Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14828g3.492ON83683631140.0
Kwal_55.212293.492ON78748812571e-160
SAKL0F02772g3.492ON7735038323e-98
Smik_6.2263.492ON8393605986e-65
Suva_7.4183.492ON8314985942e-64
Skud_7.4413.492ON8073705889e-64
YGR130C3.492ON8163555792e-62
KLLA0D16236g3.492ON8713255546e-59
ZYRO0D09988g3.492ON9943454441e-44
NCAS0E008103.492ON6923714372e-44
Ecym_12373.492ON7272864346e-44
CAGL0I10516g3.492ON8133654172e-41
TDEL0D056003.492ON7002543973e-39
Kpol_480.143.492ON6993413868e-38
NDAI0G009403.492ON6565033671e-35
TPHA0D042503.492ON6293213261e-30
AFR310C3.492ON6232592503e-21
KNAG0B008103.492ON7572632022e-15
KAFR0C019603.492ON5632681575e-10
KNAG0A079403.492ON2751601312e-07
TBLA0C044803.492ON8022071272e-06
KAFR0G036903.492ON3631521153e-05
NDAI0B058603.492ON6811011065e-04
CAGL0D04994g3.479ON692180860.12
NCAS0F035503.492ON441103830.27
KAFR0G020908.604ON732175790.90
TPHA0P003408.68ON121991781.2
CAGL0G02497g5.702ON1780211781.5
TPHA0J026605.453ON96886771.7
SAKL0G17380g4.324ON381100717.2
Smik_13.2002.590ON83793717.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14828g
         (836 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...  1204   0.0  
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   488   e-160
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   325   3e-98
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   234   6e-65
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   233   2e-64
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   231   9e-64
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   227   2e-62
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   218   6e-59
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   175   1e-44
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   172   2e-44
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   171   6e-44
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   165   2e-41
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   157   3e-39
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   153   8e-38
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   145   1e-35
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   130   1e-30
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...   100   3e-21
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    82   2e-15
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    65   5e-10
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    55   2e-07
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    54   2e-06
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    49   3e-05
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    45   5e-04
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...    38   0.12 
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    37   0.27 
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    35   0.90 
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...    35   1.2  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    35   1.5  
TPHA0J02660 Chr10 (588337..591243) [2907 bp, 968 aa] {ON} Anc_5....    34   1.7  
SAKL0G17380g Chr7 (1505539..1506684) [1146 bp, 381 aa] {ON} some...    32   7.2  
Smik_13.200 Chr13 complement(326426..328939) [2514 bp, 837 aa] {...    32   7.8  

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score = 1204 bits (3114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/836 (75%), Positives = 630/836 (75%)

Query: 1   MFKKRQDPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQSAYNSPFRTSQSLAAAQKRKMQ 60
           MFKKRQDPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQSAYNSPFRTSQSLAAAQKRKMQ
Sbjct: 1   MFKKRQDPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQSAYNSPFRTSQSLAAAQKRKMQ 60

Query: 61  KFPTXXXXXXXXXXXDMGYXXXXXXXXXXXXXXXPRYLQGNDERQRRRLDKLERKEDALK 120
           KFPT           DMGY               PRYLQGNDERQRRRLDKLERKEDALK
Sbjct: 61  KFPTVSASVSAHSSSDMGYKVIDAARRRAKDIAVPRYLQGNDERQRRRLDKLERKEDALK 120

Query: 121 YKKDSQRIVDVRGGQDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTQXXXXXXX 180
           YKKDSQRIVDVRGGQDR                                 HTQ       
Sbjct: 121 YKKDSQRIVDVRGGQDRAAGAAEDEGDVATDAEVEAAADAETEAEADAEAHTQTDAGADA 180

Query: 181 XXXXXXXXXXXXXXKDAEAVPATIDETPVSDTQDYVTPGAEAPDAESGIAEPETSAAIAE 240
                         KDAEAVPATIDETPVSDTQDYVTPGAEAPDAESGIAEPETSAAIAE
Sbjct: 181 GVAASTAESVAASTKDAEAVPATIDETPVSDTQDYVTPGAEAPDAESGIAEPETSAAIAE 240

Query: 241 SEVPAAIAVTETPVDGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNSKEVAV 300
           SEVPAAIAVTETPVDG                                    VNSKEVAV
Sbjct: 241 SEVPAAIAVTETPVDGAAAEPEVPVAAAAESEVPAALPSSETAGAEPTETATVNSKEVAV 300

Query: 301 GTAPDAASSVQKVPAGVDLXXXXXXXXXXXXXXXTEGKINADGVPEKPKDIKETPRVPFA 360
           GTAPDAASSVQKVPAGVDL               TEGKINADGVPEKPKDIKETPRVPFA
Sbjct: 301 GTAPDAASSVQKVPAGVDLVGEPAVAEAAGEQPATEGKINADGVPEKPKDIKETPRVPFA 360

Query: 361 TGIFALWTRSDKRGQPVASPNDPEFIVKFDKGYMSKALYDTLEYEEAIHKREMDDYTKEH 420
           TGIFALWTRSDKRGQPVASPNDPEFIVKFDKGYMSKALYDTLEYEEAIHKREMDDYTKEH
Sbjct: 361 TGIFALWTRSDKRGQPVASPNDPEFIVKFDKGYMSKALYDTLEYEEAIHKREMDDYTKEH 420

Query: 421 DAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSS 480
           DAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSS
Sbjct: 421 DAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSS 480

Query: 481 SKNVIFKETENMXXXXXXXXXXXXXXQEDVKTELEELEKLRAEIDAENREHQGRVDELTA 540
           SKNVIFKETENM              QEDVKTELEELEKLRAEIDAENREHQGRVDELTA
Sbjct: 481 SKNVIFKETENMKAAKVEEKEGVEAKQEDVKTELEELEKLRAEIDAENREHQGRVDELTA 540

Query: 541 ELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYL 600
           ELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYL
Sbjct: 541 ELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYL 600

Query: 601 PKLNAIDTKISELLTSLTVVKQETANHKTEFAAVSXXXXXXXXXXXXXXXXXXXXXXXXX 660
           PKLNAIDTKISELLTSLTVVKQETANHKTEFAAVS                         
Sbjct: 601 PKLNAIDTKISELLTSLTVVKQETANHKTEFAAVSKRLEEEDEERKEKLRQEEENRKRLE 660

Query: 661 AERLQKQREEHDQQILLLQQEHERQLAEASQKAAEHEQAXXXXXXXXXXXXXXXXXXXGE 720
           AERLQKQREEHDQQILLLQQEHERQLAEASQKAAEHEQA                   GE
Sbjct: 661 AERLQKQREEHDQQILLLQQEHERQLAEASQKAAEHEQALLKEREQRELVERERVKLQGE 720

Query: 721 KAIRXXXXXXXXXXXXXXXXXQRNHSRALALDGAEAAVQKSQKEITEQKKTPLLPASEQK 780
           KAIR                 QRNHSRALALDGAEAAVQKSQKEITEQKKTPLLPASEQK
Sbjct: 721 KAIREQEEAKAADKALEEEIKQRNHSRALALDGAEAAVQKSQKEITEQKKTPLLPASEQK 780

Query: 781 ETPLLPAPVQKETPLLPAPESAQPKALTNDNSSLYEYFTEKEIRTVNSSTSAFTKA 836
           ETPLLPAPVQKETPLLPAPESAQPKALTNDNSSLYEYFTEKEIRTVNSSTSAFTKA
Sbjct: 781 ETPLLPAPVQKETPLLPAPESAQPKALTNDNSSLYEYFTEKEIRTVNSSTSAFTKA 836

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  488 bits (1257), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 277/488 (56%), Positives = 329/488 (67%), Gaps = 21/488 (4%)

