Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14850g3.493ON1711717661e-105
Kwal_55.212383.493ON1701716242e-83
SAKL0F02750g3.493ON1701715122e-66
KLLA0D16280g3.493ON1691714732e-60
Skud_16.4443.493ON1731744314e-54
YPR149W (NCE102)3.493ON1731744315e-54
Smik_16.4023.493ON1731744262e-53
Suva_16.4783.493ON1661744071e-50
KAFR0C019703.493ON1791794063e-50
TDEL0D056103.493ON1751763984e-49
CAGL0I10494g3.493ON1721733881e-47
CAGL0L08448g3.493ON1731743845e-47
NDAI0B058803.493ON1821833795e-46
Ecym_12363.493ON1691723777e-46
NDAI0G009303.493ON1761773724e-45
NCAS0E008003.493ON1741753681e-44
TBLA0C044903.493ON1861533604e-43
ZYRO0D09966g3.493ON1781783533e-42
Skud_7.4423.493ON1741753517e-42
TPHA0D032803.493ON1841853456e-41
YGR131W (FHN1)3.493ON1741753412e-40
Kpol_1017.63.493ON1871763422e-40
KAFR0G037003.493ON1861863396e-40
KNAG0B008003.493ON1821833273e-38
Smik_6.2273.493ON1741753194e-37
AFR312W3.493ON1681713185e-37
TBLA0D029603.493ON1891543143e-36
Suva_7.4193.493ON1741753133e-36
KNAG0A079503.493ON1821833012e-34
NCAS0F035603.493ON1831842771e-30
KAFR0F003402.61ON311160691.2
Suva_4.272.61ON32274637.5
SAKL0D00110gsingletonON562144638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14850g
         (171 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   299   e-105
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   244   2e-83
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   201   2e-66
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   186   2e-60
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   170   4e-54
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   170   5e-54
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   168   2e-53
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   161   1e-50
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   160   3e-50
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   157   4e-49
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   154   1e-47
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   152   5e-47
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   150   5e-46
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   149   7e-46
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   147   4e-45
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   146   1e-44
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   143   4e-43
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   140   3e-42
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   139   7e-42
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   137   6e-41
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   135   2e-40
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   136   2e-40
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   135   6e-40
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   130   3e-38
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   127   4e-37
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   127   5e-37
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   125   3e-36
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   125   3e-36
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   120   2e-34
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   111   1e-30
KAFR0F00340 Chr6 (83466..84401) [936 bp, 311 aa] {ON} Anc_2.61 Y...    31   1.2  
Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)     29   7.5  
SAKL0D00110g Chr4 (1481..3169) [1689 bp, 562 aa] {ON} some simil...    29   8.6  

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  299 bits (766), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 154/171 (90%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NFVSALAWPLLIAVFD                 IRTHSCTNQDYLDSNTVTQGSTDRCRK
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV 171
           AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV 171

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  244 bits (624), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 123/171 (71%), Positives = 138/171 (80%), Gaps = 1/171 (0%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLSILDNSLRA NF FL+I+LGLTGSLAAT + +NNPQVNFA+F AAFGLLFD+LYAIPA
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAAT-RDNNNPQVNFAVFAAAFGLLFDTLYAIPA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF+SALAWPLLIAVFD                 IR HSCTN DY+D+N VTQGS+DRCRK
Sbjct: 60  NFISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRK 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV 171
           AQASVAFLYF+FF+FL KL LSLVN+ SVGAF   S R++ NVGVPTISQV
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSGRKSANVGVPTISQV 170

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  201 bits (512), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 128/171 (74%), Gaps = 1/171 (0%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLSILDNSLR +NFAFLVIILGLTGSL AT   H+ P+VNFAIFTAAF L+ DS YA+ A
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHS-PRVNFAIFTAAFALVTDSFYAVFA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           N  SA AWP+L+  +D                 IRTHSCTN+ YL SN +TQGSTDRCRK
Sbjct: 60  NLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV 171
           AQA+VAFLYFSFFIFL KL LS++N+ S GAFG+GS  R  NVGVPTISQV
Sbjct: 120 AQATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSRRANVGVPTISQV 170

