Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14806g3.491ON35835817590.0
Kwal_55.212273.491ON37637613630.0
SAKL0F02794g3.491ON39739811271e-153
TDEL0D055903.491ON3443579501e-127
KLLA0E04621g3.491ON3893889231e-122
Ecym_12383.491ON3933908991e-119
YPR148C3.491ON4354369021e-119
ZYRO0D10010g3.491ON3823868941e-118
AFR309C3.491ON3643688341e-109
Skud_16.4433.491ON4204228361e-109
Kpol_1017.73.491ON3783847871e-102
TBLA0D029803.491ON4434167921e-102
Suva_16.4773.491ON4234317831e-101
TPHA0D032703.491ON3884037172e-91
Smik_16.4013.491ON4272967151e-90
CAGL0L08492g3.491ON3854016692e-84
NDAI0B058503.491ON4732986059e-74
NCAS0F035403.491ON4442605942e-72
KAFR0G036803.491ON4152785094e-60
KNAG0A079303.491ON4522794802e-55
TDEL0H022407.221ON3383472432e-22
Kwal_47.181487.221ON3233302413e-22
SAKL0F08162g7.221ON3303242413e-22
Kpol_1070.197.221ON3113492316e-21
NDAI0A026607.221ON3643312283e-20
KLTH0A03894g7.221ON3232912221e-19
ZYRO0D16522g7.221ON3583082222e-19
CAGL0L00891g7.221ON3413442194e-19
TPHA0C012307.221ON3053432175e-19
KNAG0D017607.221ON3422962185e-19
NCAS0A133807.221ON3293402151e-18
KLLA0E04511g7.221ON3023532131e-18
KAFR0I019507.221ON3303502123e-18
ADL115W7.221ON3332952071e-17
Suva_9.1597.221ON3253382053e-17
TBLA0D042007.221ON3313611973e-16
Ecym_43777.221ON3333451963e-16
Smik_9.1507.221ON3263211946e-16
YIL041W (GVP36)7.221ON3263211893e-15
Kpol_478.227.221ON3502911861e-14
Skud_9.1287.221ON3292031841e-14
TBLA0B015807.221ON3862211762e-13
TPHA0B027507.221ON3633001638e-12
NDAI0D031304.340ON149561722.0
KLLA0F19096g8.260ON292367703.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14806g
         (358 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   682   0.0  
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   529   0.0  
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   438   e-153
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   370   e-127
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   360   e-122
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   350   e-119
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   352   e-119
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   348   e-118
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   325   e-109
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   326   e-109
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   307   e-102
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   309   e-102
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   306   e-101
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   280   2e-91
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   280   1e-90
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   262   2e-84
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   237   9e-74
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   233   2e-72
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   200   4e-60
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   189   2e-55
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    98   2e-22
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    97   3e-22
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    97   3e-22
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    94   6e-21
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     92   3e-20
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    90   1e-19
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    90   2e-19
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    89   4e-19
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    88   5e-19
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    89   5e-19
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    87   1e-18
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    87   1e-18
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    86   3e-18
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    84   1e-17
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    84   3e-17
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    80   3e-16
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    80   3e-16
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    79   6e-16
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    77   3e-15
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    76   1e-14
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    75   1e-14
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    72   2e-13
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    67   8e-12
NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4....    32   2.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...    32   3.6  

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/358 (93%), Positives = 334/358 (93%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60
           MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60

Query: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120
           EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL
Sbjct: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 121 FGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAXXXXX 180
           FGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASA     
Sbjct: 121 FGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAEEDEE 180

Query: 181 XXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVED 240
              ITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVED
Sbjct: 181 DEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVED 240

Query: 241 SRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKLEDE 300
           SRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQ                QKLLEKLEDE
Sbjct: 241 SRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQEDEAEASKDSDSSDEAQKLLEKLEDE 300

Query: 301 FVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEGDEA 358
           FVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEGDEA
Sbjct: 301 FVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEGDEA 358

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/376 (70%), Positives = 298/376 (79%), Gaps = 18/376 (4%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60
           MS+YFGGFS NKLT+++TN AHKTQDTLSTAIANIQLDDPQA LSLKARKHYLQETLGTI
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI 60

Query: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120
           EDISKLPPQYQ LEKKCDSLEK CRRMLVVTKT+EVEGYDYPPNLSESLSDWWSSNKEGL
Sbjct: 61  EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 121 FGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAXXXXX 180
           FG +SSSKK+K  E A  +K ALMPRSFAQAI+KAAKDSG+V+ ALK +EQ+ASA     
Sbjct: 121 FGLMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQASADEEDE 180

Query: 181 XXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVED 240
              IT LIKMF AWS CQ+ +DQ KAEMDALM KEFN KL A +EEKFKNA  LR+KVED
Sbjct: 181 DEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVED 240

Query: 241 SRLKFDTMRYELKMAEEQGKT-----------------EEAAQQTE-SQKPQXXXXXXXX 282
           SRLKFDTMRYE+K+ E+Q K                  EE A   E S +          
Sbjct: 241 SRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKE 300

Query: 283 XXXXXXXXQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQN 342
                   Q+LLEKLEDEFVSNTTEAVETMGEITDSAE++NLVKLFHNFQL+Y++QCVQ+
Sbjct: 301 EQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQD 360

Query: 343 LETSINSLNELEGDEA 358
           LE S+++LNELEG++A
Sbjct: 361 LEASLSTLNELEGEDA 376

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  438 bits (1127), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 230/398 (57%), Positives = 267/398 (67%), Gaps = 43/398 (10%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60
           MS YF  FSL+KLTNSI++ AHKTQD LSTAIANIQLDDPQAKLSLK RKHYLQETLG I
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI 60

Query: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120
           +DISKLPPQYQFLEKKCDSLEK+CRRMLVVTKT+EVEGYDYPPNLSES+SDWW +N+ GL
Sbjct: 61  DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL 120

Query: 121 FGFVSSSKKEKKLEPAE--DSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKAS-AXX 177
             F+   K E     AE  D  E  +PRSFAQA+SKAAKDSG+V+  LK E+++      
Sbjct: 121 LSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQKEPPQDED 180

Query: 178 XXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKK 237
                 I SLI MFEAWS C+  +DQ KAEMD+LM KEFN KL   + E FK   +LRKK
Sbjct: 181 EDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKK 240

Query: 238 VEDSRLKFDTMRYELKMAE-------------------EQGKTEEAAQQTESQK------ 272
           VE+SRLKFDT+RYEL + E                   EQ   EE A +TE Q+      
Sbjct: 241 VEESRLKFDTLRYELNLKEKEQQKAKAKEEENEKVDVVEQNAPEEKA-KTEGQETSEGKE 299

Query: 273 --------------PQXXXXXXXXXXXXXXXXQKLLEKLEDEFVSNTTEAVETMGEITDS 318
                          +                 KLLEKLEDEFVS+TTEAVE MGEITDS
Sbjct: 300 HDLKADEKLSEDTASKIPESVENEEVDNEDPEHKLLEKLEDEFVSSTTEAVEIMGEITDS 359

Query: 319 AEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEGD 356
           +EI++LVKLFH FQLIY++QCVQ LE S   L+ L+ +
Sbjct: 360 SEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  370 bits (950), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 195/357 (54%), Positives = 247/357 (69%), Gaps = 14/357 (3%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60
           MS Y   FSLNK+T+++ N AHKTQDTL++AIAN+   DPQAKLSLKAR  YLQETLGTI
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS--DPQAKLSLKARTRYLQETLGTI 58

Query: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120
           +D SKLPPQYQ LEKK D+LEK C+R+L+VT+T+EVEGYDYPPNL+ES+SDWWS NK+G 
Sbjct: 59  DDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGW 118

Query: 121 FGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAXXXXX 180
           FG   + K EK    + D  +A +PRSF+QAISKAA D   V T L+             
Sbjct: 119 FG---TKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEH-----GDEDEE 170

Query: 181 XXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVED 240
              ++++ KMF++WS C  N+D+ K EMD+++ KEFN KL   + E FK     RKKVE+
Sbjct: 171 DEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEE 230

Query: 241 SRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKLEDE 300
           SRLKFDT+RYE+K+ E    TE A + TE+ +                   KLLE+LEDE
Sbjct: 231 SRLKFDTVRYEIKLKE----TENAKKSTETDEASKDETKTEEEPPKTSEEDKLLEELEDE 286

Query: 301 FVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEGDE 357
           FVSNTT AVE MGE+T+SAEI+ L KLF NFQL+Y++QCVQ +E S+  L  LE D+
Sbjct: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALESDD 343

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  360 bits (923), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 184/388 (47%), Positives = 252/388 (64%), Gaps = 36/388 (9%)

Query: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDIS 64
           F   SLN +T+SI+N A +TQ+  S+AI  I LDDP+ +LS+  R+H LQETLGT+ DIS
Sbjct: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDIS 61

