Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14784g3.490ON1951959111e-126
Kwal_55.212263.490ON1961935642e-73
SAKL0F02816g3.490ON1921963504e-41
Ecym_12393.490ON1931942825e-31
ZYRO0D10032g3.490ON2091962793e-30
TDEL0D055803.490ON1931962703e-29
NCAS0E008203.490ON2022002462e-25
AFR308W3.490ON1921922373e-24
KLLA0E04643g3.490ON2211912281e-22
Kpol_480.153.490ON2071992217e-22
NDAI0G009503.490ON2132052096e-20
Suva_7.4173.490ON2122192025e-19
Skud_7.4403.490ON2132102027e-19
YGR129W (SYF2)3.490ON2152181922e-17
TPHA0D042403.490ON2092111833e-16
Smik_6.2253.490ON2132131817e-16
TBLA0C044703.490ON2222141791e-15
CAGL0I10538g3.490ON2001901702e-14
KAFR0C019503.490ON1571891131e-06
KNAG0B008203.490ON207201910.002
CAGL0I04422g3.178ON42257730.58
Kpol_1060.75.10ON146034692.1
TPHA0C007108.341ON93456673.2
KAFR0G011107.437ON21460629.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14784g
         (195 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...   355   e-126
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...   221   2e-73
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...   139   4e-41
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...   113   5e-31
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   112   3e-30
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   108   3e-29
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    99   2e-25
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    96   3e-24
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    92   1e-22
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    90   7e-22
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    85   6e-20
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    82   5e-19
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    82   7e-19
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    79   2e-17
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    75   3e-16
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...    74   7e-16
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    74   1e-15
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    70   2e-14
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    48   1e-06
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    40   0.002
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    33   0.58 
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...    31   2.1  
TPHA0C00710 Chr3 complement(135151..137955) [2805 bp, 934 aa] {O...    30   3.2  
KAFR0G01110 Chr7 (252842..253486) [645 bp, 214 aa] {ON} Anc_7.43...    28   9.4  

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score =  355 bits (911), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 177/195 (90%), Positives = 177/195 (90%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXXXXXXX 60
           MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSM              
Sbjct: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTEES 60

Query: 61  XXXXLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKPK 120
               LLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKPK
Sbjct: 61  KEAKLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKPK 120

Query: 121 KVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEKNKQ 180
           KVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEKNKQ
Sbjct: 121 KVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEKNKQ 180

Query: 181 FNDKIERQTKKREEN 195
           FNDKIERQTKKREEN
Sbjct: 181 FNDKIERQTKKREEN 195

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score =  221 bits (564), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 139/193 (72%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXXXXXXX 60
           MDL+KYADRLKNLKRK + LSVKNK ++++EEK  SA  KPAVYSM              
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60

Query: 61  XXXXLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKPK 120
               LL+YSM ++EQWQDK ++ S +    A +QDLAK TYDKEVQQL K   N+V K  
Sbjct: 61  EANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNKNT 120

Query: 121 KVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEKNKQ 180
           K  +N KGKIVV+DD  LV  L ++LNKTA+ERYARI+KKI RQM + T GG+INEKNKQ
Sbjct: 121 KYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEKNKQ 180

Query: 181 FNDKIERQTKKRE 193
           FNDK+ERQTKKRE
Sbjct: 181 FNDKLERQTKKRE 193

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score =  139 bits (350), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 120/196 (61%), Gaps = 5/196 (2%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXXXXXXX 60
           MDL     +LK LKRKGV +SVKN+++  +EEKQ     KP VYSM              
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMNEDETFKDQKEEDT 60

Query: 61  XXXXLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKPK 120
               LL YS+KD+E+WQ K R    K+SD +  QDLAK+TYDKE++++ K+ +    K  
Sbjct: 61  RGK-LLNYSIKDYEKWQLK-RTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKVT 118

Query: 121 KVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIE-KKIHRQMVSDTPGGFINEKNK 179
           K  +N KG+I + DD   +  LAD+LNK+   RY  IE KK   ++ S T GGFIN+KNK
Sbjct: 119 KARLNGKGRIQINDDKKSLEQLADNLNKSTKRRY--IERKKQAEKLDSSTTGGFINDKNK 176