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  186 bits (473), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 97/171 (56%), Positives = 118/171 (69%), Gaps = 2/171 (1%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLSILDNSLR +NF FL+I+LGL G+L AT   H++ +VNFAIF A FG++FDSLYA+ A
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQD-HSSSRVNFAIFAAVFGIVFDSLYALIA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF+SALAWP+++   D                 IR  SCTN  +   N + +GS DRCRK
Sbjct: 60  NFISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV 171
           AQAS  FLYFSF IFL K  LS+VN I+ GAFG  S+R+T  VGVPTISQV
Sbjct: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRKT-QVGVPTISQV 169

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  170 bits (431), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 114/174 (65%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML+  DN LR +NF FLVI++GL  SL  T    N+ +VNF +F AA+G+  DSLY + A
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQD-RNSSRVNFCMFAAAYGIFTDSLYGVFA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF   LAWPL++   D                 IR HSC N+ Y+DSN +TQGS  RCR+
Sbjct: 60  NFFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQ 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGS---SRRTGNVGVPTISQV 171
           AQA+VAFLYFS  IFLAK  +S+ N+IS GAFG+GS    RRTG VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  170 bits (431), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 114/174 (65%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML++ DN LR +NF FLVI +GL  SL  T   H++ +VN+ +F  A+G+  DSLY + A
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSS-RVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF+  LAWPL++   D                 IR HSC N  Y+DSN +TQGS  RCR+
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGS---SRRTGNVGVPTISQV 171
           AQA+VAFLYFS  IFLAK  +S+ N+IS GAFG+GS    RRTG VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  168 bits (426), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 90/174 (51%), Positives = 113/174 (64%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML++ DN LR +NF FLVI + L  SL  T   H++ +VN+ +F  A+G+  DSLY + A
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSS-RVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF+  LAWPL++   D                 IR HSC N  Y+DSN +TQGS  RCR+
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGS---SRRTGNVGVPTISQV 171
           AQA+VAFLYFS  IFLAK  +S+ N+IS GAFG+GS    RRTG VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  161 bits (407), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 90/174 (51%), Positives = 116/174 (66%), Gaps = 11/174 (6%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML+ +DN LR +NF FLVI +GL  SL  T ++ N+ ++N+ +F  A+ ++ DSLY + A
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNT-QSGNSSRINYCMFAVAYAIVTDSLYGVFA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF   LAWPL++   D                 IR HSC NQ YL SN++TQGS +RCR+
Sbjct: 60  NFFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGS---SRRTGNVGVPTISQV 171
           AQA+VAFLYFS  IFLAK  +S+ N+IS GAFG+GS    RRTG VGVPTISQV
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  160 bits (406), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 87/179 (48%), Positives = 106/179 (59%), Gaps = 8/179 (4%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML + DN LR +N  FL+I + LT +L  T   H+N +VN+ +F  AFGL FDS+Y I A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF   LAWPLL+   D                 IR HSC NQ YLDSN + +GS  RCR+
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSR--------RTGNVGVPTISQV 171
           AQA VAFLYFS  IF+AK+ +S +NL   GAF +GSSR         T   GVP ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  157 bits (398), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 119/176 (67%), Gaps = 6/176 (3%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML+I+DN+LR +NFAFLVI+LGL G L ++   H++ +VNF +F AAFG++ DS Y I A
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSS-RVNFCMFAAAFGIVTDSFYGILA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           N     AWP+++   D                 IRTHSC NQDYLDSN +TQGST RCR 
Sbjct: 60  NIWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSS-----RRTGNVGVPTISQV 171
           AQASVAF YFSFFIFLAK+ +SL+ +I+ G F + ++     R++  VGVPTISQV
Sbjct: 120 AQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  154 bits (388), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/173 (49%), Positives = 110/173 (63%), Gaps = 3/173 (1%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLS+ DN LR +N  FL+I +GL  SL  T K H++ +VNF +F AA+G+  DSLY I A
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSS-RVNFCLFAAAYGIATDSLYGIFA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNT-VTQGSTDRCR 119
           NF   LAWPL++ V D                 IR HSC N+ YL+  T + QGS  RCR
Sbjct: 60  NFFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119