Query: 346 EKPKDIKETPRVPFATGIFALWTRSDKRGQPVASPNDPEFIVKFDKGYMSKALYDTLEYE 405
           +KPK+IK+TPRVPFATGIFALWTRSDKRGQPVASP+DPEFIVKFDKGYMSKALYDTLEYE
Sbjct: 318 QKPKNIKDTPRVPFATGIFALWTRSDKRGQPVASPDDPEFIVKFDKGYMSKALYDTLEYE 377

Query: 406 EAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEA 465
           EA+HK+EMD YTKE+  KY+AKA EYED LTSLKSQIAELEATME LQ DTT+KI IS A
Sbjct: 378 EAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAA 437

Query: 466 KLSAQMIDLNAEHSSSKNVIFKETENMXXXXXXXXXXXXXXQEDVKTELEELEKLRAEID 525
           +LSA+MI+ NA+HS++KNVIFKETEN               Q++VK E EELE  RAE D
Sbjct: 438 ELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEAD 497

Query: 526 AENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHG 585
           A N+E   R+DELT +LD+K +AIQELN QQAE+QASID L+QQKD L+++A AADE H 
Sbjct: 498 ATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHN 557

Query: 586 SNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKTEFAAVSXXXXXXXXXX 645
           SN+A+LE I NK+YLPK+NA+D++IS+LL+SL +VKQETAN  TEFAAVS          
Sbjct: 558 SNIAILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVSKRLEEENEER 617

Query: 646 XXXXXXXXXXXXXXXAERLQKQREEHDQQILLLQQEHERQLAEASQKAAEHEQAXXXXXX 705
                          AER QKQR+EHDQ +L LQQEHERQLAEASQKAA+ E        
Sbjct: 618 KEKLRLEEENRKRLEAERFQKQRDEHDQHVLTLQQEHERQLAEASQKAADTELLLQQERE 677

Query: 706 XXXXXXXXXXXXXGEKAIRXXXXXXXXXXXXXXXXXQRNHSRALALDGAEAAVQKSQKEI 765
                        GEKAI+                 +RNH+RA A+D AEAA  ++ K I
Sbjct: 678 KRELVERERVRLQGEKAIQEQEQAKLADKALEDEVKERNHNRAQAIDAAEAARARNAKSI 737

Query: 766 TEQKKTPLLPASEQKETPLLPAPVQKETPLLPAPESAQPKALTNDNSSLYEYFTEKEIRT 825
           +                P L  P + E   +        K  T DN SLYEYFTEKE+R 
Sbjct: 738 S------------NNNAPALSTPKEDEKLNI--------KDATTDN-SLYEYFTEKEVRY 776

Query: 826 VNSSTSAF 833
           VNS++S  
Sbjct: 777 VNSNSSLL 784

 Score =  164 bits (414), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 78/133 (58%), Positives = 93/133 (69%), Gaps = 1/133 (0%)

Query: 1   MFKKRQDPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQSAYNSPFRTSQSLAAAQKRKMQ 60
           MFKK+ DP EHLFQQ +P+  +  KGFL KVV+KEQE + Y+SPFRTSQS   AQKRK+Q
Sbjct: 1   MFKKKHDPFEHLFQQDQPK-KETSKGFLRKVVTKEQEDATYSSPFRTSQSQVEAQKRKVQ 59

Query: 61  KFPTXXXXXXXXXXXDMGYXXXXXXXXXXXXXXXPRYLQGNDERQRRRLDKLERKEDALK 120
           +FPT           +MG+               PRYLQGNDERQRRRLDKLERKED+L+
Sbjct: 60  RFPTVSASSGGNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQ 119

Query: 121 YKKDSQRIVDVRG 133
           YKKDSQ+IV V+G
Sbjct: 120 YKKDSQKIVKVKG 132

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  325 bits (832), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 206/503 (40%), Positives = 292/503 (58%), Gaps = 56/503 (11%)

Query: 341 ADGVPE---KPKDIKETPRVPFA--TGIFALWTRSDKRGQPVASPNDPEFIVKFDKGYMS 395
           ADG+     +P D  + PRVPF   TG+FALWTRSDK+ QP+A+P DPE+IV+ DKGYMS
Sbjct: 310 ADGLAHGLAQPIDPNKAPRVPFKAKTGVFALWTRSDKQDQPLATPQDPEYIVRTDKGYMS 369

Query: 396 KALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKD 455
           KA+YD LEY+E +H+ E+  + KE   KY+A   EY D+LT L+SQI EL+ATME L+ D
Sbjct: 370 KAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLD 429

Query: 456 TTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXXXXXXXXXXXXXQEDVKTELE 515
           T EKI++SE++LS +M+DLNA H SSKNVIFKETEN+               E+VK E+E
Sbjct: 430 TKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEIE 489

Query: 516 ELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDALIS 575
           EL  L+ ++DAE  E+Q ++D+LTA+LD+K+  IQELN +Q E+   I +L Q+K  + +
Sbjct: 490 ELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIET 549

Query: 576 EANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKTEFAAVS 635
           E   A+E H  +  +LESI+NKEYLPK+NAID++++ LL SLT++KQE AN KTEFAA++
Sbjct: 550 ETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAIT 609

Query: 636 XXXXXXXXXXXXXXXXXXXXXXXXXAERLQKQREE-----------HDQQILLLQQEHER 684
                                     ERLQKQREE           H++++  +++EHE+
Sbjct: 610 KRLEEERKAHEEKLRREEEERKRLEEERLQKQREELEAKAEDARLKHEEELRQIKEEHEK 669

Query: 685 QLAEASQKAAEHEQAXXXXXXXXXXXXXXXXXXXGEKAIRXXXXXXXXXXXXXXXXXQRN 744
            L +A+ + A+ ++                    GEKAI+                 ++ 
Sbjct: 670 ALNDANVQLAKEKEE-------REVVEREKTRLAGEKAIQEQERAQEADLALKQELMEKR 722

Query: 745 HSRALALDGAEAAVQKSQKEITEQKKTPLLPASEQKETPLLPAPVQKETPLLPAPESAQP 804
             +A A+D AE A     ++I+ QKK+            +L  P Q              
Sbjct: 723 RKQAEAVDAAEQA-----RKISTQKKS------------VLSNPSQN------------- 752

Query: 805 KALTNDNSSLYEYFTEKEIRTVN 827
             LT + SSLY+Y T +EI TV+
Sbjct: 753 --LTRE-SSLYDYETVEEIITVD 772

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (57%), Gaps = 8/137 (5%)

Query: 1   MFKKRQ--DPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQSA---YNSPFRTSQSLAAAQ 55
           +FKK+Q  DP  HL Q  +PQ       FL KVV+ ++++     Y+SPFR+ Q L AA+
Sbjct: 3   IFKKKQQVDPFAHLLQPEQPQ---EQPNFLRKVVTNKKKEEEEKDYSSPFRSQQELIAAK 59

Query: 56  KRKMQKFPTXXXXXXXXXXXDMGYXXXXXXXXXXXXXXXPRYLQGNDERQRRRLDKLERK 115
             K +KFPT           D+GY               PRYL+  DE+QR++LDKLE K
Sbjct: 60  NVKAKKFPTVSATSGTASAADLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFK 119

Query: 116 EDALKYKKDSQRIVDVR 132
           E+ L+Y KDSQ+IVDVR
Sbjct: 120 ENHLQYLKDSQKIVDVR 136

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  234 bits (598), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 130/360 (36%), Positives = 209/360 (58%), Gaps = 18/360 (5%)

Query: 348 PKDIKETPRVPF-------ATGIFALWTRSDKR----------GQPVASPNDPEFIVKF- 389
           P D  + P+VPF        TGIFALW  S               PVA+P  PE IVK  
Sbjct: 376 PIDPSKAPKVPFQERPRKGKTGIFALWKSSTSSSAQKSNTAAPSNPVATPEKPELIVKTK 435

