSGVQQ+VVGEGTHFLVPWLQ
Sbjct: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62

Query: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121
           KAV+YDVRTKPK+IATNTGTKD+QMVSLTLRVLHRP V++LP IYQNLGLDYDERVLPSI
Sbjct: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLKAIVA++DAAELITQRE VS  IR ELS RASEF+IRLEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182

Query: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VE KQIAQQDAERA+++VE AEQ R+ SVIRAEGEAE+AE IS            IRR+E
Sbjct: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIAKTLANSSNVTYLPSSHSASEQ-GSPNSLLLNLGR 280
           ASK+IA+TLANSSNVTYLPS  S   Q G+  SLLLNLGR
Sbjct: 243 ASKDIAQTLANSSNVTYLPSQQSGGGQEGTSQSLLLNLGR 282

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  418 bits (1074), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 213/283 (75%), Positives = 247/283 (87%), Gaps = 3/283 (1%)

Query: 1   MSRLADSLAKIALPL---GLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLV 57
           MSRLADSL ++ LPL    LA SA+Q+SMYDV+GG+RA+IFDR+SGV+  VVGEGTHFL+
Sbjct: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60

Query: 58  PWLQKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERV 117
           PWLQKA+++DVRTKP+NIATNTGTKDLQMVSLTLRVLHRPDVM L  IY+ LG DYDERV
Sbjct: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120

Query: 118 LPSIGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRE 177
           LPSIGNEVLKAIVAQF+A+ELITQRE VSQ+IR EL+ RASEFNIRLEDVSITHMTFG+E
Sbjct: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180

Query: 178 FTKAVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXI 237
           FTKAVEQKQIAQQ+++RA++VVE AEQER+A+VIRAEGEAE+AE+IS            I
Sbjct: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240

Query: 238 RRIEASKEIAKTLANSSNVTYLPSSHSASEQGSPNSLLLNLGR 280
           RR+EASK IA+TLANS NVTYLPS   A++ G+PNSLLLNLGR
Sbjct: 241 RRLEASKGIAETLANSPNVTYLPSKGQAADSGAPNSLLLNLGR 283

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  417 bits (1071), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 216/284 (76%), Positives = 243/284 (85%), Gaps = 4/284 (1%)

Query: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60
           MS+  + L+K+A+P GL   A  Y+MYDVKGGSR VIFDR+SGVQQ+VVGEGTHFLVPWL
Sbjct: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60

Query: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120
           QKA++YDVR+KPK+IATNTGTKDLQMVSLTLRVLHRP+VM+LP IYQ+LGLDYDERVLPS
Sbjct: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLK+IVAQFDAAELITQRE VSQRIR+ELS RA EF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180

Query: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVEQKQIAQQDAERA+++VE AEQ RQASVIRAEGEAESAE IS            IRR+
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRL 240

Query: 241 EASKEIAKTLANSSNVTYLPSSHSAS----EQGSPNSLLLNLGR 280
           EASKEIA+TL+ SSNVTYLPS+ +      E GS N+LLLN+GR
Sbjct: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  386 bits (992), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 202/214 (94%)

Query: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60
           MSR+AD +A+IA+P+GL  SA+QYSMYDV+GG RAVIFDRL GVQQ V+GEGTHFLVPWL
Sbjct: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60

Query: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120
           QK++L+DVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVM+LP IYQNLG+DYDERVLPS
Sbjct: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLKAIVAQFDAAELITQRE VSQRIR ELS RA EF+I+LEDVSITHMTFG+EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180

Query: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAE 214
           AVEQKQIAQQDAERAR++VE AEQER+A+VIRAE
Sbjct: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  286 bits (733), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 190/259 (73%), Gaps = 11/259 (4%)

Query: 19  ASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATN 78
           A  LQ S+++V GG RA+++ R++GV  ++  EGTHF++PWL+  ++YDVR KP+N+A+ 
Sbjct: 50  AFLLQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASL 109

Query: 79  TGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAEL 138
           TGTKDLQMV++T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++L
Sbjct: 110 TGTKDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQL 169

Query: 139 ITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYV 198
           ITQRE VS+ IR+ L  RAS+FNI L+DVSIT MTF  EFT+AVE KQIAQQDA+RA ++
Sbjct: 170 ITQREKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFI 229

Query: 199 VELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVTY 258
           V+ A QE+Q  V++A+GEA+SAE I             ++R++ ++EIA+ LANS N   
Sbjct: 230 VDKARQEKQGMVVKAQGEAKSAELIG-EAIKKSRDYVELKRLDTAREIARILANSPNRVV 288

Query: 259 LPSSHSASEQGSPNSLLLN 277
           L +           SLLLN
Sbjct: 289 LDNE----------SLLLN 297

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  286 bits (731), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 138/234 (58%), Positives = 180/234 (76%), Gaps = 1/234 (0%)

Query: 22  LQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGT 81
           L  S+++V GG RA+++ RLSGVQQ V GEGTHF++PWL+  VLYDVR+KP+ +++ TGT
Sbjct: 54  LNASLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGT 113