Query: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTG-NVGVPTISQV 171
           +AQA VAF YFS  IFLAK+ +S+V+++S GAFGA   R+    VGVP+ISQV
Sbjct: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  152 bits (384), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 108/174 (62%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML++ DN LR +NF F+VI +GL   L AT   H++ +VN+ +F AA+G+  DSLY + A
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSS-RVNYCMFAAAYGIATDSLYGVFA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF   LAWPL++   D                 IR HSC N  Y ++N + QGS  RCR+
Sbjct: 60  NFFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGN---VGVPTISQV 171
           +QA+VAF +FS  IFLAK+ +SL+N+ S GAFG    RR  N   VGVP++SQV
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  150 bits (379), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 113/183 (61%), Gaps = 13/183 (7%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLS +DN LR +N  FLV+ +    +L  T + +N+ ++NF +F AAFGLL DS + +  
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQR-NNSSRINFCMFAAAFGLLTDSFFGVAF 59

Query: 61  NFVSALA-WPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCR 119
           N   ALA WP+L+ +FD                 IR HSC N+ Y++SN++TQGS +RCR
Sbjct: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119

Query: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAG------SSRRT-----GNVGVPTI 168
            +QA+VAF YFS FIFLAK+ +S +N+ S G FG+G      S RRT       VGVPTI
Sbjct: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTI 179

Query: 169 SQV 171
           SQV
Sbjct: 180 SQV 182

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  149 bits (377), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 94/172 (54%), Positives = 118/172 (68%), Gaps = 4/172 (2%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLA-ATHKTHNNPQVNFAIFTAAFGLLFDSLYAIP 59
           MLSILDNSLRA NF FL+I+L LTGSL    +++H+  +VNF +FTA F LLFDSLY++ 
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHS--RVNFGLFTAIFALLFDSLYSVL 58

Query: 60  ANFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCR 119
           ANF+SALAWP+L+   D                 I  HSC+N  +L  N +++G   RCR
Sbjct: 59  ANFISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCR 118

Query: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV 171
           K QAS  FL+FSFFIFLAK  LS +N++S GAF +GS R+TG  GVPTISQV
Sbjct: 119 KVQASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGG-GVPTISQV 169

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  147 bits (372), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 81/177 (45%), Positives = 106/177 (59%), Gaps = 7/177 (3%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLS+ DN LR LN  FLVI +GL  +L  T + HN  ++N+ +FT  + LL DS + I A
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHN-SRINYCMFTCVYCLLTDSFFGILA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF   L++P ++   D                 IR+HSC NQ YLD N +TQGS +RCR+
Sbjct: 60  NFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFG----AGSSRRTG--NVGVPTISQV 171
           +QA VAF YFS FIFL KL +S +++I  GAF     +   RR G   VGVP+ISQV
Sbjct: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  146 bits (368), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 103/175 (58%), Gaps = 5/175 (2%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML + DN LR LN  FLVI +GL  +L  T KTHNN ++N+ +FT A+ L  DS+Y I A
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNT-KTHNNSRINYCMFTCAYCLTTDSIYGIFA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF   LA P L    D                 IR HSC ++ Y++SN +TQG  +RCR+
Sbjct: 60  NFFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAF----GAGSSRRTGNVGVPTISQV 171
           +QA VAF YFS  IFLAKL +S +N+I  GAF    G    R    +GVP+ISQV
Sbjct: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  143 bits (360), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 76/153 (49%), Positives = 95/153 (62%), Gaps = 1/153 (0%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLS   N LR +NF FLVII G+ G L  + K  ++P+VN+ +F A F L+ DS YAIPA
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 61  NFV-SALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCR 119
           NF  S  AWP+L+  FD                 IRTHSC N+ YL SN +TQGST+RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAF 152
            AQAS+AF YFSFFI+L +L  S + +   G F
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLF 153