Query: 390 DKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATM 449
           + GY+SKA+YD + Y+E +H+  + D      AKY+AK  EYE++L  L++QI E+E +M
Sbjct: 436 EHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSM 495

Query: 450 ETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXXXXXXXXXXXXXQED 509
           + ++K+T+EKIE+S+ +L  Q+ID+NA H++ K +IFK+TENM              Q +
Sbjct: 496 KAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTN 555

Query: 510 VKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQ 569
           VK++++EL   +  +  +  +    +  L+ +LDA++  I ++N +Q+++Q  ID L+Q+
Sbjct: 556 VKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQK 615

Query: 570 KDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKT 629
           K+AL+++    ++ H  NV VLES+EN+EYLP++N ID +IS LL  +T++KQE AN KT
Sbjct: 616 KNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKT 675

Query: 630 EFAAVSXXXXXXXXXXXXXXXXXXXXXXXXXAERLQKQREEHDQQILLLQQEHERQLAEA 689
           + +A++                            L+KQR+E ++Q    Q +HE Q+ + 
Sbjct: 676 QLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQARQAQLDHEEQITQV 735

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 62/144 (43%), Gaps = 21/144 (14%)

Query: 7   DPLEHLFQQSEPQTGDADKG--------FLHKVVSKE-QEQSAYNSPFRTSQSLAAAQKR 57
           DP   L  QS  + G + +         FL KVVS E + +  + SPFR   +LA+ Q  
Sbjct: 11  DPFTQLINQS-SENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQD-ALASKQNN 68

Query: 58  --------KMQKFPTXXXXXXXXXX--XDMGYXXXXXXXXXXXXXXXPRYLQGNDERQRR 107
                   K +KFPT             D+GY               P YL  N+ERQ +
Sbjct: 69  NRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQ 128

Query: 108 RLDKLERKEDALKYKKDSQRIVDV 131
            L +LE KE  L+Y K  Q+I D+
Sbjct: 129 LLTELELKEKHLQYLKKCQKITDL 152

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  233 bits (594), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 156/498 (31%), Positives = 246/498 (49%), Gaps = 58/498 (11%)

Query: 348 PKDIKETPRVPFA-------TGIFALW----TRSDKRG------QPVASPNDPEFIVKF- 389
           P D  + P+VPF        TG FALW    + S K+G       PVA+P +PE IVK  
Sbjct: 367 PIDPSKAPKVPFQERPQKERTGFFALWKSPTSSSAKKGAATAPLNPVATPENPELIVKTK 426

Query: 390 DKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATM 449
           + GY+SKA+YD + Y+E IH+  + D      AKY+AK  EY+++L  L++QI E+E +M
Sbjct: 427 EHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSM 486

Query: 450 ETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXXXXXXXXXXXXXQED 509
           + L+++T++KIE+++ +L  Q+ID+N EH++ K +IFK+TENM              Q +
Sbjct: 487 KQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTN 546

Query: 510 VKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQ 569
           VK+E++EL   ++ +  E  +    +  L+ +LDA++  I ++N +Q++ Q  ID+L++Q
Sbjct: 547 VKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQ 606

Query: 570 KDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKT 629
           K  LI++     + H  NV VLES+ENKEYLP++N IDT+IS LL  +T+++QE AN +T
Sbjct: 607 KKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERT 666

Query: 630 EFAAVSXXXXXXXXXXXXXXXXXXXXXXXXXAERLQKQREEHDQQILLLQQEHERQLAEA 689
             +A++                            L+KQR+E ++Q    + EHE Q+ + 
Sbjct: 667 HLSAITKKLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAELEHEEQITQV 726

Query: 690 SQ----KAAEHEQAXXXXXXXXXXXXXXXXXXXGEKAIRXXXXXXXXXXXXXXXXXQRNH 745
            +    +  E +                     GEKAI                   + H
Sbjct: 727 KKTYNDQLTELQDKLAAEEEELEAVKRERTKLQGEKAIEEQTRQKNADEILKQTILDKQH 786

Query: 746 SRALALDGAEAAVQKSQKEITEQKKTPLLPASEQKETPLLPAPVQKETPLLPAPESAQPK 805
            +A  L  AE  V      + E K+                               A PK
Sbjct: 787 KQATGLHAAENRVNTPSSNLQESKR-------------------------------AVPK 815

Query: 806 ALTNDNSSLYEYFTEKEI 823
                N SLYEY TE+++
Sbjct: 816 -----NDSLYEYHTEEDV 828

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 54/117 (46%), Gaps = 11/117 (9%)

Query: 27  FLHKVVSKE-QEQSAYNSPFRTSQSLAAAQKRKM-------QKFPTXXXXX--XXXXXXD 76
           FL KVVS E + +  + SPFR   +L+  Q  ++       +KFPT             D
Sbjct: 36  FLQKVVSNEPKGKEDWVSPFR-QDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQD 94

Query: 77  MGYXXXXXXXXXXXXXXXPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDVRG 133
           +GY               P YL  N+ERQ + L +LE KE  LKY K  Q+I D+ G
Sbjct: 95  LGYKNIPKDVKRAKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDLTG 151

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  231 bits (588), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 133/370 (35%), Positives = 215/370 (58%), Gaps = 19/370 (5%)

Query: 341 ADGVPEK-PKDIKETPRVPFA-------TGIFALW----TRSDKRG------QPVASPND 382
           A+ V +K P D  + P+VPF        TGIFALW    + S ++G       PVA+P +
Sbjct: 336 AESVEDKAPIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPEN 395

Query: 383 PEFIVKF-DKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQ 441
           PE IVK  + GY+SKA+YD + Y+E +H+  + D   +  AKY+A +  Y +RL  L++Q
Sbjct: 396 PELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQ 455

Query: 442 IAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXXXXXXXX 501
           I E+E +M+ ++K+T+EKIE+S+ +L  Q+ID+N  H++ K +IFK+TENM         
Sbjct: 456 IDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKD 515

Query: 502 XXXXXQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQA 561
                Q  VK+E++EL   +  +  E  +    +  L+ +LDA++  I ++N +Q+++Q 
Sbjct: 516 EVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQN 575

Query: 562 SIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVK 621
            ID LQ++K+ LI++     + H  NV  LES+ENKEYLP++N ID ++S LL  +T+++
Sbjct: 576 EIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIR 635

Query: 622 QETANHKTEFAAVSXXXXXXXXXXXXXXXXXXXXXXXXXAERLQKQREEHDQQILLLQQE 681
           QE AN KTE +A++                            L+KQR+E ++Q    Q +
Sbjct: 636 QENANEKTELSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLD 695

Query: 682 HERQLAEASQ 691
           HE+Q+ +  Q
Sbjct: 696 HEQQITQVKQ 705

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 62/143 (43%), Gaps = 18/143 (12%)

Query: 6   QDPLEHLFQQSEP-------QTGDADKGFLHKVVSKE-QEQSAYNSPFRTSQSLAAAQKR 57
           +DP   L  QS         Q  +    FL KVVS E + +  + SPFR   +L+  Q  
Sbjct: 10  EDPFTQLINQSSANAQNQREQQEEKPYQFLQKVVSNEPKGKEEWVSPFRQD-ALSRNQNN 68

Query: 58  KM-------QKFPTXXXXXXXXXX--XDMGYXXXXXXXXXXXXXXXPRYLQGNDERQRRR 108
           ++       +KFPT             D+GY               P YL  N+ERQ + 
Sbjct: 69  RLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTKNEERQYQL 128

Query: 109 LDKLERKEDALKYKKDSQRIVDV 131
           L +LE KE  LKY K+ Q+I D+
Sbjct: 129 LTELELKEKHLKYLKECQKITDL 151

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  227 bits (579), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 125/355 (35%), Positives = 209/355 (58%), Gaps = 18/355 (5%)