Query: 65  KLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFGFV 124
           +LP QY+FLE+K D+LEK+C+R+L+VTKT+EVEGYDYPPNL+ES +DWWS NK+ +F F 
Sbjct: 62  QLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF- 120

Query: 125 SSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAXXXXX---- 180
           S  K E   E  E ++  L+PRSFAQA+SKAA DS  ++  LK EE + +          
Sbjct: 121 SKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQ 180

Query: 181 ----------------------XXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNH 218
                                    + +LIK FE+W+ CQ ++DQSKAEMD+LMVKEFN 
Sbjct: 181 KPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNA 240

Query: 219 KLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKM----AEEQGKTEEAAQQTESQKPQ 274
           KL+  +E  FK    LR KV+D+RL FDT+R+E+K+     E    +EEA ++  ++ P+
Sbjct: 241 KLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQEKEVVASSEEAEKKVATETPE 300

Query: 275 XXXXXXXXXXXXXXXXQ-----KLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFH 329
                           +     KL E+LED+FVS T+E VE +GE+TDS+EII+LVKLFH
Sbjct: 301 TPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFH 360

Query: 330 NFQLIYYKQCVQNLETSINSLNELEGDE 357
           NFQLI+YKQCV++LE  +  LN L+ ++
Sbjct: 361 NFQLIHYKQCVKSLEEDLEVLNSLDSED 388

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  350 bits (899), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 196/390 (50%), Positives = 248/390 (63%), Gaps = 34/390 (8%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQ-------DTLSTAIANIQLDDPQAKLSLKARKHYL 53
           MS+YF  FSL+K+ ++I   AHKTQ       + L+ AI +I LDDPQ  LSL+ RKH L
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 54  QETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWW 113
           QETLGTI+DISKLPP+YQFLE+KCD+ EKVC R+LVV+KT+EV+GYDYPPNL+ES+SDWW
Sbjct: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 114 --SSNKEGLF-GFVSSSKKEK-----KLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTA 165
             SS K+G+F GF   SK +K     K    + S E  +P SFAQAISKAA DS  ++  
Sbjct: 121 GSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILKE 180

Query: 166 LKTEEQ--KASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAF 223
           L  EEQ    S         + SL+ + EAW+  Q N+D++K +MD  M+ EFN KL + 
Sbjct: 181 L-NEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSL 239

Query: 224 VEEKFKNARTLRKKVEDSRLKFDTMRYELKMAEEQG-KTEEAAQQTESQ----------- 271
           V   F   R LRKKVE+SRLKFDT+RYEL+M +    +T+E     ESQ           
Sbjct: 240 VNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENED 299

Query: 272 --KP--QXXXXXXXXXXXXXXXXQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKL 327
             KP                   + LLEK EDEFVSNTT+AV  M +ITDS  +  LVKL
Sbjct: 300 NLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKL 359

Query: 328 FHNFQLIYYKQCVQNLETSINSLNELEGDE 357
           FHNFQLIY+K+CVQ L+ S+N +N L  +E
Sbjct: 360 FHNFQLIYHKKCVQELQASLNVINTLTVEE 389

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  352 bits (902), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 206/436 (47%), Positives = 257/436 (58%), Gaps = 84/436 (19%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLD--DPQAKLSLKARKHYLQETLG 58
           MS YF GFSLNK+T+SI   AHKTQDTL+ A+AN  ++  DPQ +LS+K+R  ++QE+LG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKE 118
           T+ DISKLPPQYQFLEKK DSLEKVC+R+L+V+KT+EVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 119 GLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKD-------------------S 159
           G FG   S    KK     D  +A +PRSFAQAISKAA D                    
Sbjct: 121 GWFGSKKSESSTKKKGSNHD--DAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKK 178

Query: 160 GEVMTALKTEEQKAS--------AXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDAL 211
             + TA  TE Q A                  +++LIK+F++WS C  N+D+ KAEMD++
Sbjct: 179 ESIKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSM 238

Query: 212 MVKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKM--AEEQGKTEEAAQQ-- 267
           MVKEFN KL   + + FK    LRKKVE+SRLKFDTMRYE+K   AE + K  EA  +  
Sbjct: 239 MVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEATGEAH 298

Query: 268 ----------------------TESQKPQXXXXXXXXXXXXX------------------ 287
                                 TE +KP+                               
Sbjct: 299 SKDVSAKDISANTTTSFDETPSTEDEKPKSEGAEEESKKEANEPTVDDVADRKEDLKSNK 358

Query: 288 ---------XXXQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQ 338
                        KLLEKLEDEFVSNTT AVETM EITDS+EI+ L+KLF NFQL+Y++Q
Sbjct: 359 VNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQ 418

Query: 339 CVQNLETSINSLNELE 354
           CVQ +E ++  LN LE
Sbjct: 419 CVQEVEANLKVLNGLE 434

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  348 bits (894), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 180/386 (46%), Positives = 233/386 (60%), Gaps = 35/386 (9%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60
           MS YF  FS   L +SI N AH+TQD LS A+AN+ L+DPQ +LS+K R  YL+ETLG +
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60

Query: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120
           ++ISKLPPQY  LE+K D+LEK C+RML+VT+T+EVEGYDYPPNL ES SDWWS +KEG 
Sbjct: 61  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 120

Query: 121 FGFVSSSKK-EKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAXXXX 179
           FG     +  E K++    SK+ LMPRSFAQAI+KA+ + GE         QK+      
Sbjct: 121 FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAY----QNSQKSEKKQID 176

Query: 180 XXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVE 239
                 +L++MF   S C  N+D+ K EMD  + +EFN KL   +   FK    LR KVE
Sbjct: 177 EDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVE 236

Query: 240 DSRLKFDTMRYELKMA---------------------EEQGKTEEAAQQTESQKPQXXXX 278
           +SRLKFDTMRYE+++                       +Q  T E A++ E   P     
Sbjct: 237 NSRLKFDTMRYEMRLKEKEEKEENENTANADEGPSNKNQQEPTNEPAKEEEKPTPAEPAE 296

Query: 279 XXXXXXXXXXXXQ---------KLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFH 329
                       +         KLLE+LEDEFVSNT+EAVETM  I + +EI+ L+KLF 
Sbjct: 297 AQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQ 356

Query: 330 NFQLIYYKQCVQNLETSINSLNELEG 355
           N QL+YY+QCVQ +E S+  LN+LE 
Sbjct: 357 NLQLVYYRQCVQEMEASLKGLNDLEN 382

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  325 bits (834), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 178/368 (48%), Positives = 233/368 (63%), Gaps = 21/368 (5%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLS-------TAIANIQLDDPQAKLSLKARKHYL 53
           MS YFG  SL+KL N++ N A KTQ  LS        AI NI++DDP+  LSLK RK  L
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 54  QETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWW 113
           QETLG+ +DIS+LPPQY FLE+KCD++E+VC+++LVV+KT+EVEGYDYPPN +ES+SDWW
Sbjct: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 114 -SSNKEGLF-----GFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALK 167
            +S KE  F     G     K++K+ + A  S     P SFA A+ +AAK S  ++  LK
Sbjct: 121 NTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSD----PPSFAHALHRAAKGSQGIIQELK 176

Query: 168 TEEQKASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEK 227
            + ++           + SLIKMF  W+  Q+NMD +K EMD  MVKEFN KL   +E +
Sbjct: 177 EQAEEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVE 236

Query: 228 FKNARTLRKKVEDSRLKFDTMRYELKMAEEQ-GKTEEAAQQTESQKPQXXXXXXXXXXXX 286
           FK   TLR+KVE+SRL FDT++YE    +    K ++ A+Q E   P             
Sbjct: 237 FKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLA 296

Query: 287 XXXXQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETS 346
                  LE  EDEFVSNT EAVE M  I D+ ++I+LVKLF NFQL+Y+++CVQ LE S
Sbjct: 297 FYAQ---LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQELEVS 353

Query: 347 INSLNELE 354
           +NSL  LE
Sbjct: 354 LNSLTSLE 361

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  326 bits (836), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/422 (44%), Positives = 239/422 (56%), Gaps = 69/422 (16%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIA--NIQLDDPQAKLSLKARKHYLQETLG 58
           MS YF GFSLNK+T+SI   AHKTQDTL+ A+A  N+ L+DP+ +LS+K+R  ++QE+LG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLG 60

Query: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKE 118
           T+ DISKLPPQYQFLEKK DSLEKVCRR+L+V+KT+EVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120

Query: 119 GLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKA----- 173
           G FG   S    KK     D  +A +PRSFAQAISKAA D      +LK +E+       
Sbjct: 121 GWFGSRKSENANKKKVSNHD--DAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKS 178

Query: 174 -------------SAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFN--- 217
                                  +++LIK+F++WS C  N+D+ KAEMD+ M+KEFN   
Sbjct: 179 ESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKL 238

Query: 218 -----------HKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELK------------- 253
                      H+L   VE+      T+R +V+    K    + E               
Sbjct: 239 EKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANAP 298