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  140 bits (353), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 111/178 (62%), Gaps = 7/178 (3%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML++ DN LRA+NF F VI+LGL G L  + K  +N +VNF +F AAFG++ DS Y I A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           N     A+P+++ + D                 IRTHSCTN+ YLDSN +TQGST RCR+
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGA-------FGAGSSRRTGNVGVPTISQV 171
           AQA VAF YF+FFIFL K+ +S ++L+S GA              +  NVGVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  139 bits (351), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 105/175 (60%), Gaps = 5/175 (2%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLS  DN +R ++  FL+I +GL G L  T +T+ + +VNF +F AA+GL+ DS Y   A
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGT-QTNGSSRVNFCMFAAAYGLITDSFYGFLA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF S+L +P ++ V D                 IR HSC N+ YL+ N +TQGS+ RC +
Sbjct: 60  NFWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAF----GAGSSRRTGNVGVPTISQV 171
           +QA+VAF YFS F+FL K+ +S+  ++  G F    G G  R    +GVPTISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  137 bits (345), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 90/185 (48%), Positives = 109/185 (58%), Gaps = 15/185 (8%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML + DN LR +NF F VI LGL GSL AT   H++ +VN+ IF   F L+ D+ Y   A
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSS-RVNYCIFVPPFALVTDTFYGALA 59

Query: 61  NFVSA-LAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCR 119
           N  S  LAWP+++  FD                  RTHSCTNQ YLDSN +TQGSTDRCR
Sbjct: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119

Query: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGS-------------SRRTGNVGVP 166
           KAQA+ AF YFSFFIFLAKL +S +NL + GA G+ S                +  +GVP
Sbjct: 120 KAQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVP 179

Query: 167 TISQV 171
            ISQV
Sbjct: 180 NISQV 184

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  135 bits (341), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 105/175 (60%), Gaps = 5/175 (2%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLS  DN +R +N  FL+I +GL   L  T   H++ +VNF +F A +GL+ DSLY   A
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSS-RVNFCMFAAVYGLVTDSLYGFLA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF ++L +P ++ V D                 IR HSC N+ YL+ N + QGS+ RC +
Sbjct: 60  NFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGA--GSSRRTG--NVGVPTISQV 171
           +QA+VAF YFS F+FL K+ ++ + ++  G FG+  G SRR     +G+PTISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  136 bits (342), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/176 (47%), Positives = 111/176 (63%), Gaps = 8/176 (4%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLS+ DN +RA+NF F VI +GL GSL AT K H++ +VN+ +F   F ++ DS Y I A
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSS-RVNYCMFVPPFAVVTDSFYGILA 59

Query: 61  N-FVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCR 119
           N + +  AWP+++  FD                 IRTHSC N++Y+D+N + QGSTDRCR
Sbjct: 60  NIWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119

Query: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFG-----AGSSR-RTGNVGVPTIS 169
           KAQAS+AF YFSFFIF  K+ +S +NL+S GA G      G  R  T N+GVP  S
Sbjct: 120 KAQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGAS 175

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  135 bits (339), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 104/186 (55%), Gaps = 15/186 (8%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML+I DNSLR +NF F+VI +     L  T + HN+ +VN+ +F  AFG+L DS+Y + A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF   LAWP+++ VFD                 IR H+C N+ Y +SN + +GS  RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAF---------------GAGSSRRTGNVGV 165
           AQA+VAF YFS  IFL K   S++  IS G F                AG+   T + GV
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTGV 180