Query: 355 PRVPFA-------TGIFALW----------TRSDKRGQPVASPNDPEFIVKF-DKGYMSK 396
           P+VPF        TGIFALW          +++     PVA+P +PE IVK  + GY+SK
Sbjct: 360 PKVPFQEPSRKERTGIFALWKSPTSSSTQKSKTAAPSNPVATPENPELIVKTKEHGYLSK 419

Query: 397 ALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDT 456
           A+YD + Y+E IH+  + D   +   KY+AK  EY+++L  L++QI E+E +M+ ++++T
Sbjct: 420 AVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREET 479

Query: 457 TEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXXXXXXXXXXXXXQEDVKTELEE 516
           +EKIE+S+ +L  ++ID+NAEH++ K +I K+TENM              Q +VK+E+++
Sbjct: 480 SEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDD 539

Query: 517 LEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDALISE 576
           L   +  +  E  +    +  L+ +LDA++  I ++N +Q ++Q  ID+L+++K+ L+++
Sbjct: 540 LNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQ 599

Query: 577 ANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKTEFAAVSX 636
                + H  NV VLES+ENKEYLP++N ID +IS LL  +T++KQE AN KT+ +A++ 
Sbjct: 600 TEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAITK 659

Query: 637 XXXXXXXXXXXXXXXXXXXXXXXXAERLQKQREEHDQQILLLQQEHERQLAEASQ 691
                                      L+KQR+E ++Q    Q +HE+Q+ +  Q
Sbjct: 660 RLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQ 714

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 60/142 (42%), Gaps = 18/142 (12%)

Query: 7   DPLEHLFQQSEPQTGD-------ADKGFLHKVVSKE-QEQSAYNSPFRTSQSLAAAQKR- 57
           DP   L  QS   T +       +   FL KVVS E + +  + SPFR   +LA  Q   
Sbjct: 11  DPFTQLINQSSANTQNQQAHQQESPYQFLQKVVSNEPKGKEEWVSPFRQD-ALANRQNNR 69

Query: 58  ------KMQKFPTXXXXXXXXXX--XDMGYXXXXXXXXXXXXXXXPRYLQGNDERQRRRL 109
                 K +KFPT             D+GY               P YL  N+ERQ + L
Sbjct: 70  AYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLL 129

Query: 110 DKLERKEDALKYKKDSQRIVDV 131
            +LE KE  LKY K  Q+I D+
Sbjct: 130 TELELKEKHLKYLKKCQKITDL 151

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  218 bits (554), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 123/325 (37%), Positives = 195/325 (60%), Gaps = 37/325 (11%)

Query: 348 PKDIKETPRVPF------------------ATGIFALWTRSDK----------------- 372
           P DI   PRVPF                  A+G+FAL+ RS K                 
Sbjct: 379 PPDINSAPRVPFTPSGANKAGTAAATSGIAASGLFALFKRSKKPESSTKVAANAAAGTVV 438

Query: 373 --RGQPVASPNDPEFIVKFDKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANE 430
                PVA+P DPE IV+  +GY+SK++YD L+Y+E  H+ ++  Y+KE D +YE KA E
Sbjct: 439 PGDDAPVATPEDPELIVRTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQE 498

Query: 431 YEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETE 490
           YE+++ S++++IAEL+A ME ++ +  EK+++ + + S  +++ N +H ++K  ++K+TE
Sbjct: 499 YEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTE 558

Query: 491 NMXXXXXXXXXXXXXXQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQ 550
            +               + V++E++EL  L+ E+  EN+EH+ +V+ELTAELD K +A+ 
Sbjct: 559 EIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALN 618

Query: 551 ELNTQQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKI 610
           E   ++ E  A I  L+++K  L  E   A E H  NV+ +ESI+NKEYLPK+N I+T+I
Sbjct: 619 ESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEI 678

Query: 611 SELLTSLTVVKQETANHKTEFAAVS 635
           S LL SL +++QE AN K EF++V+
Sbjct: 679 SSLLASLGLIQQEIANQKVEFSSVT 703

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 68/152 (44%), Gaps = 16/152 (10%)

Query: 1   MFKKRQ--DPL-------EHLFQQSEPQTGDADKGFLHKVVSKEQEQ------SAYNSPF 45
           +F+KR   DP        +H  +Q +          L +V +K+Q+       + Y+SPF
Sbjct: 6   LFRKRNEIDPFAGLLDDADHAAEQQQQHDLTNSNSILKRVTTKQQQHQEELDDNEYHSPF 65

Query: 46  RTSQSLAAAQKRKMQKFPTXXXXXXXXXXXDMGYXXXXXXXXXXXXX-XXPRYLQGNDER 104
           RT++    A++ + +KFPT            MGY                P  L+  +  
Sbjct: 66  RTAEETQRARQVRQEKFPTLSQGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAE 125

Query: 105 QRRRLDKLERKEDALKYKKDSQRIVDVRGGQD 136
           Q+ RL  LE+KE  L+Y + SQ+IVD+   Q+
Sbjct: 126 QKVRLTALEKKEKQLRYWRKSQKIVDLTKPQE 157

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  175 bits (444), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 112/345 (32%), Positives = 179/345 (51%), Gaps = 11/345 (3%)

Query: 355 PRVPFATGIFALWTRSDKRGQ----PVASPNDPEFIVKFDK-GYMSKALYDTLEYEEAIH 409
           P V     IF+++ R  K       P+A+P +PE +VK D+ G++SKA+YD ++YE   H
Sbjct: 463 PEVEKKRSIFSIFGRKKKSQNRAPNPLATPENPEILVKTDREGFLSKAVYDKVKYENHKH 522

Query: 410 KREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSA 469
              + ++      +YE K  +Y++RL  LK ++ +LE +M+ ++ D  E IEI   +LS 
Sbjct: 523 SEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSK 582

Query: 470 QMIDLNAEHSSSKNVIFKETENMXXXXXXXXXXXXXXQEDVKTELEELEKLRAEIDAENR 529
           + ++   ++   KN IF ET+ +              QE+V+   +E+  L AE D  +R
Sbjct: 583 KFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQ---KEIAALNAEKDNIHR 639

Query: 530 EHQG---RVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHGS 586
           E  G   R+ + +A LDAK+ ++  L  +  + QA ID+L  +K  L  E  A  E H  
Sbjct: 640 EFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAK 699

Query: 587 NVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKTEFAAVSXXXXXXXXXXX 646
           N   +E   NKEYLPK++ ID KIS LL  L+V+KQE+AN K +  +++           
Sbjct: 700 NTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHE 759

Query: 647 XXXXXXXXXXXXXXAERLQKQREEHDQQILLLQQEHERQLAEASQ 691
                          + L KQREEH+     L+++HE +L +  Q
Sbjct: 760 EQLKLEAEERERKEKDLLGKQREEHEAVAAGLKKQHEEELRKMKQ 804

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 41  YNSPFRTSQSLAAAQKRKMQKFPTXXXXXXXXXX--XDMGYXXXXXXXXXXXXXXXPRYL 98
           + SPFR   +   A+KR++Q+FPT             ++GY               P YL
Sbjct: 69  FASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPIYL 128

Query: 99  QGNDERQRRRLDKLERKEDALKYKKDSQRIVD 130
           + N+ RQ + L ++E +E  L Y K+SQ + D
Sbjct: 129 RENEARQDQLLTEVEIREQKLAYIKNSQIVHD 160

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  172 bits (437), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 121/371 (32%), Positives = 184/371 (49%), Gaps = 17/371 (4%)

Query: 335 TEGKINADGVPEKPKDIKETPRVPFATGIFALWTRSD-----KRGQPVASPNDPEFIVKF 389
           +E +I+   V E P D    P VPF+       ++ +     K   PVASP + E IVK 
Sbjct: 222 SEEEIHTPNVVEPPIDPALAPMVPFSLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKT 281