Query: 180 QFNDKIERQTKKREEN 195
           QFN+K+ RQ K+ ++N
Sbjct: 177 QFNEKLSRQFKQFDDN 192

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score =  113 bits (282), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 111/194 (57%), Gaps = 9/194 (4%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSM--XXXXXXXXXXXX 58
           MD++  + RL+ LK K V +S+KN+++I+ EE     R+KP VYS+              
Sbjct: 1   MDIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60

Query: 59  XXXXXXLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEK 118
                 LL YS+ D+E+W +KE+   Q + D     D+A  TY  E++QLRK    K  K
Sbjct: 61  NTERRKLLNYSLIDYEKWDEKEK---QANFDGTYSGDIAYSTYKNEIKQLRKGGLTK-GK 116

Query: 119 PKKVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKI--HRQMVSDTPGGFINE 176
             K  I++ GK+ ++D+  LV  LA +L KT+ ER+ R +K++  H+   S+  G F+NE
Sbjct: 117 ITKGRISESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSEL-GNFVNE 175

Query: 177 KNKQFNDKIERQTK 190
           KN+ FN+K+ RQ K
Sbjct: 176 KNRHFNEKLSRQFK 189

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  112 bits (279), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 110/196 (56%), Gaps = 10/196 (5%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXXXXXXX 60
           MDL+++      LK+K   +SV+N++ +  E K+ +A  KP VY +              
Sbjct: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPSLPTQDDKH 70

Query: 61  XXXXLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKN------YTN 114
               L+ Y+++ +E+W  ++R ++ K  D    QD+AK+TYDKE+ +L K+      YTN
Sbjct: 71  GNQ-LMNYTIQQYEEWNSRQRDQTNKR-DSGNLQDMAKYTYDKELNKLHKDTMLQNRYTN 128

Query: 115 KVEKPKKVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMV--SDTPGG 172
                K     K GK+ +KDD  LV  LA  ++KTA ERY    +++ R  V  + + GG
Sbjct: 129 GGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQNASSGGG 188

Query: 173 FINEKNKQFNDKIERQ 188
           +INEKNKQFN+K++RQ
Sbjct: 189 YINEKNKQFNEKLDRQ 204

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  108 bits (270), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 112/196 (57%), Gaps = 7/196 (3%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXX--XXX 58
           MDL    +R K+LK++ V ++++ ++   +E K  S   KP +YSM              
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60

Query: 59  XXXXXXLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEK 118
                 L+ YSM+++E+W  K++ K  K    A  Q+LAK++Y+K++ + ++N  N+V  
Sbjct: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGG-ANVQELAKYSYEKDLSRSKQNNGNRV-- 117

Query: 119 PKKVSINKK-GKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEK 177
             K+S + K  ++ VKDD  LV  LA+ L KT  ER+   +K + +     TPGG+INEK
Sbjct: 118 -VKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEK 176

Query: 178 NKQFNDKIERQTKKRE 193
           NKQFN K++RQ K+ E
Sbjct: 177 NKQFNLKLDRQMKETE 192

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 99.4 bits (246), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 110/200 (55%), Gaps = 7/200 (3%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXXXXXXX 60
           +DL  Y+ +LK LKRK    +++N+  + +E K   +  KP VY+M              
Sbjct: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61

Query: 61  XX---XXLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVE 117
                  L+ Y+++ +E+W+ K++ K  K       Q LA F+YDK V  L +  T+K  
Sbjct: 62  ADDKVAKLMNYTLRQYEEWEKKQKDKKIKDDSSDMKQ-LAMFSYDKGVSNLNRFRTDKTT 120

Query: 118 KPKKVSI---NKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFI 174
             ++V I   +K GK+ ++D+  LV  LA +L KTAN+RY   +KK+  +    +  G+I
Sbjct: 121 TEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYI 180