Query: 166 PTISQV 171
           PT+S+V
Sbjct: 181 PTVSEV 186

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  130 bits (327), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 99/183 (54%), Gaps = 13/183 (7%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML + DN LR LNF FLVI L    +L  T K H + +VN+ +F AA+G+  D LY + A
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHIS-RVNYCMFAAAYGIATDGLYGLLA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF   LAWPL++   D                 IR HSC N  Y + N + QGS +RCR 
Sbjct: 60  NFWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSR------------RTGNVGVPTI 168
           +QA+ AF +FS  IF+AK+ +S +NL S GAF   SS+                 GVP+I
Sbjct: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSI 179

Query: 169 SQV 171
           SQV
Sbjct: 180 SQV 182

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  127 bits (319), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 100/175 (57%), Gaps = 5/175 (2%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLS  DN +R +N  FL+I +GL   L +T   H++ +VNF +FTAA+GL+ DSLY   A
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSS-RVNFCMFTAAYGLVTDSLYGFLA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF S+L +P ++   D                 IR HSC N+ YL+ N +TQ S+ RC +
Sbjct: 60  NFWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLIS----VGAFGAGSSRRTGNVGVPTISQV 171
           +QA+VAF YFS F+FL K+ ++    I         G G  R    +GVPTISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  127 bits (318), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 111/171 (64%), Gaps = 3/171 (1%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLSILDNSLRA+NF FL+I+LGLTGSL    + +++ +VNF +FTA F L+ DS Y+I A
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQR-NSHSRVNFGLFTAVFALVTDSFYSIVA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF+SA AWP++    D                 I  HSC+N+ +LD NT+++ STDRCRK
Sbjct: 60  NFISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV 171
            QAS  FL+FSFFIFLAK   S +N+ S GA    S       GVPTISQV
Sbjct: 120 VQASSTFLFFSFFIFLAKAVFSGLNIFSSGA--FSSGGSKRGGGVPTISQV 168

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  125 bits (314), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 64/154 (41%), Positives = 87/154 (56%), Gaps = 1/154 (0%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML + DN  R  NF F VI  G+ G+L  T   H++ +VN+ +F  A+GL+ DS Y I A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 61  NFV-SALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCR 119
           N V    A+P ++  FD                 IRTHSCTN++Y   N + QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFG 153
           +AQA +AF YFS F+FL K+ ++LV   + G  G
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELG 154

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  125 bits (313), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 101/175 (57%), Gaps = 5/175 (2%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLS+ DN +R +N  FL+I +GL   L ++   H++ +VNF +F AA+GLL DS Y   A
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSS-RVNFCMFAAAYGLLTDSFYGCLA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           N  S+L +P+++ V D                 IR HSC+N+ YLD+N +TQGS  RC +
Sbjct: 60  NLWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLIS----VGAFGAGSSRRTGNVGVPTISQV 171
           A+A+V F YFS  +FL K+ +S+  ++           G  R    +G+PTISQV
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  120 bits (301), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 107/183 (58%), Gaps = 13/183 (7%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           ML++ D  LR +NF FLVI +GL  +L  T   H++ ++N+ +FTAA+G+  DS Y + A
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSS-RINYCMFTAAYGITTDSFYGVVA 59

Query: 61  NFVSALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCRK 120
           NF   L+WPLL+   D                 IR HSC N  Y + N + QGS +RCR+
Sbjct: 60  NFWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119

Query: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFG-AGSS---------RRTGNV--GVPTI 168
           AQA+VAF +FS  IFLAK  +SLVN+ + G FG AGSS         +RT  V  GVP I
Sbjct: 120 AQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNI 179

Query: 169 SQV 171
           S V
Sbjct: 180 STV 182

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  111 bits (277), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 79/184 (42%), Positives = 111/184 (60%), Gaps = 14/184 (7%)

Query: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           MLS +DN+LR  N  FLV+ +    +L +T + H + +VN+ +F AAFGLL DS + + A
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLST-QNHGSSRVNYCMFAAAFGLLTDSFFGMAA 59

Query: 61  NFVSALA-WPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTDRCR 119
           N +  L+ WP+++ VFD                 IR HSC N+ YL+SN + QGS  RCR
Sbjct: 60  NLIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCR 119