Query: 254 -MAEEQGKTEE-------------------AAQQTESQKPQXXXXXXXXXXXXXXXXQKL 293
              +E   TE+                   AA      K                   KL
Sbjct: 299 ISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIEDLEENKL 358

Query: 294 LEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNEL 353
           LEKLEDEFVSNTT AVE M EITDS++I+ LVKLF NFQL+Y++QCVQ +E ++  LN L
Sbjct: 359 LEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSL 418

Query: 354 EG 355
           E 
Sbjct: 419 EN 420

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  307 bits (787), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 168/384 (43%), Positives = 232/384 (60%), Gaps = 42/384 (10%)

Query: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQ------LDDPQAKLSLKARKHYLQETLG 58
           F GFS++KLT+SI+NVA KTQ+ L+ A++N+       L+DP  KLS+K++  ++QE LG
Sbjct: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61

Query: 59  TIED-ISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNK 117
           TI D  SKLPP Y  LE K D++EK  +R+L VTKTYE EGYDYPPNL+ESLSDWW+++ 
Sbjct: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTNDD 121

Query: 118 EGLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTE---EQKAS 174
                  ++ + ++ ++    S ++ +PRSFAQAIS A+ D+   + ++        K  
Sbjct: 122 ----NVTNTDENDENIQ----SNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKDD 173

Query: 175 AXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTL 234
                     + L K+FE+   C  N+D  K EMD L+V EFN+KL   +  +FKN   L
Sbjct: 174 EEEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQL 233

Query: 235 RKKVEDSRLKFDTMRYELKMAE------------------------EQGKTEEAAQQTES 270
           RK VE+SRLKFDTMRYELK+ E                        E  K E + ++T  
Sbjct: 234 RKSVENSRLKFDTMRYELKIKEWKRTXXXMEAEDKSDVSKKGTSKKETPKKEASKKETPK 293

Query: 271 QKPQXXXXXXXXXXXXXXXXQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHN 330
           ++                   KLLEKLEDEFVSNT  AVE M E+TD+++IINLVKL+ N
Sbjct: 294 KEINKKEDITNEGNTENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQN 353

Query: 331 FQLIYYKQCVQNLETSINSLNELE 354
           FQL+YYKQC+Q +E+++  LN LE
Sbjct: 354 FQLVYYKQCIQEIESNLKILNGLE 377

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  309 bits (792), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 174/416 (41%), Positives = 249/416 (59%), Gaps = 64/416 (15%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLD--DPQAKLSLKARKHYLQETLG 58
           MS YF  FSL+KL +S+ + A KTQDTLS AI N+ +D  DPQ +L+L +++HYLQE++G
Sbjct: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85

Query: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKE 118
            I +ISKLP QY  LE+K D+LEK+ +R+L+VT T+E+EGYDYPPNLSES+S+WW ++  
Sbjct: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145

Query: 119 GLF--GFVSSSKKEKKLEPAE-------DSKEALMPRSFAQAISKAAKDSGEVMTALKTE 169
                   ++ K +    P +       DS+ + +PRSF  AISKA+ DS  ++T L   
Sbjct: 146 AFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLNNN 205

Query: 170 EQ------KASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAF 223
           E+      K           I  LIK+F++WS C  N+D+SK + D L++K+FN KLT+ 
Sbjct: 206 EKLEFAKTKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSL 265

Query: 224 VEEKFKNARTLRKKVEDSRLKFDTMRYEL-KMAEEQGKTEE------------------- 263
           ++ +FKN + LR KV+D+RLKFDTMRYE+ K AE + + EE                   
Sbjct: 266 LDVEFKNVKALRLKVQDARLKFDTMRYEIAKAAEAKVRAEENDKPVEMEKGEGEDEGEGE 325

Query: 264 --------------------------AAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKL 297
                                     AA   ESQK +                +KLLE L
Sbjct: 326 GKGKGKGKGETASTSTETASTSTTKDAAATIESQK-KDSPNPEFEKNDSQNEDEKLLEHL 384

Query: 298 EDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNEL 353
           EDEFVS+T+ AVETM EIT+S++I++L+KLF NFQL++Y+QC++ +ET++  L +L
Sbjct: 385 EDEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  306 bits (783), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/431 (43%), Positives = 249/431 (57%), Gaps = 84/431 (19%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIAN--IQLDDPQAKLSLKARKHYLQETLG 58
           MS Y+     NK+T+SI   AHKTQDTL++A+AN  + L+DPQ +LS+K+R  ++QE+LG
Sbjct: 1   MSGYW-----NKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLG 55

Query: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKE 118
           T+ DISKLPPQYQFLEKK DSLEKVC+R+L+V+KT+EVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115

Query: 119 GLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEE-----QKA 173
           G FG   +    KK +   D  +  +PRSFAQAISKAA D       L+  E     QK 
Sbjct: 116 GWFGSKKTEHASKKKDSNHD--DTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKK 173

Query: 174 SAXXXXXXXX-----------------ITSLIKMFEAWSACQHNMDQSKAEMDALMVKEF 216
            A                         +++LIK+F++WS C  N+D+ KAEMD++MVKEF
Sbjct: 174 EAKKTTQETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEF 233

Query: 217 N--------------HKLTAFVEE---KFKNAR--------TLRKKVEDSRLKFD----- 246
           N              H+L   VEE   KF   R         LR + +++  + D     
Sbjct: 234 NKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKEADNNDNS 293

Query: 247 ---TMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQ------------ 291
              T   E   AE++ + E+ A+  E ++P+                +            
Sbjct: 294 ANSTSLEEALTAEKKAEKEDDAKVPE-EEPKKVETDVTTANDDIDTNENPKQQPTNNQPP 352

Query: 292 -------KLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLE 344
                  KLLEKLEDEFVSNTT AVETM EITDS+EI++LVKLF NFQL+Y++QC Q +E
Sbjct: 353 VEDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVE 412

Query: 345 TSINSLNELEG 355
            ++  LN +E 
Sbjct: 413 ANLKVLNGMEN 423

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  280 bits (717), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 164/403 (40%), Positives = 231/403 (57%), Gaps = 72/403 (17%)

Query: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQ------LDDPQAKLSLKARKHYLQETLG 58
           F  FSL+KLT+SI+NVA KTQ+  + AI ++       L+DP  KLS++AR  Y+QE LG
Sbjct: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61

Query: 59  TIED-ISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNK 117
           T++D ISKLP QY  LE K DS+EK+ +R+L+VT T+  EGYDYPPNL+ES+SDWW+ + 
Sbjct: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED- 120

Query: 118 EGLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDS------GEVMTALKTEEQ 171
                           E  E+     +PRSFAQA++KA  DS       E    L+T  +
Sbjct: 121 ----------------ETTENKN--FLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPK 162

Query: 172 KASAXXXX---------------XXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEF 216
                                      + +L K F+A S    N+D  K EMD ++V EF
Sbjct: 163 NTGTKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEF 222

Query: 217 NHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQ---------- 266
           N KL   +E +FK    LR+ VE+SRLKFDTMRY++K+ E + + EEA +          
Sbjct: 223 NKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEEAKEVSTDKEIEKK 282

Query: 267 QTESQKPQXXXXXXXXXXXXXXXXQ---------------KLLEKLEDEFVSNTTEAVET 311
           ++E+++P+                +               KLLE+LEDEFVSNT+ AVE 
Sbjct: 283 ESETKEPETKGTEEKEPETKDTEEKDPVKENEGENEDEDYKLLEQLEDEFVSNTSSAVEK 342

Query: 312 MGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELE 354
           M E+TDSA+I++LVKLF NFQL+YY+QCVQ +E ++ ++++LE
Sbjct: 343 MEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  280 bits (715), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 153/296 (51%), Positives = 192/296 (64%), Gaps = 34/296 (11%)

Query: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLD--DPQAKLSLKARKHYLQETLG 58
           MS YF  FSLNK+T+SI   AHKT DTL+ A+AN  ++  DPQ +LS+K+R  ++QE+LG
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKE 118
           TI DISKLPPQYQFLEKK DSLEKVC+R+L+V+KT+EVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 119 GLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKD-------------------- 158
           G FG   S    KK     D  +A +PRSFAQAISKAA D                    
Sbjct: 121 GWFGSKKSEITNKKKGSNHD--DAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKR 178

Query: 159 ----SGEVMTALKTEEQKASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVK 214
               + +   A   E ++           +++LIK+F++WS C  N+D+ K EMD++MVK
Sbjct: 179 ESTKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVK 238

Query: 215 EFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKMAEEQ------GKTEEA 264
           EFN KL   + + FK    LRKKVE SRLKFDTMRYE+K  E Q      G TEEA
Sbjct: 239 EFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEA 294

 Score = 94.7 bits (234), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 44/64 (68%), Positives = 53/64 (82%)

Query: 292 KLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLN 351
           KLLEKLEDEFVSNTT AVETM EI DS+EI+ L+KLF NFQL+Y++QCVQ +E ++  LN
Sbjct: 364 KLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLN 423