Query: 175 NEKNKQFNDKIERQTKKREE 194
           NE+NK FN+K++R+++  EE
Sbjct: 181 NERNKHFNEKLDRESRYGEE 200

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 95.9 bits (237), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 103/192 (53%), Gaps = 7/192 (3%)

Query: 2   DLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXXXXXXXX 61
           D+N+   RL+ LK+K V  S++N+++   EE+   A  KP VYSM               
Sbjct: 5   DINR---RLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQS 61

Query: 62  XX-XLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKPK 120
               LL Y + D+E+W +K++R  Q  SD A   +LA  TY  E+ QL +    K  +  
Sbjct: 62  EQLKLLNYRIADYEKWDEKQKRHKQ-PSDGADLGELANSTYRSELHQLHRRGVVKG-RAT 119

Query: 121 KVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEKNKQ 180
              I+  GK+V+ D+P LV  LA ++ +TA  R+   +KK  +     T G  +N+KN+ 
Sbjct: 120 NGRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS-LNDKNRH 178

Query: 181 FNDKIERQTKKR 192
           FN+K++R+ +KR
Sbjct: 179 FNEKLDREFRKR 190

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 92.4 bits (228), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 105/191 (54%), Gaps = 9/191 (4%)

Query: 2   DLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXXXXXXXX 61
           DL +   +LK+L+++ V +S++NK+ I+ EEK+ S R    VYSM               
Sbjct: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSERR---VYSMADDGEDKARSNKSEP 94

Query: 62  XX--XLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKP 119
                L  YS++++E+W+ K +      S +  +Q +AK +Y KEV  L K+    +  P
Sbjct: 95  EDPIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKD----ISHP 150

Query: 120 KKVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEKNK 179
            K  I + GK+ V+D+P LV  + + LN+ + +RY   ++K+ +Q   +   GFIN+KNK
Sbjct: 151 LKGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKNK 210

Query: 180 QFNDKIERQTK 190
           +FN K+  + K
Sbjct: 211 RFNAKLNSEFK 221

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 89.7 bits (221), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 104/199 (52%), Gaps = 8/199 (4%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXX-XXXXXXXXXXX 59
           M++ +  +  K LKRK V + ++N++ +    ++    +KP  YSM              
Sbjct: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTV 62

Query: 60  XXXXXLLQYSMKDFEQWQDKERRKSQK----SSDVAKYQDLAKFTYDKEVQQLRKNYTNK 115
                LL YS++++E+W+ K+ R  +      S V     +AKFTYDK++++L+K  +  
Sbjct: 63  DEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKSTN 122

Query: 116 VEKPKKVSINK---KGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGG 172
             + K   I K    GKIVV D   L+  LA+ LN+T  ERY R  +K  +    +    
Sbjct: 123 DNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYS 182

Query: 173 FINEKNKQFNDKIERQTKK 191
           +INEKNK+FNDK+ERQ  K
Sbjct: 183 YINEKNKEFNDKLERQETK 201

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 85.1 bits (209), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 114/205 (55%), Gaps = 13/205 (6%)

Query: 2   DLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXXXX---- 57
           +L+ Y + LK LKR  + +  +N+++  QE K+ S  +KP VY +               
Sbjct: 5   ELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDG 64

Query: 58  -------XXXXXXXLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRK 110
                         L+ Y+++++E+W  +++ K +K  D +   +LA FTY+KE+ +L  
Sbjct: 65  LGDFSNEEEKRKFKLMNYTIREYEEWDKQQKDKQRKRVDGSDLTELATFTYEKELSKLNS 124

Query: 111 NYTN-KVEKPKKVSIN-KKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSD 168
              N   E+  ++ +N + GK+ VKD+  L+ +L ++LN+TA +RY   +KK+  +  SD
Sbjct: 125 KLENISHEQKHQIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASSD 184

Query: 169 TPGGFINEKNKQFNDKIERQTKKRE 193
             G +  +KNKQFN+K+ER+ K+R+
Sbjct: 185 IAGNYFKDKNKQFNEKLERELKERD 209

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 82.4 bits (202), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 72/219 (32%), Positives = 112/219 (51%), Gaps = 33/219 (15%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXX-XXXXXX 59
           MDL +  ++LK LKR+ V  S+K ++   +E ++ S+  KP VYSM              
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKS 60