Query: 390 DK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEAT 448
            + GY+SKA+YD ++Y+E  HK+ + DY  + + KYEAK  EY+  L  + +Q++EL   
Sbjct: 282 AQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDL 341

Query: 449 METLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXXXXXXXXXXXXXQE 508
           +E  + DT EKI++   +L  ++ D      + K  IF ET+ +                
Sbjct: 342 IEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNT 401

Query: 509 DVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQ 568
           +VK  ++EL   + ++ +E       +  + +ELDAKL  I ++N  Q  LQ  ID L  
Sbjct: 402 EVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTS 461

Query: 569 QKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHK 628
           QK+ L  E       H SNV ++ES++NKEYLPKLN ID +I+ LL  +T+VKQE AN K
Sbjct: 462 QKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEK 521

Query: 629 TEFAAVSXXXXXXXXXXXXXXXXXXXXXXXXXAERLQKQREE-----------HDQQILL 677
            + A ++                            L KQR+E           H Q+I  
Sbjct: 522 VQLAEITKKLEDERRAHEEQLQLEAEERKRQEENLLGKQRDELEAKANTMQVNHQQEIDA 581

Query: 678 LQQEHERQLAE 688
           L+ ++E +L E
Sbjct: 582 LKNDYETKLEE 592

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 71/166 (42%), Gaps = 34/166 (20%)

Query: 2   FKKRQDPLEHLFQQSE------------PQTGDADKGFLHKVVSKE----QEQ------- 38
           FK+R DP +HLF+++E            P+T  +   FL +VVS      Q+Q       
Sbjct: 8   FKRRDDPFDHLFEEAEAAEAAKHNTSMAPRTTSS---FLQRVVSTTSSTTQKQPKKKIAA 64

Query: 39  ------SAYNSPFRTSQSLAAAQKRKMQKFPTXXXXXXXXXXX--DMGYXXXXXXXXXXX 90
                 S Y SPFR   S    Q  K ++FPT               G+           
Sbjct: 65  SEAKAMSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAK 124

Query: 91  XXXXPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDVRGGQD 136
               P YL  N++RQ+  L  LE+KE  LKY +DSQ I+D+   Q+
Sbjct: 125 DIYFPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDLTKKQE 170

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  171 bits (434), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 166/286 (58%), Gaps = 12/286 (4%)

Query: 356 RVPFA---TGIFALWTRSDKRGQPVASPNDPEFIVKFDKGYMSKALYDTLEYEEAIHKRE 412
           R PF     GIFALW RS+K  +  A+P DPEFIV  +KGYMSK +YD LEYEE +H+ +
Sbjct: 298 RGPFKFSKKGIFALWKRSEKPEKLNATPEDPEFIVLTEKGYMSKNIYDRLEYEEELHQEK 357

Query: 413 MDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMI 472
           +    +   AKYE  A  YE++L SL ++IAE+ A M+ L+  T  +++  EA LS  ++
Sbjct: 358 LASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLM 417

Query: 473 DLNAEHSSSKNVIFKETENMXXXXXXXXXXXXXXQEDVKTELEELEKLRAEIDAENREHQ 532
           D+ A+H   K  + KE EN                  V+ ELE L++L  E   E +++Q
Sbjct: 418 DIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPELEALKRLELERKVELQQYQ 477

Query: 533 GRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDAL---ISEANAADEQHGSNVA 589
             V  LTAELDA+L  +Q ++ +Q E+  S+  L++++  +   ISE+NA      +N  
Sbjct: 478 SEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAV---VANNKE 534

Query: 590 VLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKTEFAAVS 635
           +L+++EN    P + A+D ++SE+  +++ V+QE A  K E   +S
Sbjct: 535 LLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELS 577

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 66/146 (45%), Gaps = 23/146 (15%)

Query: 1   MFKKRQ--DPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQ------------SAYNSPFR 46
           +FKK +  DP + L    E + G  +  F+ KV +  +                Y SPFR
Sbjct: 4   IFKKNKQPDPFKELLDNEEDKHGTTEL-FVKKVTNHRKASEDDGTQGNVEGGGEYVSPFR 62

Query: 47  TSQSLAAAQKRKMQKFPTXXXXXXXXXXXDMGYXXXXXXXXXXXXXXXPRYLQGNDERQR 106
             +++A A++ +  KFPT           ++                 PR     D +Q+
Sbjct: 63  DDKAVAEAERIRDLKFPTTGHHSTVRVKDNV--------KRKAQDIAEPRSFGTTDLKQQ 114

Query: 107 RRLDKLERKEDALKYKKDSQRIVDVR 132
           ++LD+L  KE+ L+Y ++SQ+IVDVR
Sbjct: 115 KQLDELGMKENQLEYLRNSQKIVDVR 140

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  165 bits (417), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 114/365 (31%), Positives = 183/365 (50%), Gaps = 24/365 (6%)

Query: 346 EKPKDIKETPRVPF------ATGIFALWTRSDKRGQPV-----------------ASPND 382
           E P+   + PR+P+           + + R+D  G PV                 A+P +
Sbjct: 365 ETPQPYDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPEN 424

Query: 383 PEFIVKFDK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQ 441
           PE I K ++ GYMSK +YD + Y+E  H+R +  + K   AKY+ K  EY + L  L+ +
Sbjct: 425 PELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKE 484

Query: 442 IAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXXXXXXXX 501
           I  +  +ME L+K+T +KIE+SE  L  ++ + N  H+  KN IFKETEN+         
Sbjct: 485 IDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQKIQQKK 544

Query: 502 XXXXXQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQA 561
                   V+ E+ +L   + E+  E  +    +  L  +LDAK+  + ++  +Q E Q 
Sbjct: 545 EILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQK 604

Query: 562 SIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVK 621
            I+ L+ QK    ++ +AA ++H     V+ES ENKEYLPK++ ID +ISELL  L ++K
Sbjct: 605 EIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIK 664

Query: 622 QETANHKTEFAAVSXXXXXXXXXXXXXXXXXXXXXXXXXAERLQKQREEHDQQILLLQQE 681
           QE AN +TE + ++                            L+KQR E +++    ++E
Sbjct: 665 QENANEQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEKAEQQKRE 724

Query: 682 HERQL 686
           HE Q+
Sbjct: 725 HEEQV 729

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 4/97 (4%)

Query: 37  EQSAYNSPFRTSQSLAAAQKRKMQKFPTXXXXXXXXXX--XDMGYXXXXXXXXXXXXXXX 94
           EQ    +PF  +   A  +  K  KFPT             ++G+               
Sbjct: 100 EQKIAVNPF--TNKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKF 157

Query: 95  PRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDV 131
           P YL  N+ RQ+  L +LE KE  L+Y KDSQ+I+D+
Sbjct: 158 PVYLTENEFRQQTILKELELKEGKLQYLKDSQKIIDL 194

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  157 bits (397), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 147/254 (57%)

Query: 382 DPEFIVKFDKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQ 441
           +PE +VK   GY++K +YD +  ++  H   +  Y K+   K++ K  E   ++ SL++Q
Sbjct: 347 NPEHVVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQ 406

Query: 442 IAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXXXXXXXX 501
           I E++  M  L+ DT  KIE+SE +L+ +  ++   H   KN +FK+TE +         
Sbjct: 407 IKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKD 466

Query: 502 XXXXXQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQA 561
                Q +V+ E++EL   + +++ E ++    ++EL+A +DAK+A ++E+N +Q   Q 
Sbjct: 467 SVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNTQE 526

Query: 562 SIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVK 621
            I+ LQQQK  ++ +    +  H  N  V+E  +NK YLPKLN +D +IS LL  LT ++
Sbjct: 527 EINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIR 586

Query: 622 QETANHKTEFAAVS 635
           Q  AN +TE +A++
Sbjct: 587 QHCANERTELSAIT 600

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 59/129 (45%), Gaps = 5/129 (3%)