Query: 352 ELEG 355
            LE 
Sbjct: 424 GLEN 427

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  262 bits (669), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 157/401 (39%), Positives = 220/401 (54%), Gaps = 72/401 (17%)

Query: 8   FSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDISKLP 67
           F+L  +T SI   +  TQ  +       Q +DP+ KLS+KA+  +LQE +G   DISKLP
Sbjct: 4   FNLESITQSI---SEGTQSLVQ------QFNDPKTKLSIKAKTRFLQEAIGNERDISKLP 54

Query: 68  PQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSS-----------N 116
           PQY  LEKKCDS+EKV +R+L+VTKTYE+EGYDYPPN+SESLS WW +           N
Sbjct: 55  PQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKN 114

Query: 117 KEGLFGFVSSSKKE--KKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKAS 174
                G V  +  E  K L   E S E   P SFA AI++A KDS  +  +++T+++   
Sbjct: 115 VIPKHGNVEKAGTEASKTLTDKEVSHEG--PPSFASAIARAGKDSQLIFESIETKDEDEK 172

Query: 175 AXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTL 234
                       L+K+F+ WS C + +  SK EMD +M+KEFN KL  ++++ F+   TL
Sbjct: 173 EDI-------DELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTL 225

Query: 235 RKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQK-- 292
           R KVE+SRL FDTMRYE+    +Q  ++E   + E+ KP                  K  
Sbjct: 226 RAKVEESRLNFDTMRYEVAQTSKQTDSKELGNEDET-KPSSMDANKTNTEEKEAANDKVE 284

Query: 293 --------------------------------------LLEKLEDEFVSNTTEAVETMGE 314
                                                 LLE+LEDEFVSNTTEAVE M E
Sbjct: 285 TKEKTETNATIADETKETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTE 344

Query: 315 ITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEG 355
           +++++E+++L+KLF  FQL Y++ CV++LE S+  LN ++ 
Sbjct: 345 VSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN 385

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  237 bits (605), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 176/298 (59%), Gaps = 52/298 (17%)

Query: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDIS 64
           F  FSL+K+TNSI N A K  +TL+ AI      DPQ KLS+K++    QE LGTI DIS
Sbjct: 2   FSSFSLDKITNSIGNAAQKATNTLNNAINTAT--DPQTKLSIKSQTRLFQEQLGTIHDIS 59

Query: 65  KLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFGFV 124
           KLP QY+ LE K DSLEK  +R+L+V+KT+E+EGYDYPPNL+ES SDWW+  K+      
Sbjct: 60  KLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKK------ 113

Query: 125 SSSKKEKKL--------------------EPAED--SKEALMPRSFAQAISKAAKDSGEV 162
           SSS ++K++                    EP E+  +  + +PRSFAQAISK+A D  ++
Sbjct: 114 SSSHRKKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDI 173

Query: 163 MTALKTEE----------------------QKASAXXXXXXXXITSLIKMFEAWSACQHN 200
              L  +E                       +           I +LIK FE+WS C  N
Sbjct: 174 YQQLSIQETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKN 233

Query: 201 MDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKMAEEQ 258
           +DQ K+EMD++M KEFN+KL   +  +FK   TLRKKV DSRLKFDT+R+E+K+ EE+
Sbjct: 234 IDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIKEEE 291

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (82%)

Query: 291 QKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSL 350
            KLLE+LEDEFVS+T  AVE M EIT+S+ II L+KLF NFQL+YY+QCVQ +E ++ +L
Sbjct: 408 HKLLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTL 467

Query: 351 NELE 354
           NEL+
Sbjct: 468 NELD 471

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  233 bits (594), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 170/260 (65%), Gaps = 24/260 (9%)

Query: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDIS 64
           F  FSL+K+TNS+   A KT DTLS AI      DP  KLSL+++K   QE++GT+ DIS
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT--DPATKLSLRSQKRLFQESIGTVHDIS 59

Query: 65  KLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFGFV 124
            LP QY  LE + D+LEK  RR+L+V+KT+E+EGYDYPPNLSES SDWWS         +
Sbjct: 60  TLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWS---------L 110

Query: 125 SSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQ----------KAS 174
           SS KK+++    ++ K+  +PRSFAQAIS +A+D  E+   +   +           + +
Sbjct: 111 SSKKKKEQ---EKEDKKGFLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEEN 167

Query: 175 AXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTL 234
                    + +LIK F++W+ C  N+DQ KAEMD++M+KEFN KL   + E+FK   TL
Sbjct: 168 EEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTL 227

Query: 235 RKKVEDSRLKFDTMRYELKM 254
           RK+V+DSRLKFDT+RYELK+
Sbjct: 228 RKRVKDSRLKFDTVRYELKV 247

 Score = 95.1 bits (235), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 44/64 (68%), Positives = 53/64 (82%)

Query: 291 QKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSL 350
            KLLE+LED FVS+T  AVE M EITDS+EII LVKLF NFQL+YY+QCVQ +E ++ +L
Sbjct: 380 HKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTL 439

Query: 351 NELE 354
           NELE
Sbjct: 440 NELE 443

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  200 bits (509), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 161/278 (57%), Gaps = 30/278 (10%)

Query: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIED-- 62
           F  F+ +K+TNSI+  A   Q  ++  I      D Q KL  K    + QE +G I D  
Sbjct: 2   FSNFNFDKITNSISTAAQSAQQKINDTILT---PDVQTKLHFKKTARFWQEKVGQIPDKE 58

Query: 63  ISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFG 122
           ISKLP  Y  LE K D+LEK+ +R+L+VTKTYE+EGYDYPPNLSESL+DWW S+      
Sbjct: 59  ISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWSD------ 112

Query: 123 FVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQ--------KAS 174
            +  SKK ++       K + M  SF  AISKAA DS  ++  LK ++Q           
Sbjct: 113 -LKKSKKHQE-------KSSFMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEPEE 164

Query: 175 AXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTL 234
                      +L+++F + S C  N+D+SKAEMDA++VKEFN KL   +   FK    L
Sbjct: 165 EVEEEDDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKL 224

Query: 235 RKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQK 272
           R KV+DSRL+FDT+R+E+K+ E     +E+ +Q  SQK
Sbjct: 225 RTKVQDSRLEFDTLRHEIKLKE---LAQESIRQENSQK 259

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 54/63 (85%)

Query: 292 KLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLN 351
           KLLEKLEDEFVSNT  AVE M E+T+++E+INLVKLF NFQLI+YKQCVQ +E ++  L+
Sbjct: 353 KLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLD 412

Query: 352 ELE 354
           +LE
Sbjct: 413 QLE 415

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  189 bits (480), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 112/279 (40%), Positives = 158/279 (56%), Gaps = 49/279 (17%)

Query: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI--ED 62
           F  FSL+KLT++ITN A   QDT+   I +    D Q KL       Y QE +GTI  ++
Sbjct: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILS---PDAQTKLQFLKTTRYFQEKVGTISEDE 58

Query: 63  ISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFG 122
           I+KLP  YQ L++K +++EKV +R+LVVTKT+E+EGYDYPPN++ESL+ WW+ ++     
Sbjct: 59  IAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDE----- 113

Query: 123 FVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAXXXXXXX 182
                 K+KK +   DS  +++ RSFA AI KA  DS  +++ LK E+QK          
Sbjct: 114 -----NKKKKTQDFGDS--SILNRSFAIAIGKAVLDSQYILSDLK-EQQKTRGTEEKKVK 165

Query: 183 X-------------------------------ITSLIKMFEAWSACQHNMDQSKAEMDAL 211
                                           + ++I  F  WS C  N+DQSKAEMD++
Sbjct: 166 REEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDSM 225

Query: 212 MVKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRY 250
           +VKEFN KLT  +E  FK    L  +V+DSRL+FDT+R+
Sbjct: 226 IVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/58 (65%), Positives = 48/58 (82%)

Query: 299 DEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEGD 356
           DEFVSN T AVE M E+TDS+E+I+LVKLF N QL++Y+QCVQ LE S+ SL+ELE +
Sbjct: 391 DEFVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 98.2 bits (243), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 95/347 (27%), Positives = 160/347 (46%), Gaps = 65/347 (18%)

Query: 9   SLNKLTNSI--------TNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60
           + N  TNS+        T V+ +TQ+ +ST + ++           ++ +  +QE LG +
Sbjct: 3   TFNNFTNSLNQKFQELSTAVSQRTQE-ISTNLPSL----------TQSTQRLVQERLGQV 51

Query: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDW---WSSNK 117
            DIS+LP +Y  LE+K D+++ +    L VT  YE E YDYP  ++ES++D+    +   
Sbjct: 52  TDISQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVNDFSKIVAHKV 111