Query: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGS--SRRTGN----------VGVPT 167
            +QA+VAF YF+ F+FLAK+ +S +++ S GAFG+GS  SRR              GVPT
Sbjct: 120 VSQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPT 179

Query: 168 ISQV 171
           IS+V
Sbjct: 180 ISEV 183

>KAFR0F00340 Chr6 (83466..84401) [936 bp, 311 aa] {ON} Anc_2.61
           YDL218W
          Length = 311

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 60/160 (37%), Gaps = 31/160 (19%)

Query: 2   LSILDNS-LRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60
           +S + NS LR L FA   I+LGL      ++  H + + NFA+   A G+     Y +  
Sbjct: 19  ISYIPNSILRFLQFASTSIVLGLIAFALHSYHNHGSRRANFALAVGAIGV----FYCLAV 74

Query: 61  NFVSALAWPLLIA----VFDXXXXXXXXXXXXXXXXXIRTHSCTNQ-------------- 102
            F++ +A  L++     + +                    HSC                 
Sbjct: 75  FFLTLIAPQLVLGGIFLIAEIIMTLLFLCGFIVAAKVFGQHSCGTHVVSSYNPAYGSFAD 134

Query: 103 --------DYLDSNTVTQGSTDRCRKAQASVAFLYFSFFI 134
                   D       T+  T+ CR ++AS+AFL  +F +
Sbjct: 135 FQSTGGQYDPFKGTYTTKSYTNACRSSKASIAFLGLAFVL 174

>Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)
          Length = 322

 Score = 28.9 bits (63), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 9/74 (12%)

Query: 97  HSCTNQ----DYLDSNTVTQGSTDR---CRKAQASVAFLYFSFFIFLAKLGLSLVNLIS- 148
           HSC ++    +Y D  +    +T+    C  +QA++AF    F +FL  + L  VN+++ 
Sbjct: 100 HSCKSRNSSGEYYDPYSGQYTTTNHRRACNSSQAAIAFAGLCFLLFLTSVVLLGVNILTP 159

Query: 149 -VGAFGAGSSRRTG 161
            +G + +    RTG
Sbjct: 160 IMGRYKSQGLWRTG 173

>SAKL0D00110g Chr4 (1481..3169) [1689 bp, 562 aa] {ON} some
           similarities with uniprot|Q07629 Saccharomyces
           cerevisiae YDL218W
          Length = 562

 Score = 28.9 bits (63), Expect = 8.6,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 55/144 (38%), Gaps = 6/144 (4%)

Query: 9   LRALNFAFLVIILGLTGSLAATHK-THNNPQVNFAIFTAAFGLLFDSLYAIPANFVSALA 67
           LR + F   +  LG+   +A     +++   ++F +  +A  LL+  L AI    V A  
Sbjct: 258 LRVVQFMPAIAALGMLAYVAHDKGYSYDEASIHFGLAASAISLLY--LLAIVMVRVPASI 315

Query: 68  WPLLIAVFDXXXXXXXXXXXXXXXXXIRTHSCTNQDYLDSNTVTQGSTD---RCRKAQAS 124
             + + VF+                     +C N  Y+        + D    C+  QAS
Sbjct: 316 NAVAVLVFEVAMSTIWLAALITLAVSTGRENCKNAYYISDRQDFYWNYDWRVNCKAGQAS 375

Query: 125 VAFLYFSFFIFLAKLGLSLVNLIS 148
                F+F +F     L  +N+IS
Sbjct: 376 AGMAGFAFVLFACSSVLCELNVIS 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.138    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,828,284
Number of extensions: 425533
Number of successful extensions: 1258
Number of sequences better than 10.0: 41
Number of HSP's gapped: 1192
Number of HSP's successfully gapped: 42
Length of query: 171
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 69
Effective length of database: 41,785,467
Effective search space: 2883197223
Effective search space used: 2883197223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)