Query: 60  XXXXXLLQYSMKDFEQWQDKER-RKSQKSSDVA-KYQDLAKFTYDKEVQQLR-KNYT--- 113
                   Y+++++  W+ K++ RKS K+      Y  LAK +YDK ++ L  +NY    
Sbjct: 61  DDKDRAFHYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHE 120

Query: 114 --------------NKVEKPKKVSINKKGKIVVKDDPHLVGSLADSLNKTANERY-ARIE 158
                         +++EK +K SI   GKI + DD  LV  LA +L   + +R+ AR  
Sbjct: 121 SSVNEKDSKGSLGKSRIEKIQKNSIT--GKIRIVDDDELVNKLASTLESDSKKRHDAR-- 176

Query: 159 KKIHRQMVS-DTPGG---FINEKNKQFNDKIERQTKKRE 193
               RQM +  TP G   FIN+KNKQFN+K+ R+++  E
Sbjct: 177 ---KRQMENVKTPSGVESFINDKNKQFNEKLGRESRGSE 212

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 82.4 bits (202), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 102/210 (48%), Gaps = 20/210 (9%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXX--XXXX 58
           M+L+K   +LK LKRKGV++S+KN++   +E ++     KP VYSM              
Sbjct: 1   MELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAE 60

Query: 59  XXXXXXLLQYSMKDFEQWQDKE--RRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKV 116
                    Y+++++  W+ K+  R+  Q       Y  +AK +Y+K ++ L    +NK 
Sbjct: 61  TSDKDKAFHYTVQEYNAWKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNKN 120

Query: 117 E----------KPKKVSINK------KGKIVVKDDPHLVGSLADSLNKTANERYARIEKK 160
           E           PK  +I+K       GKI + DD  LV  LA +L   + +RY    K+
Sbjct: 121 ENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQ 180

Query: 161 IHRQMVSDTPGGFINEKNKQFNDKIERQTK 190
           +       +   FIN+KNKQFN+K+ R+ K
Sbjct: 181 MENAKTPSSVESFINDKNKQFNEKLSREPK 210

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score = 78.6 bits (192), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 103/218 (47%), Gaps = 28/218 (12%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMX--XXXXXXXXXXX 58
           MD  K  ++LK LKRK V +S+K+++   +E ++ SA  KP VYSM              
Sbjct: 1   MDFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTE 60

Query: 59  XXXXXXLLQYSMKDFEQWQDKERRKSQKSSDVAK-----YQDLAKFTYDKEVQQLRKNYT 113
                    Y++++++ W   ERR  Q  +  ++     Y  LAK +Y+K ++ L     
Sbjct: 61  SPEKEKAFHYTVQEYDAW---ERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQ 117

Query: 114 NKVEK------------PKKVSINK------KGKIVVKDDPHLVGSLADSLNKTANERYA 155
           N  ++            PKK  I K       GKI + DD  LV  LA SL   + +RY 
Sbjct: 118 NSSKQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYE 177

Query: 156 RIEKKIHRQMVSDTPGGFINEKNKQFNDKIERQTKKRE 193
             ++++           FIN+KNKQFN+K+ R++K  E
Sbjct: 178 ARKRQMQNAKTLYGVESFINDKNKQFNEKLSRESKGSE 215

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 75.1 bits (183), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 103/211 (48%), Gaps = 28/211 (13%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXXXX--- 57
           MD+    D  K LK++ +   +++++ +  +EK+  +  KP VYS+              
Sbjct: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDL 60

Query: 58  -XXXXXXXLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDL----AKFTYDKEVQQLRKN- 111
                   LL Y+++D+E+W++  +RK +  ++ +         AKFTYDKE+ +++K  
Sbjct: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQ 120

Query: 112 --YTNKVEKPKKVSINK---KGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMV 166
             +    E  +  ++ +    GK+++KDD HLV      +NK +N+RY    K++    V
Sbjct: 121 GKFATDEEITRGSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRYI---KRMKLNAV 177