Query: 1   MFK-KRQDPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQSAYNSPFRTSQSLAAAQKRKM 59
           MFK KR DP    +  +  Q  D ++    K   ++  +  Y SPFR  Q + +AQ+R+ 
Sbjct: 1   MFKQKRSDPFAQYW--AGDQAKDVEEQQKKKKEEEDVGERDYVSPFRDEQEVLSAQRRRT 58

Query: 60  QKFPTXXXXXXXXXXX--DMGYXXXXXXXXXXXXXXXPRYLQGNDERQRRRLDKLERKED 117
           Q+FPT             ++GY               P YL+  +++Q   L +LE KE 
Sbjct: 59  QRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVYLEEIEKKQLELLRELEVKEA 118

Query: 118 ALKYKKDSQ 126
            L+Y KD Q
Sbjct: 119 HLRYLKDCQ 127

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  153 bits (386), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 100/341 (29%), Positives = 183/341 (53%), Gaps = 12/341 (3%)

Query: 360 ATGIFALWT-RSDKRGQPVA-----SPNDPEFIVKFDK-GYMSKALYDTLEYEEAIHKRE 412
           +TGI A++   S    QPV+     SP +PE+++K  + GY+SKA+YD ++Y++++H+R 
Sbjct: 334 STGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRW 393

Query: 413 MDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMI 472
           +D+     + KY+ K  EYED L  ++S+I  +   M+ L+  T++KIE+ E +L   ++
Sbjct: 394 LDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNIL 453

Query: 473 DLNAEHSSSKNVIFKETENMXXXXXXXXXXXXXXQEDVKTELEELEKLRAEIDAENREHQ 532
           D+   H+ SKN IFKETE M              Q +++ E+E L + +  +  +  E  
Sbjct: 454 DMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWN 513

Query: 533 GRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLE 592
            +++E+TA+LDAK+  I+  N Q+ +++  +  L   K  L  E    +E H +N  +L 
Sbjct: 514 SKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELLT 573

Query: 593 SIE-NKEYLPKLNAIDTKISELLTSLTVVKQETANHKTEFAAVSXXXXXXXXXXXXXXXX 651
            +   K YLP++N ID +I+  L  L+ +K+ET         ++                
Sbjct: 574 DLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEIRL 633

Query: 652 XXXXXXXXXAERLQKQREE----HDQQILLLQQEHERQLAE 688
                     ++LQKQ  E    H++++L +Q+++E+++A+
Sbjct: 634 KNEKLKREQEQKLQKQLAELKAKHNEELLEIQKKYEKKMAQ 674

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  145 bits (367), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 145/503 (28%), Positives = 222/503 (44%), Gaps = 43/503 (8%)

Query: 340 NADGVP-EKPKDIKETPRVPFATGIFALWTRS----------DKRGQPVASPNDPEFIVK 388
           NA+  P EKP D K TP V F      +  ++          +K   P A+PN  E IVK
Sbjct: 181 NAEKPPLEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVK 240

Query: 389 FDK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEA 447
             K G +SK++YD L+Y++  H++ +  Y  E   KY+ K  EYE+ L SL  +I     
Sbjct: 241 TKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVASNE 300

Query: 448 TMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXXXXXXXXXXXXXQ 507
            +E  +KDT  K++I  A+L  +M D  +  +  K  IF ET+ +               
Sbjct: 301 LIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELD 360

Query: 508 EDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQ 567
           + V  E+++L K + ++  E  E    +  +  +LDAKL  I+++N  Q  LQ  ID L 
Sbjct: 361 DQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLN 420

Query: 568 QQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANH 627
            +K  L  E  A    H +NV  +E+++NK+YLPKLN ID++I++LL  LT++KQE AN 
Sbjct: 421 NEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANE 480

Query: 628 KTEFAAVSXXXXXXXXXXXXXXXXXXXXXXXXXAERLQKQREEHDQQILLLQQEHERQLA 687
           K + + ++                            L KQREE +Q+   LQ  HE ++ 
Sbjct: 481 KIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMT 540

Query: 688 EAS----QKAAEHEQAXXXXXXXXXXXXXXXXXXXGEKAIRXXXXXXXXXXXXXXXXXQR 743
                  Q+ A+ +                     G KAI                   +
Sbjct: 541 NLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSK 600

Query: 744 NHSRALALDGAEAAVQKSQKEITEQKKTPLLPASEQKETPLLPAPVQKETPLLPAPESAQ 803
            H +A A +  + A          QKK    P +E          + KE+  +PA   A+
Sbjct: 601 QHQQAEAYNAVQLA----------QKKKNASPVAED---------LMKESH-IPALSKAK 640

Query: 804 PKALTNDNSSLYEYFTEKEIRTV 826
                  + SL+EY TE+EI  V
Sbjct: 641 -------DDSLFEYETEEEIMYV 656

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 65/156 (41%), Gaps = 28/156 (17%)

Query: 4   KRQDPLEHLFQQSEPQTGDADKG-------FLHKVVS----------------KEQEQSA 40
           K+ DP EHL       TG +D         FL +V+S                K+     
Sbjct: 8   KKNDPFEHLLNPQPKTTGSSDSSRPRSSSLFLQRVISSTSSIQKTPTTSSSSKKKVSTEE 67

Query: 41  YNSPFRT---SQSLAAAQKRKMQKFPTXXXXXX--XXXXXDMGYXXXXXXXXXXXXXXXP 95
           Y SPFR+   + + A  Q  K ++FPT             +MG+               P
Sbjct: 68  YLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFFP 127

Query: 96  RYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDV 131
            YL  N++RQ+  L KL + E  L+YKKDSQ I+D+
Sbjct: 128 SYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDL 163

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  130 bits (326), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 94/321 (29%), Positives = 157/321 (48%), Gaps = 9/321 (2%)

Query: 377 VASPNDPEFIVKFDK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRL 435
           VASP +PE++V+ ++   +SKA+YD + YE+ +H   + ++    D KY  K  EYED+L
Sbjct: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374

Query: 436 TSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXX 495
             L+ Q+ ++E   +       +KIEI E +L   ++D+ ++++  K  + KETE M   
Sbjct: 375 VELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434

Query: 496 XXXXXXXXXXXQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQ 555
                      Q DVK E+E+L   +  I  E     G ++ LT  LD K+A I+ +N  
Sbjct: 435 KINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494

Query: 556 QAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIE-NKEYLPKLNAIDTKISELL 614
              +Q  I+ LQ +K  L +E    +E+   N  VL+ +   K+YLP+LN ID +I+   
Sbjct: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554

Query: 615 TSLTVVKQETANHKTEFAAVSXXXXXXXXXXXXXXXXXXXXXXXXXAERLQKQREEHDQQ 674
             L ++K ET +   + + ++                          E LQK+  E    
Sbjct: 555 DKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLTE---- 610

Query: 675 ILLLQQEHERQLAEASQKAAE 695
              LQ++H  ++AE  +K  E
Sbjct: 611 ---LQEKHNEEMAEIQKKYQE 628

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 49/108 (45%), Gaps = 5/108 (4%)

Query: 27  FLHKVVSKEQEQSAYNSPFRTSQSLA---AAQKRKMQKFPTXXXXXXXXXXX--DMGYXX 81
           FL + +S++ E + Y SPFR  Q       A+  K +KFPT             +MGY  
Sbjct: 23  FLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSS 82

Query: 82  XXXXXXXXXXXXXPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIV 129
                        P+YL  N++RQ + L +L+ KE  L   + S R++
Sbjct: 83  LAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score =  100 bits (250), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 134/259 (51%)

Query: 376 PVASPNDPEFIVKFDKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRL 435
           P  +P +PE ++  ++GYMSKA+YD L  EE  H   + +  ++    Y+  +  YE  +
Sbjct: 279 PNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEI 338