Query: 118 EGLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAXX 177
           + L    S+S+ +  L     +KE   PR+   A+SK +  S E +  +   ++   A  
Sbjct: 112 QELSHASSASEAQNILITPTPAKE---PRTLNYALSKVSLISSEYLNHIGDHDEAQVA-- 166

Query: 178 XXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKK 237
                  + L+K    +S  Q  + Q++ + D ++   FN +L   +E  FK A+  RK 
Sbjct: 167 -------SVLLK----YSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKD 215

Query: 238 VEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKL 297
           VE  RL++D  R  L     Q K E+ A    S + Q                   +E L
Sbjct: 216 VEYKRLQYDVARSNLA----QAKPEKEA----SLRVQ-------------------METL 248

Query: 298 EDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLE 344
           ED+F   T +A   M E+  +A+    +K   N QL Y++     +E
Sbjct: 249 EDQFAQATEDATIIMQEVLSNAKFTEEIKEMANAQLTYHQTSASLIE 295

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 97.4 bits (241), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 92/330 (27%), Positives = 155/330 (46%), Gaps = 59/330 (17%)

Query: 18  TNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDISKLPPQYQFLEKKC 77
           T V+ KTQD  +T + ++           ++ +  +QE LG + DIS+LP  Y  LE K 
Sbjct: 39  TAVSQKTQD-FTTQLPSL----------AQSTQRLMQEKLGQVTDISQLPQDYVELENKI 87

Query: 78  DSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWS---SNKEGLFGFVSSSKKEKKLE 134
           D ++ V    L VT+ YE E YDYP N+ +S++++ S   +    L    S+++ +  L 
Sbjct: 88  DRMKLVYENFLKVTQVYENESYDYPNNVRDSVNEFSSIVGTKLHELSRATSTNEAQSVLI 147

Query: 135 PAEDSKEALMPRSFAQAISKAAKDSGEVMT-ALKTEEQKASAXXXXXXXXITSLIKMFEA 193
                K+   P++   A+SK A  S E +  +   E+ + S          +SL+K    
Sbjct: 148 SPGPHKD---PKTLNYALSKVALTSSEYLNKSPGAEDSEVS----------SSLLK---- 190

Query: 194 WSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELK 253
           +S  Q  + Q++   D L+  +FN KL A + +    A+  RK VE+ RL++D  R  L 
Sbjct: 191 YSDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRLQYDIARANLA 250

Query: 254 MAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKLEDEFVSNTTEAVETMG 313
            A  +   +EA+ + +                        +E LEDEF   T +AV  M 
Sbjct: 251 NARPE---KEASLRVQ------------------------MESLEDEFAQATDDAVVIMQ 283

Query: 314 EITDSAEIINLVKLFHNFQLIYYKQCVQNL 343
           ++ +S+E++  ++     Q  YYKQ  + L
Sbjct: 284 KVAESSELLKDLRELVAAQAEYYKQSAELL 313

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 97.4 bits (241), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 153/324 (47%), Gaps = 64/324 (19%)

Query: 20  VAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDISKLPPQYQFLEKKCDS 79
           V+ +TQD L+T++ ++           ++ +  +QE LG + DIS+LP +Y  LE + D 
Sbjct: 41  VSQRTQD-LTTSLPSLA----------QSTQRLVQERLGQVTDISQLPQEYLELENRIDR 89

Query: 80  LEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWS--SNKEGLFGFVSSSKKEKKL---- 133
           +  V    L VT+ YE E YDYP N+ +S++++    S+K       SS+ + + +    
Sbjct: 90  IRLVYENFLKVTQVYEHESYDYPNNVRDSVNEFSKTVSSKLHELSHASSTDEAQNILISP 149

Query: 134 EPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAXXXXXXXXITSLIKMFEA 193
            PA+D      P++   A+SK A  S E ++    E++  +          T+L+K    
Sbjct: 150 GPAKD------PKTLNYALSKVALTSSEYLSKSGHEDETIA----------TALLK---- 189

Query: 194 WSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELK 253
           +S  Q  + Q++ + D L+  +FN KL   +      A   RK+VE+ RL++D  R  L 
Sbjct: 190 YSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIARANLA 249

Query: 254 MAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKLEDEFVSNTTEAVETMG 313
            A+ +   +EA+ + +                        +E LEDEF   T +A   M 
Sbjct: 250 NAKPE---KEASLRVQ------------------------MESLEDEFAQATEDATGVMQ 282

Query: 314 EITDSAEIINLVKLFHNFQLIYYK 337
           ++  S+E +  +    + QL YYK
Sbjct: 283 DVIASSEFLKDLSELVSAQLAYYK 306

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 93.6 bits (231), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 92/349 (26%), Positives = 161/349 (46%), Gaps = 71/349 (20%)

Query: 9   SLNKLTNSI--------TNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60
           S N  TNS+        T V+ KTQ+  ST+I  +           ++ +  +QE LG +
Sbjct: 2   SFNSFTNSLSQKFQELSTAVSEKTQE-FSTSIPTLA----------ESTQRLVQEKLGNV 50

Query: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWS--SNKE 118
            DIS+LP +Y  LE++ D+++ V    L +T  YE E YDYP  +S+S++D+    +NK 
Sbjct: 51  TDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVNDFSKVFANKV 110

Query: 119 GLFGFVSSSKKEKKL----EPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKAS 174
                 +S+++ + +     PA++      PR+   A+SK A +S E +  L    +   
Sbjct: 111 TELSHATSAQEAQNILVTPGPAKE------PRTLNYALSKVALNSSESLAQLADPNEGPV 164

Query: 175 AXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTL 234
           A          +L+K    +S  Q  + Q++   D L+  +FN +L   +E     A   
Sbjct: 165 AD---------ALLK----FSDVQAKIAQTRLHQDTLIQTKFNKQLREKLELDIGKASKA 211

Query: 235 RKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLL 294
           RK V+  RL++D  R +L  A+ +   +EA+ + E                        +
Sbjct: 212 RKDVQYKRLQYDVARSKLTQAKPE---KEASLRVE------------------------M 244

Query: 295 EKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNL 343
           E LE++F  +T +A   M E+   ++ ++ +K     QL Y++   Q L
Sbjct: 245 ESLEEQFAQSTEDATIIMQEVIADSKFLSSLKELAEAQLSYFETSAQLL 293

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 89/331 (26%), Positives = 154/331 (46%), Gaps = 43/331 (12%)

Query: 15  NSITNVAHKTQDTLSTAIAN----IQLDDPQAKLSLKARKHYLQETLGTIEDISKLPPQY 70
           NS TN  +K    LST ++        + P      ++ +  +QE LG + DIS+LP +Y
Sbjct: 5   NSFTNSFNKRLQELSTTVSQKTQEFSTNMPDINSLAQSTQRMVQERLGQVTDISQLPEEY 64

Query: 71  QFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWS---SNKEGLFGFVSSS 127
             LE+K D+++ V    L VT T+E + YDYP    ES+ ++     S  E L    S+S
Sbjct: 65  LQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVARESVIEFSKSAVSKVEELSHATSAS 124

Query: 128 KKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMT-ALKTEEQKASAXXXXXXXXITS 186
           + ++ L    +S +   P++   A+SKA+  S E +     T++   S         I  
Sbjct: 125 EAQQIL--TNNSNQIKEPKTLNYALSKASLISSEQLNKQFSTDDDNNSNSDFKLVSSI-- 180

Query: 187 LIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFD 246
           L+K    +S  Q  + Q++ + D L+ ++FN+ L   +   F+ A+ +RK V++ RL++D
Sbjct: 181 LLK----FSDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYD 236

Query: 247 TMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKLEDEFVSNTT 306
             R  L  A+ +   +EA+ + +                        +E LED+F   T 
Sbjct: 237 VARTNLLNAKPE---KEASLRVQ------------------------MELLEDQFAQATE 269

Query: 307 EAVETMGEITDSAEIINLVKLFHNFQLIYYK 337
            A   M EI +++  +  +      QL YY+
Sbjct: 270 HATLVMNEIIENSNFMEYLNELARAQLAYYQ 300

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 90.1 bits (222), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 134/291 (46%), Gaps = 48/291 (16%)

Query: 53  LQETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDW 112
           +QE LG + DIS+LP +Y  LE K D +  V    L VT+ YE E YDYP N+ +S++++
Sbjct: 63  VQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSVNEF 122

Query: 113 WSSNKEGLFGF---VSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMT-ALKT 168
            S     L       S+++ +  L      K+   P++   A+SK A  S E +  ++  
Sbjct: 123 SSVVAGKLHDLSRATSTNEAQSVLIAPGPHKD---PKTLNYALSKVALTSSEYLNKSVGG 179

Query: 169 EEQKASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKF 228
           ++ + S           +L+K    +S  Q  + Q++ + D L+   FN KL   +    
Sbjct: 180 DDSEVS----------NALLK----YSDVQAKVAQARLQQDTLIQTRFNKKLRDILANDL 225