Query: 82  KDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
            DLQMV++T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 NDLQMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 RETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVEL 201
           RE+VS+ IR  L  RAS FNI L+DVSIT+MTF  EFT AVE KQ+AQQDA+RA + VE 
Sbjct: 174 RESVSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEK 233

Query: 202 AEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           A+QE+Q+ +++A+GEA+SAE I             ++R++ ++EIA  LA S N
Sbjct: 234 AKQEKQSMIVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIAGILAASPN 286

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  286 bits (731), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 184/243 (75%), Gaps = 1/243 (0%)

Query: 13  LPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKP 72
           L LG  A     ++++V GG RA+++ R+ GV Q++  EGTH ++PW++  ++YDVR KP
Sbjct: 47  LVLGAGALFFNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKP 106

Query: 73  KNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQ 132
           +N+A+ TGTKDLQMV++T RVL RP+V +LPTIY+ LG DYDERVLPSI NEVLKA+VAQ
Sbjct: 107 RNVASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQ 166

Query: 133 FDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDA 192
           F+A++LITQRE VS+ IR  L  RAS FNI L+DVSIT+MTF  EFT+AVE KQIAQQDA
Sbjct: 167 FNASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDA 226

Query: 193 ERARYVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLAN 252
           +RA ++V+ A QE+Q  V++A+GEA+SAE I             ++R++ +K+IAK LAN
Sbjct: 227 QRAAFIVDKARQEKQGMVVKAQGEAKSAELIG-DAIKKSRDYVELKRLDTAKDIAKILAN 285

Query: 253 SSN 255
           S N
Sbjct: 286 SPN 288

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  284 bits (727), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 136/231 (58%), Positives = 178/231 (77%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+++ RLSGV  ++  EGTHF++PWLQ  ++YDVR KP+N+A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RPD+  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RA +FNI L+DVSIT MTF  EFT AVE KQIAQQDA+RA ++V+ A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ SK+IAK LA SSN
Sbjct: 235 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDISKDIAKILATSSN 284

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  283 bits (725), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 180/231 (77%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   ++YDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RPDV++LPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RAS+FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA +VV+ A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V+RA+GEA+SAE I             ++R++ +++IAK LA+S N
Sbjct: 237 EKQGMVVRAQGEAKSAELIG-EAIKKSRDYVELKRLDTARDIAKILASSPN 286

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  282 bits (722), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 133/235 (56%), Positives = 182/235 (77%), Gaps = 1/235 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+++ RL+GVQ ++  EGTHF +PWL+  ++YDVR KP+N+A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LPT+++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RAS+FN+ L+DVSIT+MTF  EFT AVE KQIAQQDA+RA +VV+ A Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVTYL 259
           E+Q  V++A+GEA+SAE I             ++R++ ++EIA  L++S N   L
Sbjct: 237 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIATILSSSPNKVIL 290

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  282 bits (721), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 180/231 (77%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   ++YDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RPDV++LPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RAS+FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA +VV+ A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ +++IAK LA+S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIG-EAIKKSRDYVELKRLDTARDIAKILASSPN 286

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  281 bits (720), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 181/231 (78%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ G+QQ++  EGTHF VPWL+  ++YDVR KP+N+A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RP+V +LPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RAS+FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA +VV+ A Q
Sbjct: 178 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ ++EIA+ L+ S N
Sbjct: 238 EKQGMVVKAQGEAQSAELIG-EAIKKSKDYVELKRLDTAREIAEILSKSPN 287

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  281 bits (719), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 180/235 (76%), Gaps = 1/235 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ RL+GV  ++  EGTHF+ PW+   ++YDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RAS F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA +VV+ A Q
Sbjct: 177 VSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVTYL 259
           E+Q  V++A+GEA+SAE I             ++R++ +++IAK LANS N   L
Sbjct: 237 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTARDIAKILANSPNRVVL 290

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  280 bits (716), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 188/260 (72%), Gaps = 11/260 (4%)

Query: 18  AASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIAT 77
           +A  L  ++++V GG RA+++ R+SGV  ++  EGTHF +PW++  ++YDVR KP+N+A+
Sbjct: 55  SAMLLNSALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVAS 114

Query: 78  NTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAE 137
            TGTKDLQMV++T RVL RP+V +LPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++
Sbjct: 115 LTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQ 174

Query: 138 LITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARY 197
           LITQRE VS+ IR+ L  RA+ FNI L+DVSIT MTF  EFT AVE KQIAQQDA+RA +
Sbjct: 175 LITQREKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAF 234

Query: 198 VVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVT 257
           VV+ A QE+Q  V+RA+GEA+SAE I             ++R++ ++EIA+ LA S N  
Sbjct: 235 VVDKARQEKQGMVVRAQGEAKSAELIG-DAIKKSKDYVELKRLDTAREIARILAKSPNRV 293