Query: 436 TSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXX 495
             L ++I++L A +  LQ +T  +I+  EA LS  + D+ AE++  ++V+ ++ E     
Sbjct: 339 ADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHEQAEAQRAE 398

Query: 496 XXXXXXXXXXXQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQ 555
                       ++++ E++ L KL+     E  E Q R+D+L  +LDA+   ++ +  Q
Sbjct: 399 QLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQ 458

Query: 556 QAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLT 615
           QAE+   +  LQ+QK  L  E   ++E    N   LE +   +Y   +  ID K SE+LT
Sbjct: 459 QAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILT 518

Query: 616 SLTVVKQETANHKTEFAAV 634
            +  ++QE    + E  A+
Sbjct: 519 EIAKIRQEIEFQRKELVAL 537

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 59/133 (44%), Gaps = 19/133 (14%)

Query: 4   KRQDPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQSAYNSPFRTSQSLAAAQKRKMQKFP 63
           K++DP E L Q   P TG A        V+ +     Y SPFR + ++  A      KFP
Sbjct: 26  KKKDPTEFLRQSHHPPTGGA-------AVTGDASHDEYYSPFRDAIAVEEAHGSGTLKFP 78

Query: 64  TXXXXXXXXXXXDMGYXXXXXXXXXXXXXXXPRYLQGNDERQRRRLDKLERKEDALKYKK 123
           T             G                P+ L   DERQR++L +LE KE  L+  K
Sbjct: 79  T------------TGTHVTEEARRRVPDIDEPKRLSTVDERQRQQLQELELKEGQLRLYK 126

Query: 124 DSQRIVDVRGGQD 136
           +SQ+IVDVRG  D
Sbjct: 127 ESQKIVDVRGKSD 139

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 127/263 (48%), Gaps = 3/263 (1%)

Query: 376 PVASPNDPEFIVKFDK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDR 434
           P A+ + PE ++K  K G++S A+++ + Y++ +HK EM DY +E ++K+  K  EYE +
Sbjct: 298 PQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQK 357

Query: 435 LTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXX 494
           L  +  +   + A M   + D   K E+ E +   Q+ D NA  + SK  +  E + +  
Sbjct: 358 LAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKL 417

Query: 495 XXXXXXXXXXXXQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNT 554
                       +  ++ E+ +L   ++  + +       +  +T  LDA+L  + + N 
Sbjct: 418 QKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNH 477

Query: 555 QQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLP--KLNAIDTKISE 612
           +Q ++   I DL Q+K  L +E +A     G+    L  +E  ++L   +L  +   I  
Sbjct: 478 KQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQG 537

Query: 613 LLTSLTVVKQETANHKTEFAAVS 635
            L SL VVKQE +  + +   ++
Sbjct: 538 KLDSLAVVKQEISGERLKLIGIT 560

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 8/97 (8%)

Query: 41  YNSPFRTSQSLAAAQKRKMQ-----KFPTXXXXX--XXXXXXDMGYXXXXXXXXXXXXXX 93
           Y SPFR  Q L  A K+++Q     KFPT             ++G+              
Sbjct: 48  YVSPFRGGQ-LTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106

Query: 94  XPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVD 130
            P YL  N++RQR  L  LE++E  L + +  Q ++D
Sbjct: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLD 143

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 123/268 (45%), Gaps = 22/268 (8%)

Query: 376 PVASPNDPEFIVKFDKGY-MSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDR 434
           PVASP + E +VK   G  +SK +YD +E++  ++ + +  Y  +   K     +EY ++
Sbjct: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306

Query: 435 LTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMXX 494
           + S++ +  +    +E L  ++    E+ + KL   ++D  A  S +K  I ++T  +  
Sbjct: 307 IKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366

Query: 495 XXXXXXXXXXXXQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNT 554
                       +  ++ E   +   +             ++E+  ELDAKL  + + N 
Sbjct: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426

Query: 555 QQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLP-------KLNAID 607
           +   L+  I+ LQ +K  L+ E              ++SIE K+  P       +LN +D
Sbjct: 427 RNENLEHEINKLQSKKQTLLDE--------------IDSIEYKKLHPDDDSKQLELNEMD 472

Query: 608 TKISELLTSLTVVKQETANHKTEFAAVS 635
            +I+  L++L ++KQE  N K + + ++
Sbjct: 473 EQINSKLSNLNLIKQEIINEKLKISKLT 500

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 51/114 (44%), Gaps = 10/114 (8%)

Query: 27  FLHKVV---SKEQE-QSAYNSPFRTSQSLAAAQKRKMQ-----KFPTXXXXXXXXXXXDM 77
           FL KV    SKE + ++ YNSPFR +   +  QK+++Q     KFP              
Sbjct: 33  FLSKVNTNKSKENDDENKYNSPFRNNAP-SREQKKQLQDLKTAKFPLVSATSTYNTDTKD 91

Query: 78  GYXXXXXXXXXXXXXXXPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDV 131
            Y               P  L  N+ RQ + L  L+ K+DAL   KDS +++DV
Sbjct: 92  VYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 80/160 (50%), Gaps = 10/160 (6%)

Query: 339 INADGVPEKPKDIKETPRVPFATGIFALWTRSDKRGQPVASPNDPEFIVKF------DKG 392
           +  + V  +P DI++ P++P++   +     ++ R  PVA+P  PE +V +      +K 
Sbjct: 87  VEKEDVVREPVDIQKVPKIPYSE--YGQCNEAEFRN-PVATPETPEEVVIYKHLNGTNKA 143

Query: 393 YMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETL 452
           Y SK ++D ++ +   H   +     + + +   K  EY  +L  L  QI   +A M  L
Sbjct: 144 Y-SKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNL 202

Query: 453 QKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENM 492
           ++     I+++E +L+   +    + ++ KN I+KETE +
Sbjct: 203 RRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKETERL 242

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 96/207 (46%), Gaps = 27/207 (13%)

Query: 375 QPVASPNDPEFIVKF----DKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANE 430
            P A+P +PE +VK     +   +SK++YD + Y   +H + + DY  + + KY+ K  E
Sbjct: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEE 435

Query: 431 YED-------RLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKN 483
           + +       ++ S++  I + +A +++L  D  EK +I       +M+         KN
Sbjct: 436 FNNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYHEKML-------IKKN 488

Query: 484 VIFKETENMXXXXXXX--XXXXXXXQEDVKTELEELEKLRAEIDAENREHQGRVDELTAE 541
            I K+ + +                 +D  T+  +   L  +  +E    Q +++E   +
Sbjct: 489 QIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSE----QSKLNE---Q 541

Query: 542 LDAKLAAIQELNTQQAELQASIDDLQQ 568
           +D+K+  I++LN   A+++  I +L +
Sbjct: 542 IDSKVNVIKQLNKNLADVKQKITELSE 568

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 75/152 (49%), Gaps = 18/152 (11%)

Query: 344 VPEKPKDIKETPRVPFATGIFALWTRSDKRGQPVASPNDPEFIVKFDKG-----YMSKAL 398
           + EKP +I   P++P          +  +    +A+P + E ++   K      Y SK +
Sbjct: 152 IIEKPINIYSVPKIPSYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLLYYFSKEV 211

Query: 399 YDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTE 458
           +D ++YE  IH  ++     + D ++ +K NEY+ ++++L ++I ++E           E
Sbjct: 212 FDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKI-DIE----------NE 260

Query: 459 KIEISEAKLSAQMIDLNAEHSSSKNVIFKETE 490
           KI    +K+S    D  ++  S+KN +FK TE
Sbjct: 261 KIRKLNSKIS-HFKDF-SDFKSTKNYLFKMTE 290

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 26/37 (70%)

Query: 95  PRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDV 131
           PR L+ N+E Q   L++L+ KE+ LK+ KDSQ +V +
Sbjct: 101 PRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYI 137

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 2/101 (1%)