Query: 229 KNARTLRKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXX 288
             A+  RK VE  RL++D  R  L  A+ +   +EA+ + +                   
Sbjct: 226 NEAQKARKNVEHKRLQYDIARSNLANAKPE---KEASLRVQ------------------- 263

Query: 289 XXQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQC 339
                +E LEDEF   T +AV  M ++  S+E++  ++     Q  Y+KQ 
Sbjct: 264 -----MESLEDEFAQATDDAVVVMQKVAGSSELLKELRELVAAQADYHKQS 309

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/308 (26%), Positives = 137/308 (44%), Gaps = 49/308 (15%)

Query: 52  YLQETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSD 111
           Y+QE LG   DIS++P +Y  L  K D+++ +    L VT+ Y+ E YDYP  ++ES+++
Sbjct: 38  YMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESINE 97

Query: 112 W---WSSNKEGLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKT 168
           +     S  + L    S+ +    L     SK+   P++   A+S+ +  S E M  L T
Sbjct: 98  FSRTVGSKIQELSHASSAHEAHSILSAPGPSKD---PKTLNYALSRVSLVSSECMEHLST 154

Query: 169 EEQKASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKF 228
            +    A         + L+K    +S  Q  + Q++   D+L+   FN KL   ++   
Sbjct: 155 HDDALLA---------SYLMK----YSDIQSRVAQARLHQDSLVQTHFNAKLREEIDGNL 201

Query: 229 KNARTLRKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXX 288
           K A  +R+ VE+ RL +D  R  L    E+ K E+ AQ                      
Sbjct: 202 KRAHRVRRDVENKRLTYDASRTHL----EKAKPEKEAQ---------------------- 235

Query: 289 XXQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSIN 348
             +  +E  E+EF   T  A+  M E+   A  + L++     Q  Y++   Q ++    
Sbjct: 236 -LRVQMETAEEEFAQATENAIVVMQEVIAGANFMPLLRELAAAQWSYHETAAQRMQA--- 291

Query: 349 SLNELEGD 356
            L++  GD
Sbjct: 292 FLSDFPGD 299

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 89.0 bits (219), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 91/344 (26%), Positives = 150/344 (43%), Gaps = 58/344 (16%)

Query: 1   MSNYFGGF--SLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLG 58
           MSN F  F  SL +   S +N   +    LST I  +           ++ +  +QE LG
Sbjct: 1   MSN-FNSFANSLRENLQSFSNTVSQKTHELSTNIPTL----------AQSTQRMVQEKLG 49

Query: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDW---WSS 115
            + DIS+LP +Y  LE K D+++ V    L VT  YE E YDYP  +SES++++    ++
Sbjct: 50  QVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAA 109

Query: 116 NKEGLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASA 175
             + L    S+++ +  L      KE   P++   A+SK A ++ E +     +   A  
Sbjct: 110 KVQELSKATSATEAQNILVAPGPVKE---PKTLNYAMSKVALNASEYLNHSFDDPMDA-- 164

Query: 176 XXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLR 235
                      L K+   +S  Q  + Q++ + D  +  +FN  +   + E    A   R
Sbjct: 165 ----------KLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKAR 214

Query: 236 KKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLE 295
           K V+  RL++D  R  L+ A+ +   +EA  + +                        +E
Sbjct: 215 KDVQSKRLQYDVARTNLQNAKPE---KEAGLRVQ------------------------ME 247

Query: 296 KLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQC 339
            LED+F   T +A   M E+  SA  +  +K     QL YY+Q 
Sbjct: 248 TLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQS 291

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 88.2 bits (217), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 94/343 (27%), Positives = 157/343 (45%), Gaps = 72/343 (20%)

Query: 18  TNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDISKLPPQYQFLEKKC 77
           T V+ +TQD L T+I +I            + +  +QE LG + DIS+LP +Y  LEK+ 
Sbjct: 19  TVVSERTQD-LGTSIPSIA----------SSTQRLVQEKLGNVTDISQLPQEYLELEKEI 67

Query: 78  DSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDW---WSSNKEGLFGFVSSSKKEKKLE 134
           D+++ V    L +T  Y+ E YDYP  +S+S++D+   + S  E L    S+ + +  L 
Sbjct: 68  DTIKLVYEHFLKITSIYDNESYDYPKYVSDSVNDYSKLFQSKIEDLSRATSAEEAQNILV 127

Query: 135 PAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAXXXXXXXXITSLIKMFEAW 194
                 E   PR+   A+SK A  S E +  L+     A A         ++L+K    +
Sbjct: 128 TPGPITE---PRTLNYALSKVALTSSESLNQLQDPNVSAVA---------STLLK----F 171

Query: 195 SACQHNMDQSKAEMDALMVKEFN----HKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRY 250
           S  Q  + Q + + D L+  + N     KL++ +E+  K+    R+ V+  RL++D  R 
Sbjct: 172 SDMQTKIAQQRLQQDTLIQTKVNKVIKEKLSSLIEKATKS----RRDVQYKRLQYDVARS 227

Query: 251 ELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKLEDEFVSNTTEAVE 310
           +L  A+ +   +EAA + E                        +E LE++F   T  A  
Sbjct: 228 KLAQAKPE---KEAALRVE------------------------MESLEEQFAQATESATV 260

Query: 311 TMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNEL 353
           TM ++   ++ ++ +K     QL Y+       E S N L EL
Sbjct: 261 TMQDVISQSKFLDTLKNLVEAQLSYF-------ENSANLLKEL 296

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 88.6 bits (218), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 136/296 (45%), Gaps = 45/296 (15%)

Query: 53  LQETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDW 112
           +QE LG + DIS+LP +Y  LEK+ D+L+ V    L VT  YE E YDYP  + +S+++W
Sbjct: 44  VQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVNEW 103

Query: 113 WSS--NKEGLFGFVSSSKKEKKL--EPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKT 168
             +   +      VSS+ + + +   P ++++    P++   A+SK A +  +++  L  
Sbjct: 104 SRTVATRVSELRHVSSAAEAQHVIAAPTQETE----PKTLHYALSKVALNGSQLVDNL-- 157

Query: 169 EEQKASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKF 228
                 A        ++S +  F   S  +  + Q++ E DA +  +FN KL   +  + 
Sbjct: 158 -----DAPRTPRETQLSSGLLEF---SGVEAELAQARLEQDAAVKAQFNEKLRGQLSGEI 209

Query: 229 KNARTLRKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXX 288
             A   RK+V   RL++D  R  L  A+ +   +EA+ + +                   
Sbjct: 210 ARAAAARKEVFQKRLQYDVARTNLLNAKPE---KEASLRVQ------------------- 247

Query: 289 XXQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLE 344
                +E LEDEF   T  A   M E+   A+++  V+     Q  Y+++    LE
Sbjct: 248 -----METLEDEFAQCTEHATIVMQEVLSQADLLGAVRRLAAAQHAYHERSAAILE 298

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 87.4 bits (215), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 91/340 (26%), Positives = 150/340 (44%), Gaps = 65/340 (19%)

Query: 9   SLNKLTNSIT--------NVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60
           S N  TNS +         V+ KTQ+ LST + N+           ++ +  +QE LG +
Sbjct: 3   SFNSFTNSFSKTLSELSSTVSQKTQE-LSTNLPNLA----------QSTQRMVQERLGQV 51

Query: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESL---SDWWSSNK 117
            DIS+LP +Y  LE K DS++++    L V+  YE + YDYP    ESL   S   +S  
Sbjct: 52  TDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKV 111

Query: 118 EGLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQ-KASAX 176
           E L    S+ + +  L  +  S +   P++   A+SK A  S E +      E  K+SA 
Sbjct: 112 EELSHASSAHEAQNILTTS--STQIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSA- 168

Query: 177 XXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRK 236
                   ++L+     +S  Q  + Q++ + D L+ ++FN  L   +      A  +RK
Sbjct: 169 --------SALLN----FSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRK 216

Query: 237 KVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEK 296
           +V+  RL++D  R  L  A+ + +     Q                           +E 
Sbjct: 217 EVQSKRLQYDIARTNLMNAKPEKEASLRVQ---------------------------MET 249

Query: 297 LEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYY 336
           LED+F   T  A   M ++ D+++I++ V      QL Y+
Sbjct: 250 LEDDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYF 289

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 89/353 (25%), Positives = 155/353 (43%), Gaps = 54/353 (15%)

Query: 1   MSNYFGGFS--LNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLG 58
           MS YF  FS  + +L+ S++  A + Q  L     +++ + P   L   + +  LQE LG
Sbjct: 1   MSQYFDSFSKKVQELSTSVSQKAQEAQ--LDQKFKDLKTNLP---LLANSTQRMLQEKLG 55

Query: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKE 118
            + DIS+LP +Y  LE + ++++ +    L VTK YE E YDYP N+ ES+ ++      
Sbjct: 56  QVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKLVGG 115

Query: 119 GLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAXXX 178
            L      + +E+       S +   P++   A+SK A  S E       E++       
Sbjct: 116 KLHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTSSE-----HVEDE------- 163