Query: 167 SDTPGG-----------FINEKNKQFNDKIE 186
           ++   G           + N KNK FNDK+E
Sbjct: 178 NNDATGSKVSHDKGKTSYNNAKNKDFNDKLE 208

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 74.3 bits (181), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 105/213 (49%), Gaps = 20/213 (9%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXXX--XX 58
           M+L++   RLK LK+K V++S+KN++   +E ++ +   KP VY+M              
Sbjct: 1   MNLDQLEQRLKELKKKRVNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTE 60

Query: 59  XXXXXXLLQYSMKDFEQWQDK--ERRKSQKSSDVAKYQDLAKFTYDKEVQQLRK------ 110
                    Y+ +++  W+ +  +R+  Q       Y  LAK +Y+K ++ L        
Sbjct: 61  SSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEY 120

Query: 111 -NYTN--------KVEKPKKVSINKK-GKIVVKDDPHLVGSLADSLNKTANERYARIEKK 160
            N+ N        K+ +  ++  + K GKI + DD  LV  LA SL   + +RY   +++
Sbjct: 121 DNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQ 180

Query: 161 IHRQMVSDTPGGFINEKNKQFNDKIERQTKKRE 193
           +   ++      FIN+KNKQFN+K+ R+++  E
Sbjct: 181 MESAVIPSGVESFINDKNKQFNEKLSRESRNSE 213

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 73.6 bits (179), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 100/214 (46%), Gaps = 26/214 (12%)

Query: 2   DLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXX----------XX 51
           D+N+     K LK K  +  + N+  +     +++   KP VYSM               
Sbjct: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62

Query: 52  XXXXXXXXXXXXXLLQYSMKDFEQWQDK------ERRKSQKSSDVAKYQDLAKFTYDKEV 105
                        L+ Y++++++ W+ K      E + + K   +     LAK TYDK++
Sbjct: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDI 122

Query: 106 QQLRK-----NYTNKVEKPKKV---SINKKGKIVVKDDPHLVGSLADSLNKTANERYARI 157
           ++L K     N  NK  KP K+     N+  KIV+KDD  LV  L ++L   ++  Y  +
Sbjct: 123 RKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLYKHL 182

Query: 158 EKKIHRQMVSDTPGGFINEKNKQFNDKIERQTKK 191
            ++  R+  S T  G +N KN++FN+K+ R+ KK
Sbjct: 183 GER--RKNYSTTLSGHVNTKNQEFNEKLTREWKK 214

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 70.1 bits (170), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 94/190 (49%), Gaps = 9/190 (4%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMX----XXXXXXXXX 56
           M+L  Y ++LK LK+    + ++N+  + QE ++     KP VYSM              
Sbjct: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSD 60

Query: 57  XXXXXXXXLLQYSMKDFEQWQDKERRKSQKSSDV---AKYQDLAKFTYDKEVQQLRKNYT 113
                   L QY+++DF  W+ +++RK +   +     + Q LAK TYDKE+Q L +   
Sbjct: 61  EQSDMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120

Query: 114 NKVEKPKKVSINK-KGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGG 172
               K  +  INK  GK+ +KD+  LV  L+ +L +TA +RY    +KI       +  G
Sbjct: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDS-NRKIANDKEHTSLSG 179

Query: 173 FINEKNKQFN 182
            IN KN QFN
Sbjct: 180 SINAKNLQFN 189

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 82/189 (43%), Gaps = 41/189 (21%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXXXXXXXXX 60
           MD+    +  ++L++K   + ++N++ I       S  +KP  YS+              
Sbjct: 3   MDMANLREEFRDLRKKCREIKIENRKLI-------SIASKPKTYSIREEEIGAEVSDEDE 55

Query: 61  XXXXLLQYSMKDFEQWQDKERRKSQKSSDVAKY-QDLAKFTYDKEVQQLRKNYTNKVEKP 119
               +++   K   +++          + VA+  +D+ + TY+KEV  L K     VE  
Sbjct: 56  DDSEIIKLLTKPLREFE--------TEAHVAENKEDIDRLTYNKEVMSLGKREKRDVE-- 105