Query: 376 PVASPNDPEFIVKF--DKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYED 433
           P+A+  +PE ++K   DK  ++K  YD L      H   M +   E    Y  K   Y++
Sbjct: 384 PIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQE 443

Query: 434 RLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDL 474
           +L  L  QI      +  ++KDT +  E+++A L+ +   L
Sbjct: 444 KLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQL 484

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 83/180 (46%), Gaps = 16/180 (8%)

Query: 404 YEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIE-- 461
           + E  HK +++  T   +A+     +EY  +L +LK    E     E  + +  EKIE  
Sbjct: 138 FLEESHKLKLEQLTANKNAELNKMNDEYRSKLEALK---YEKIKKFENEKNELIEKIEEI 194

Query: 462 -----ISEAKLSAQMIDLNAEHSSSKNVIFKETENMXXXXXXXXXXXXXXQEDVKTELEE 516
                 ++  L  +M D+ A+H   K    K+ +                 +++K+E+E 
Sbjct: 195 RNKMITNDVALQQRMKDIEADHLEEKEKWLKDYQKEWREVTEKNQESIRKTKELKSEIET 254

Query: 517 LEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDALISE 576
           +  L   ID +N+    R++EL +E+      +Q  N Q  E++ +ID  +++KD L++E
Sbjct: 255 V--LTPRIDTQNK----RLEELKSEIKKLDDTLQNKNEQVGEIRKNIDLEREKKDKLLAE 308

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 376 PVASPNDPEFIVKFDKG---YMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYE 432
           P+A+P +PE +V+  +     +SK  YD L   ++ H   +  Y  E+ A Y  +   Y+
Sbjct: 180 PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQ 239

Query: 433 DRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLN 475
            ++  L  +I   +     L+ D     EI++ K   +   +N
Sbjct: 240 KQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQIN 282

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%)

Query: 95  PRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIV 129
           P +L+G +E+Q+  L  L+ KE  L+  K+SQRI+
Sbjct: 99  PEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII 133

>KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {ON}
           Anc_8.604 YOR195W
          Length = 732

 Score = 35.0 bits (79), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 88/175 (50%), Gaps = 25/175 (14%)

Query: 422 AKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSS 481
           AK E K ++  + + SL+ +  EL+  +E ++ D   ++ I E+K+SA    LN E  SS
Sbjct: 403 AKEENKNSDLLNEVNSLQEERKELQKKLEKIELDKENEVSILESKISA----LN-ETISS 457

Query: 482 KNVIFKETENMXXXXXXXXXXXXXXQEDVKTELE-ELEKLRAEIDAENREHQGRVDELTA 540
                KE EN+                  KT LE +L  L+++ +  N     R  E+T 
Sbjct: 458 LQSCQKEIENLNS---------------TKTNLENDLTALKSKFEEVNDNSSIRTAEVT- 501

Query: 541 ELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIE 595
           EL++++ +++E N Q  EL + +D   ++ + L SE+   DE++      LESI+
Sbjct: 502 ELNSQIESLRESNDQLQELNSKLD---EEIEILKSESLKQDEEYKKVSIELESIQ 553

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
           YFL008W
          Length = 1219

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 52/91 (57%), Gaps = 14/91 (15%)

Query: 530 EHQGRV---DELTAEL-----DAKLAAIQ--ELNTQQAELQASIDDLQQQKDALISEANA 579
           E+QG V   D+L  ++     ++K  AI+  +L +  ++L +SI DL+ Q    IS+ N 
Sbjct: 675 EYQGLVTLKDKLLIQIEQLSNNSKTFAIEARDLESNISQLNSSISDLRTQ----ISQINR 730

Query: 580 ADEQHGSNVAVLESIENKEYLPKLNAIDTKI 610
           + E++ + V   E +  KEY PK N ++TK+
Sbjct: 731 SIEENKAEVQYHEDMLKKEYEPKQNQLNTKL 761

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 90/211 (42%), Gaps = 45/211 (21%)

Query: 405  EEAIHKRE---MDDYTKEHDAKYEAK---------ANEYEDRLTSLKSQIAELEATMETL 452
            EE I K +   +DDYTK  +   E K          NE  DR   LK Q  E   T + L
Sbjct: 1306 EEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKEL 1365

Query: 453  QKDTTEKIE--ISEAKLSAQMIDLNAEHSS---SKNVIFKETENMXXXXXXXXXXXXXXQ 507
            Q    E+I   ISE     + +D+  E +S   S+   F+E +N                
Sbjct: 1366 QSSLQEQISNLISEKDDIRKQLDVKTEENSELLSELNNFREKQN---------------- 1409

Query: 508  EDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQ 567
                    +LE LR E++ E  + +    +L  E+++   A +  N +  ELQ  IDDL+
Sbjct: 1410 --------DLETLREELNKEISKSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLK 1461

Query: 568  QQKDALISEANAADEQHGSNV-AVLESIENK 597
             Q   L + +  ADEQ   NV A+    EN+
Sbjct: 1462 TQ---LAANSTDADEQTNRNVEAIKREFENQ 1489

>TPHA0J02660 Chr10 (588337..591243) [2907 bp, 968 aa] {ON} Anc_5.453
           YDR379W
          Length = 968

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 404 YEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKD--TTEKIE 461
           Y   I   E+  Y        ++K NE E+RL+ L+  I ELE     LQKD  T E+ +
Sbjct: 566 YSAVITDFEISKYDTSQTKSIQSKINEAEERLSMLQLNIEELELKKSQLQKDIRTLERTK 625

Query: 462 ISEAKLSAQMIDLN---AEHSSSKNV 484
            +  K +  + + N   +E+S+ KN+
Sbjct: 626 STMMKSTIPISNTNGSSSENSNQKNI 651

>SAKL0G17380g Chr7 (1505539..1506684) [1146 bp, 381 aa] {ON} some
           similarities with uniprot|P33441 Saccharomyces
           cerevisiae YML062C MFT1 Subunit of the THO complex which
           is a nuclear complex comprised of Hpr1p Mft1p Rlr1p and
           Thp2p that is involved in transcription elongation and
           mitotic recombination
          Length = 381

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 16/100 (16%)

Query: 535 VDELTAELDAKLAAIQELNTQQA-------ELQASIDDLQQQKDALISEANAADEQHGSN 587
           V+ + AE+DAKL  IQ+LN++          L + ID+   Q++ L+S ++  D      
Sbjct: 92  VERIKAEMDAKLPIIQDLNSELMLRNKRLEALNSDIDEFNLQQEKLVSSSSNLDAYRKD- 150

Query: 588 VAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANH 627
               E    K+ L KL A     +++ TS +VV  E   H
Sbjct: 151 ---WEEALGKDLLEKLIA-----AKVFTSRSVVIHEADGH 182

>Smik_13.200 Chr13 complement(326426..328939) [2514 bp, 837 aa] {ON}
           YMR031C (REAL)
          Length = 837

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 6/93 (6%)

Query: 383 PEFIVKFDKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQI 442
           PE I K   G +S  L +  E  EA  +R MD+   E    Y    NE+E    S+ S  
Sbjct: 387 PEDITKIASGLISPVLGEVSERAEA--QRAMDEEIAERTEAYSNSLNEWESMERSMISND 444

Query: 443 AELEATM----ETLQKDTTEKIEISEAKLSAQM 471
           A++  T     +T +K T EK++ S   L A+M
Sbjct: 445 AKILTTTANRQQTEKKVTQEKVKASYDALVARM 477

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.123    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,755,012
Number of extensions: 2202621
Number of successful extensions: 14141
Number of sequences better than 10.0: 599
Number of HSP's gapped: 14070
Number of HSP's successfully gapped: 946
Length of query: 836
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 718
Effective length of database: 39,950,811
Effective search space: 28684682298
Effective search space used: 28684682298
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 70 (31.6 bits)