Query: 179 XXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKV 238
                  SL      +S  Q  + Q + + D ++  +FN  +   +E+  + +   RK V
Sbjct: 164 -------SLANFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLV 216

Query: 239 EDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKLE 298
           E  RL++D +R   ++   + + + A Q  ES                           E
Sbjct: 217 EQKRLQYDVVRSN-RLKNTKPEKQAALQVEESTH-------------------------E 250

Query: 299 DEFVSNTTEAVETMGEITDSAEI-INLVKLFHNFQLIYYKQCVQNLETSINSL 350
           +EF   T +A+  M ++ + A+   NL +L    QL Y+K   + LE  +N +
Sbjct: 251 EEFAKATDDAIIAMSKVVELADFSANLHELVAA-QLAYHKSSAEILEELVNEV 302

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 86.3 bits (212), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 86/350 (24%), Positives = 149/350 (42%), Gaps = 70/350 (20%)

Query: 9   SLNKLTNSIT--------NVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60
           S N+ TNS T        +V+ +TQ+ LS  +  +           ++ +  +QE LG +
Sbjct: 3   SFNEFTNSFTKRFQELSTSVSQRTQE-LSNNLPTLA----------QSTQRLVQEKLGQV 51

Query: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120
            DIS+LP +Y  LEKK DS++ +    L VT  YE E YDYP  + +S++D+  +    +
Sbjct: 52  TDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIKDSVNDFSKTMAAKI 111

Query: 121 --FGFVSSSKKEKKL----EPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKAS 174
                 SS+ + + +     P  D      P++   A+SK +  + EV+  + +   +++
Sbjct: 112 TDLSHASSASEAQNILISPGPIRD------PKTLNYALSKVSLTASEVINQVGSTPNESA 165

Query: 175 AXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTL 234
                         K+ E +S  Q  + Q++ + D L+  +FN  L   +      A   
Sbjct: 166 LSS-----------KLLE-FSNVQSKIAQARLQQDTLIQTKFNKALRDDLSTSLAKANKF 213

Query: 235 RKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLL 294
           RK+V++ RL++D  R  L  A                KP+                   +
Sbjct: 214 RKEVQNKRLQYDVARTNLMNA----------------KPEKEASLRVK-----------M 246

Query: 295 EKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLE 344
           E LEDEF   T  A   M E+   ++ +  +      QL Y++   Q L+
Sbjct: 247 ESLEDEFAQATENATLVMQEVIAGSDFLTSLNQMVAAQLEYFQTSAQLLQ 296

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 84.3 bits (207), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 129/295 (43%), Gaps = 49/295 (16%)

Query: 53  LQETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDW 112
           +QE LG + DIS++P +Y  LE++ D  + +    L V++ YE E YDYP ++S+S++D+
Sbjct: 63  VQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDF 122

Query: 113 WSSNKEGLFGFVSSSKKEKKLEPAE----DSKEALMPRSFAQAISKAAKDSGEVMTALKT 168
             +    + G V    K    E A+        A  P++   A+SK A  S E ++   +
Sbjct: 123 SKT----VTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGS 178

Query: 169 EEQKASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKF 228
           ++             +T+ I +   +S  Q  + Q++ + D L+   FN +L   +  +F
Sbjct: 179 DD------------VVTADILL--KYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQF 224

Query: 229 KNARTLRKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXX 288
             A   RK+V+  RL++D  R     A  + +     Q                      
Sbjct: 225 AEAMQSRKQVDQKRLQYDIARANFTAARPEKQASLRVQ---------------------- 262

Query: 289 XXQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNL 343
                +E LED+F  +T +AV  M  + D  E +   +     QL ++K   + L
Sbjct: 263 -----METLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTAQLGFHKAAAELL 312

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 90/338 (26%), Positives = 147/338 (43%), Gaps = 62/338 (18%)

Query: 3   NYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIED 62
           N F      KL    T+V+ +TQD  + A               ++ +  +QE LG + D
Sbjct: 4   NAFASSLSKKLQELSTSVSERTQDLPNLA---------------QSTQRMVQERLGQVTD 48

Query: 63  ISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFG 122
           IS+LP +Y  LE K D+++ +    L VT  YE   YDYP  ++ES++++ SS    L  
Sbjct: 49  ISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSSSLASKLTE 108

Query: 123 FV---SSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTAL-KTEEQKASAXXX 178
                S+S+ +  L      KE   P++   A+SK A +S E +  +  TEEQ  +    
Sbjct: 109 LTHATSASQAQNILVAPGPIKE---PKTLNYALSKVALNSSECLNKMFPTEEQPLA---- 161

Query: 179 XXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKV 238
                 +SL++    +S  Q  + Q++ + D L+  +FN KL   V  +   A   RK+V
Sbjct: 162 ------SSLLQ----FSDVQAKIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEV 211

Query: 239 EDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKLE 298
              RL++D  R  L  A  +   +EA+ + +                        +E LE
Sbjct: 212 HSMRLRYDVARTNL--ANNKKPEKEASLRVQ------------------------METLE 245

Query: 299 DEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYY 336
           D+F   T +A   + E+   A     +K     Q  Y+
Sbjct: 246 DQFGQVTEDATVCLQEVISHANFTEDLKELAKAQAEYF 283

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 92/361 (25%), Positives = 149/361 (41%), Gaps = 63/361 (17%)

Query: 8   FSLNKLTNSIT--------NVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGT 59
            S N L +SI         +V+ KTQ+  ST  A  Q+   Q +L+        QE LG 
Sbjct: 1   MSFNNLKSSIGQALQGLSESVSQKTQEMASTWPAYAQV---QQRLA--------QEKLGQ 49

Query: 60  IEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDW---WSSN 116
           I DIS++P +Y  LE + D+L+   + +L VT+ YE   YD+P +  ES+ DW     S 
Sbjct: 50  ITDISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQDWSRAIGSR 109

Query: 117 KEGLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAX 176
            + L    S+S+    L+     +    PR+   A+S+A+      ++ L +        
Sbjct: 110 VQELSRASSASEAGNLLKSPVGPENG--PRTLNYALSQASL----AVSTLTSSNMPGPNG 163

Query: 177 XXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRK 236
                  I        A+S  Q  + Q +   D  +  +FN +L   +      A   RK
Sbjct: 164 EGLSSGLI--------AYSDTQAKLAQIRIAQDTQVQTKFNKQLREILNNPIAKANKYRK 215

Query: 237 KVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEK 296
            V+  R+ +D  R  L+ A  +   +EA+ + E                        +E 
Sbjct: 216 DVQYKRVLYDIARTNLQNARPE---KEASLRVE------------------------MET 248

Query: 297 LEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEGD 356
           LED+F   T EA   M E   +  ++  V      Q  YYKQ ++ +   +   N  +GD
Sbjct: 249 LEDQFAQITEEATIVMQETLSNTHLLKNVAELAEIQKNYYKQSLELMNDLMPVFNTAKGD 308

Query: 357 E 357
           +
Sbjct: 309 D 309

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 80.1 bits (196), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 87/345 (25%), Positives = 143/345 (41%), Gaps = 67/345 (19%)

Query: 20  VAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDISKLPPQYQFLEKKCDS 79
           V  KTQD  ST  +  Q                +QE LG I DIS++P +Y  +EK+ D 
Sbjct: 41  VTQKTQDLTSTLPSIAQ-----------TTHRMVQEKLGQITDISQMPEEYVHMEKRVDK 89

Query: 80  LEKVCRRMLVVTKTYEVEGYDYPPNLSES---LSDWWSSNKEGLFGFVSSSKKEKKL--- 133
           +  +    L VT+ YE E YDYP ++SES   +S   +   + L    S+ + +  L   
Sbjct: 90  IRLIYENFLKVTQIYESETYDYPQHVSESVNEISKTVTGKIQELTKATSTEEAQNILISP 149

Query: 134 EPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAXXXXXXXXITSLIKMFEA 193
            PA+D      P++   A+SK +  S E ++   ++              +T+ I +   
Sbjct: 150 GPAKD------PKTLNYALSKVSLTSSEYLSKSGSDSN------------VTADILL--K 189

Query: 194 WSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELK 253
           +S  Q  + Q++ + D L+   FN +L   +  +F  A   RK+V++ RL++D  R    
Sbjct: 190 YSDIQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIARANFS 249

Query: 254 MAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKLEDEFVSNTTEAVETMG 313
            A                KP+                   +E LEDEF      ++  M 
Sbjct: 250 AA----------------KPEKQASLRVH-----------METLEDEFAEAMDVSISFMQ 282

Query: 314 EITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEGDEA 358
            + + +E +         QL Y+K   + L   ++S   LE D A
Sbjct: 283 SVMEKSEFLKEFSELVGAQLKYHKVAAELLSDFVSS---LEADSA 324

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 79.3 bits (194), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 85/321 (26%), Positives = 140/321 (43%), Gaps = 62/321 (19%)