Query: 120 KKVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEKNK 179
                                SL   +N+ ++ERY +  +K  R+ + DT  GFINE+NK
Sbjct: 106 ---------------------SLVSEMNRISDERYKKGAQK--RRRLKDTERGFINEQNK 142

Query: 180 QFNDKIERQ 188
            FN ++E++
Sbjct: 143 AFNLRLEKE 151

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 82/201 (40%), Gaps = 47/201 (23%)

Query: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMXXXXXXX----XXX 56
           M L +  D+ K L ++   L V+ ++Q  + EK       P VYS+              
Sbjct: 35  MGLTELRDKFKTLSQESQRLRVRIRKQQAEVEK-------PKVYSLQAAEPSVDGIDGAE 87

Query: 57  XXXXXXXXLLQYSMKDFEQWQDKERRKSQKSSD-VAKYQD--LAKFTYDKEVQQL----- 108
                   LL   ++   Q + +E R+ +   D VA+ +   +AK TY KE+  L     
Sbjct: 88  VVDNVTVKLLNTPLR---QLEAREARRGENGDDAVARVEGDRVAKDTYKKELALLGRKST 144

Query: 109 RKNYTNKVEKPKKVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMV-- 166
           R  Y + VE+                       L   LN  + +RY   + K+ RQ    
Sbjct: 145 RGTYRDNVER-----------------------LVTHLNDVSKKRYLVRKNKMKRQGARG 181

Query: 167 SDTPGGFINEKNKQFNDKIER 187
             +  G+INEKNKQFN K++R
Sbjct: 182 GSSLDGYINEKNKQFNKKLQR 202

>CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some
           similarities with uniprot|P22209 Saccharomyces
           cerevisiae YAR018c KIN3 ser/thr protein kinase
          Length = 422

 Score = 32.7 bits (73), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 12/57 (21%)

Query: 101 YDKEVQQLRKNYTNKVEKPKKVSIN-KKGKIVVKDDPHLVGSLADSLNKTANERYAR 156
           YDKEV QLR+ +T  VE+  +  IN KKG            S+ DS+N  A  R A+
Sbjct: 367 YDKEVSQLREQFTKAVEERAREIINGKKGP-----------SIPDSINNYAATRIAK 412

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score = 31.2 bits (69), Expect = 2.1,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 80   ERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYT 113
            E  K+QKS+  +K Q+L KF  D+EV++   N++
Sbjct: 1320 EEVKTQKSTGNSKVQELHKFHLDQEVEEEGSNFS 1353

>TPHA0C00710 Chr3 complement(135151..137955) [2805 bp, 934 aa] {ON}
           Anc_8.341 YLR138W
          Length = 934

 Score = 30.4 bits (67), Expect = 3.2,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 79  KERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKPKKVSINKKGKIVVKD 134
           K RR++    ++ K Q+    + D   +++R+N T     PK VSI+++G ++ +D
Sbjct: 804 KNRREAISDQNLNKEQNDIAHSEDPFTKKMRRNLT---PAPKNVSISREGSLIDED 856

>KAFR0G01110 Chr7 (252842..253486) [645 bp, 214 aa] {ON} Anc_7.437
           YBL102W
          Length = 214

 Score = 28.5 bits (62), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 13/60 (21%)

Query: 102 DKEVQQLRKNY----TNKVEKPKKVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARI 157
           D ++ QLR++     TN+ ++P+  SIN+  K        +  S ADS+N+ A++ Y R+
Sbjct: 6   DSQINQLRESLNRWSTNRTQEPQ--SINESAK-------TMFASWADSINERASDIYQRL 56

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,486,212
Number of extensions: 776988
Number of successful extensions: 3764
Number of sequences better than 10.0: 109
Number of HSP's gapped: 3712
Number of HSP's successfully gapped: 110
Length of query: 195
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 91
Effective length of database: 41,556,135
Effective search space: 3781608285
Effective search space used: 3781608285
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 63 (28.9 bits)