Query: 258 YLPSSHSASEQGSPNSLLLN 277
            L +           SLLLN
Sbjct: 294 VLDNE----------SLLLN 303

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  280 bits (715), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 178/231 (77%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF++PW++  V+YDVR KP+N+A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RP+V +LPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR  L LRA +FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA +VV+ A Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ +K+IA  LA S N
Sbjct: 238 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAKDIADILAKSPN 287

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  279 bits (713), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 139/253 (54%), Positives = 185/253 (73%), Gaps = 11/253 (4%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF++PWL+  V+YDVR KP+N+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RA  FN+ L+DVSIT+MTF  EFT AVE KQIAQQDA+RA +VV+ A+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVTYLPSSHS 264
           E+Q  V++A+GEA+SAE I             ++R++ ++EIA  LA S N   L +   
Sbjct: 240 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIADILAKSPNRVVLDNE-- 296

Query: 265 ASEQGSPNSLLLN 277
                   SLLLN
Sbjct: 297 --------SLLLN 301

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  279 bits (713), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 177/231 (76%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   ++YDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RA+ FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA +VV+ A Q
Sbjct: 177 VSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ +++IAK LANS N
Sbjct: 237 EKQGMVVKAQGEAKSAELIG-EAIKKSRDYVELKRLDTARDIAKILANSPN 286

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  278 bits (711), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 179/231 (77%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+I+ RL+GVQ ++  EGTHF +PW +  ++YDVR KP+N+A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RP+V +LPT+++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RAS+FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA +VV+ A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ ++EIA  L+ S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIATILSQSPN 286

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  277 bits (708), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 138/253 (54%), Positives = 183/253 (72%), Gaps = 11/253 (4%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+++ R+SGV  ++  EGTHF++PW++  ++YDVR KP+N+A+ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  R+S FNI L+DVSIT MTF  EFT AVE KQIAQQDA+RA +VV+ A Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVTYLPSSHS 264
           E+Q  V+RA+GEA+SAE I             ++R++ ++EIA  LA S N   L +   
Sbjct: 239 EKQGMVVRAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIATILAKSPNRVVLDNE-- 295

Query: 265 ASEQGSPNSLLLN 277
                   SLLLN
Sbjct: 296 --------SLLLN 300

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  275 bits (703), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 184/253 (72%), Gaps = 11/253 (4%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF++PWL+  ++YDVR KP+N+A+ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LPT+Y+ LG DYD+RVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RAS FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA ++V+ A Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVTYLPSSHS 264
           E+Q  V++A GEA+SAE I             ++R++ +KEIA  LA S N   L +   
Sbjct: 215 EKQGMVVKAVGEAKSAELIG-EAIKKSKDYVELKRLDTAKEIATILAASPNRVVLDNE-- 271

Query: 265 ASEQGSPNSLLLN 277
                   SLLLN
Sbjct: 272 --------SLLLN 276

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  274 bits (700), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 177/231 (76%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTH L+PW +  V+YDVR KP+N+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LP IY+ LGLDYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RAS FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA +VV+ A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+G+A+SAE I             ++R++ ++EIA+ L+ S N
Sbjct: 240 EKQGLVVKAQGDAKSAELIG-EAIRKSKDYVELKRLDTAREIAQILSRSPN 289

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  273 bits (697), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 178/234 (76%), Gaps = 1/234 (0%)

Query: 22  LQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGT 81
           L  ++++V GG RA+++ R+ GV  ++  EGTH ++PWL+  V+YDVR KP+N+A+ TGT
Sbjct: 56  LNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGT 115

Query: 82  KDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RP+V +LPTIY+ LG DY ERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 116 KDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQ 175

Query: 142 RETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVEL 201
           RE VS+ IR+ L  RAS F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA +VV+ 
Sbjct: 176 REKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 235

Query: 202 AEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           A QE+Q  V++A+GEA+SAE I             ++R++ ++EIA+ LA S N
Sbjct: 236 ARQEKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIAQILARSPN 288

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  272 bits (696), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 179/235 (76%), Gaps = 1/235 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R++GVQ ++  EGTHF++PW++  V+YDVR KP+N+++ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRET 144
           QMV++T RVL RP+V  LP IY+ LG+DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERARYVVELAEQ 204
           VS+ IR+ L  RA  FNI L+DVSIT+MTF  EFT +VE KQIAQQDA++A +VV+ A Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVTYL 259
           E+Q  +++A+GEA+SAE I             ++R++ ++EIA  L+ S N   L
Sbjct: 238 EKQGMIVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIASILSRSPNKVIL 291

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 80  GTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAI 129
           G +   +  +  + L R D+   P +Y++L L+    VLP  GN +LK +
Sbjct: 274 GCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGNRILKEL 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.129    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,800,088
Number of extensions: 798407
Number of successful extensions: 2712
Number of sequences better than 10.0: 50
Number of HSP's gapped: 2781
Number of HSP's successfully gapped: 50
Length of query: 280
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 172
Effective length of database: 41,097,471
Effective search space: 7068765012
Effective search space used: 7068765012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)