Query: 3   NYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIED 62
           N F      KL    T+V+ KTQ+  S A               ++ +  +QE LG + D
Sbjct: 4   NAFASSLSKKLQEISTSVSEKTQELPSLA---------------QSTQRMVQERLGQVTD 48

Query: 63  ISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFG 122
           IS+LP +Y  LE+K D+++ +    L VT  YE   YDYP  ++ES++++  S    L  
Sbjct: 49  ISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTE 108

Query: 123 FV---SSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMT-ALKTEEQKASAXXX 178
                S+S+ +  L      KE   P++   A+SK A +S E +   L TEEQ  +    
Sbjct: 109 LTHATSASEAQNILVAPGPIKE---PKTLNYALSKVALNSSECLNKMLPTEEQPLA---- 161

Query: 179 XXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKV 238
                 ++L++    +S  Q  + Q++ + D L+  +FN  L   +  +   A   RK V
Sbjct: 162 ------SALLQ----FSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDV 211

Query: 239 EDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKLE 298
              RL++D  R  L  A  +   +EA+ + +                        +E LE
Sbjct: 212 HSMRLRYDVARTNL--ANNKKPEKEASLRVQ------------------------METLE 245

Query: 299 DEFVSNTTEAVETMGEITDSA 319
           D+F   T +A   + E+   A
Sbjct: 246 DQFAQVTEDATVCLQEVISHA 266

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 84/321 (26%), Positives = 139/321 (43%), Gaps = 62/321 (19%)

Query: 3   NYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIED 62
           N F      KL    T+V+ KTQ+  S A               ++ +  +QE LG + D
Sbjct: 4   NAFASSLSKKLQEISTSVSEKTQELPSLA---------------QSTQRMVQERLGQVTD 48

Query: 63  ISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFG 122
           IS+LP +Y  LE K D+++ +    L VT  YE   YDYP  ++ES++++  S    L  
Sbjct: 49  ISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTE 108

Query: 123 FV---SSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTAL-KTEEQKASAXXX 178
                S+S+ +  L      KE   P++   A+SK A +S E +  +  TEEQ  +    
Sbjct: 109 LTHATSASEAQNILVAPGPIKE---PKTLNYALSKVALNSSECLNKMFPTEEQPLA---- 161

Query: 179 XXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKV 238
                 ++L++    +S  Q  + Q++ + D L+  +FN  L   +  +   A   RK V
Sbjct: 162 ------SALLQ----FSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDV 211

Query: 239 EDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQKLLEKLE 298
              RL++D  R  L  A  +   +EA+ + +                        +E LE
Sbjct: 212 HSMRLRYDVARTNL--ANNKKPEKEASLRVQ------------------------METLE 245

Query: 299 DEFVSNTTEAVETMGEITDSA 319
           D+F   T +A   + E+   A
Sbjct: 246 DQFAQVTEDATVCLQEVISHA 266

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 117/291 (40%), Gaps = 50/291 (17%)

Query: 53  LQETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDW 112
           ++E LG ++DIS LP +Y  LE K D+ + V    L +T  YE E YDYP   SES++++
Sbjct: 39  VKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFSESVNEF 98

Query: 113 WSSNKEGLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQK 172
             S    ++ F +    E              PR+   A+SK +  + E    L   + K
Sbjct: 99  TDSIGNKMYEFSNGVSTE--------GSSGKTPRTLNYAVSKVSMGASEQFQKLHDTDDK 150

Query: 173 ASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNAR 232
             A              +       + ++ +++   D  +  +FN +L   + +  + A 
Sbjct: 151 RIA-------------NLLTNVGNAEASIAEARLLQDHSIQAKFNFQLREEIAQSIERAS 197

Query: 233 TLRKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQK 292
             RK+V   RLK+D  R +    E+ G  +                              
Sbjct: 198 KYRKEVYHKRLKYDIAREKYSKHEKNGTVKVE---------------------------- 229

Query: 293 LLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNL 343
            LE LEDEF   T +A+  M EI  +      +K F   +L Y+++ V  L
Sbjct: 230 -LEILEDEFNHATKDAIMVMQEIISNNRFEQNLKDFAAAKLAYHEKSVDAL 279

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 100/203 (49%), Gaps = 19/203 (9%)

Query: 53  LQETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDW 112
           +QE LG + DIS+LP +Y  LE K D+++ +    L VT  YE   YDYP  ++ES++++
Sbjct: 39  VQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEF 98

Query: 113 WSSNKEGLFGF---VSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTE 169
             S    L       S+S+ +  L      KE   P++   A+SK + +S E +  +   
Sbjct: 99  SRSVASKLTELTHATSASEAQNILVAPGPIKE---PKTLNYALSKVSLNSSECLNKMFPA 155

Query: 170 EQKASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFK 229
           E++  A         ++L++    +S  Q  + Q++ + D L+  +FN KL   +  +  
Sbjct: 156 EEQPLA---------SALLQ----FSDVQAKIAQTRIQQDTLIQTKFNKKLRERLSFEIG 202

Query: 230 NARTLRKKVEDSRLKFDTMRYEL 252
            A   RK V   RL++D  R  L
Sbjct: 203 KADKCRKDVHSMRLRYDVARTNL 225

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 104/221 (47%), Gaps = 34/221 (15%)

Query: 53  LQETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDW 112
           +QE  G + DIS LP +Y  LE++ DS++ V    L +T  YE E YDYP ++ +S++++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 113 W---SSNKEGLFGFV----SSSKKEKKLEPAEDSKEAL---------MPRSFAQAISKAA 156
               SS  + L   +     +S     +EP   S  ++          PR+   A+SKAA
Sbjct: 61  QKTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNSPRTLNNALSKAA 120

Query: 157 KDSGEVMTALKTEEQKASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEF 216
             + E    LK ++  ++               +F ++S  +  +   + + D ++ K F
Sbjct: 121 LFAAE---QLKMDKDSST---------------VFHSFSEAESIISDERIKQDKIIQKSF 162

Query: 217 NHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKMAEE 257
           N +L   +  +   A   RK V++ RL++D  R +L  A E
Sbjct: 163 NTELKNVLTNRIDVANKHRKDVQNKRLQYDISRTKLDHASE 203

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 67.4 bits (163), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 126/300 (42%), Gaps = 50/300 (16%)

Query: 53  LQETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDW 112
           ++E LG  +DIS LP +Y  LE K D+++++    L VT  YE E YDYP    ES   W
Sbjct: 39  MKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESF--W 96

Query: 113 WSSNKEGLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQK 172
             ++  G        +K   L  +E + +  +P++   A+      + E +  L      
Sbjct: 97  EFTDSVG--------EKFSALNISEHNNKVKIPKTLNYALHNVFLTANEKVKLL------ 142

Query: 173 ASAXXXXXXXXITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNAR 232
                        SL +   + S  + ++ +++   D+L+    N++L   + + F+ A 
Sbjct: 143 -------HEPLDNSLSETLASLSETEADIAEARLHQDSLVKSRINYQLKEELSQNFERAA 195

Query: 233 TLRKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQXXXXXXXXXXXXXXXXQK 292
             RK V   R  +D  +   + A+ + +   +AQ                          
Sbjct: 196 KYRKAVHHKRFNYDVAKTNFEHAKPEKQATLSAQ-------------------------- 229

Query: 293 LLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNE 352
             + L+DEF   T +A   M EI  ++ + +++K     QL+Y+++    L   +++ N+
Sbjct: 230 -ADILKDEFEQATKDATIVMQEIISNSRLEHILKELAVSQLVYHQRSTDLLNKFLDAQND 288

>NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4.340
          Length = 1495

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 11/61 (18%)

Query: 22   HKTQDTLSTAIANIQLDDPQAK----LSLK-------ARKHYLQETLGTIEDISKLPPQY 70
            HK     S  IA + L DPQ +    L+LK        +  Y +E L  I D+ ++P QY
Sbjct: 1434 HKLSKDKSLGIAQVNLGDPQIQKDENLALKLNDGHVIIKLDYAKEALENIPDVPQIPEQY 1493

Query: 71   Q 71
            Q
Sbjct: 1494 Q 1494

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 8/67 (11%)

Query: 4    YFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETL----GT 59
            YF    L +++NS+T V +++    +T + +I LD    KL+L   + Y++E      GT
Sbjct: 1813 YFNQLKLLRISNSVTKVDYRS----NTLLTDIGLDTDIVKLTLSDNRVYIEELTDSLNGT 1868

Query: 60   IEDISKL 66
            + ++ K+
Sbjct: 1869 VSELIKI 1875

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.125    0.339 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,385,204
Number of extensions: 1307682
Number of successful extensions: 5146
Number of sequences better than 10.0: 89
Number of HSP's gapped: 5191
Number of HSP's successfully gapped: 104
Length of query: 358
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 247
Effective length of database: 40,753,473
Effective search space: 10066107831
Effective search space used: 10066107831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)