Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14762g3.489ON65065034160.0
SAKL0F02838g3.489ON65462719080.0
AFR307C3.489ON65065816610.0
KLLA0E04665g3.489ON64762216270.0
Kpol_480.163.489ON65565816150.0
ZYRO0D10054g3.489ON66467115830.0
TDEL0D055703.489ON64966215570.0
NCAS0E008303.489ON67168115580.0
TPHA0D042303.489ON65266015180.0
Suva_7.4163.489ON71371514540.0
Kwal_55.212223.489ON37337314140.0
TBLA0C044603.489ON69870314260.0
Smik_6.2243.489ON70571214240.0
Skud_7.4393.489ON71371614140.0
YGR128C (UTP8)3.489ON71371414130.0
NDAI0G009603.489ON70067713870.0
CAGL0I10560g3.489ON67865512881e-169
Kwal_55.21225singletonOFF2152138331e-107
KNAG0B008303.489ON6076738012e-97
KAFR0C019403.489ON6096417784e-94
CAGL0J00451gsingletonON332201810.29
Kwal_55.207034.32ON90665725.3
Ecym_40685.533ON63095716.5
Ecym_36121.527ON131575716.7
Suva_9.1487.238ON145102677.2
Kpol_478.44.32ON91372708.2
Smik_16.3713.455ON1208147708.9
KNAG0I025406.325ON91878709.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14762g
         (650 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...  1320   0.0  
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   739   0.0  
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   644   0.0  
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   631   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   626   0.0  
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   614   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   604   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   604   0.0  
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   589   0.0  
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   564   0.0  
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   549   0.0  
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   553   0.0  
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   553   0.0  
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   549   0.0  
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   548   0.0  
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   538   0.0  
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   500   e-169
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   325   e-107
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   313   2e-97
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   304   4e-94
CAGL0J00451g Chr10 complement(36171..37169) [999 bp, 332 aa] {ON...    36   0.29 
Kwal_55.20703 s55 (524084..526804) [2721 bp, 906 aa] {ON} YLL026...    32   5.3  
Ecym_4068 Chr4 (148971..150863) [1893 bp, 630 aa] {ON} similar t...    32   6.5  
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...    32   6.7  
Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}...    30   7.2  
Kpol_478.4 s478 (15750..18491) [2742 bp, 913 aa] {ON} (15750..18...    32   8.2  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...    32   8.9  
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    32   9.3  

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score = 1320 bits (3416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/650 (100%), Positives = 650/650 (100%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60
           MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60

Query: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS 120
           KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS
Sbjct: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS 120

Query: 121 SFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSY 180
           SFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSY
Sbjct: 121 SFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSY 180

Query: 181 VQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFY 240
           VQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFY
Sbjct: 181 VQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFY 240

Query: 241 QFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAPESIISFKPISTNRALLTSDNKIFLLD 300
           QFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAPESIISFKPISTNRALLTSDNKIFLLD
Sbjct: 241 QFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAPESIISFKPISTNRALLTSDNKIFLLD 300

Query: 301 LLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDV 360
           LLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDV
Sbjct: 301 LLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDV 360

Query: 361 GTGTLRDSMGKGFMSRENKSQHLQPLISTLNDTEAAEFNYDRILKELSKAADNIENFDSV 420
           GTGTLRDSMGKGFMSRENKSQHLQPLISTLNDTEAAEFNYDRILKELSKAADNIENFDSV
Sbjct: 361 GTGTLRDSMGKGFMSRENKSQHLQPLISTLNDTEAAEFNYDRILKELSKAADNIENFDSV 420

Query: 421 FFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPVSHTHN 480
           FFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPVSHTHN
Sbjct: 421 FFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPVSHTHN 480

Query: 481 LLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAI 540
           LLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAI
Sbjct: 481 LLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAI 540

Query: 541 KQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKLTKYID 600
           KQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKLTKYID
Sbjct: 541 KQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKLTKYID 600

Query: 601 QQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650
           QQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL
Sbjct: 601 QQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/627 (57%), Positives = 487/627 (77%), Gaps = 5/627 (0%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60
           M SISQPFRLTALPKIASLNN++TQ +YLQVA+TLTP+ N IN+GVSGS++SQYIINPTP
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60

Query: 61  KLVYNQPISSTNVVSACAVAEITTT-SEKDSQEVICYGIQSNRVYSLCATIKPVSSTASD 119
           KLV+N  I ST++V+AC V+EI     + ++QEV CY + +N+ ++L   IKP+++ A  
Sbjct: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS 120

Query: 120 SSFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVS 179
            +  +T+  +KVS+  ++ ++K+FP  K+I+AVL++GL+Q FDF+LKL HS D SY N+S
Sbjct: 121 VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNIS 180

Query: 180 YVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIF 239
            V++FT+E  Q +  +L+D++  KV +KLFEI   DS  P  EL+SVILE   L++S+ F
Sbjct: 181 LVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSKTF 240

Query: 240 YQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAPESIISFKPISTNRALLTSDNKIFLL 299
           YQFG++Y L    +SIY+LPHFQ S TI LPF+  E+++SFKPISTNRALLT DN+I+LL
Sbjct: 241 YQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRIYLL 300

Query: 300 DLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINID 359
           DLLHNAILSQRE+ HVK FQLL TA+IPGN+  NNKTIA+GVS K  +N +S+LDI+NI+
Sbjct: 301 DLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNIN 360

Query: 360 VGTGTLRDSMGKGFMSRENKSQHLQPLISTLNDTE----AAEFNYDRILKELSKAADNIE 415
           VG+GTL+DSM KGF++++   + L  L    +D       ++F+Y++IL EL KA    E
Sbjct: 361 VGSGTLKDSMSKGFLTQDATEEVLNSLFDEQDDELDEDGTSQFDYNQILSELEKAKSKTE 420

Query: 416 NFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPV 475
            FD+VFFK L IK  YYT+ DRF N + FL+ V +LIF++F  EYP+ALTYLLT+PLFP 
Sbjct: 421 KFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTHPLFPA 480

Query: 476 SHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDS 535
            H   LL K K+HPRLF+QAIVTCPNL LD L+ ELFTVINDELCLDLSLRILQDF KDS
Sbjct: 481 KHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDS 540

Query: 536 IKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKL 595
           IK++IK+ SK+D+NNFI FVI+E+ +E+R K+KP+LFQLL+LVLDS+GLFAL+ E LE L
Sbjct: 541 IKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALDGESLENL 600

Query: 596 TKYIDQQLSVVKENVELYNLVEEKNFK 622
            ++I+ Q+ +V++N+EL NL+++ + K
Sbjct: 601 HQFIENQVDIVEQNIELLNLLDDTSAK 627

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/658 (50%), Positives = 463/658 (70%), Gaps = 18/658 (2%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60
           M  I+QPFRL  LPKI+SLNNYA Q +YLQVAD L PT+N + VGVSGS++SQY+INPTP
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPTSNTVTVGVSGSSISQYVINPTP 60

Query: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSN-RVYSLCATIKPVSSTASD 119
           KLVYN PI STNVV+ C V  ++     D  E+  Y + +N +V++L A ++   +   +
Sbjct: 61  KLVYNIPIPSTNVVTGCDVLAMS-----DGAELWSYALTANGKVHTLHAVLRKAGAAPQE 115

Query: 120 SSFGETYAAH-KVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNV 178
           +    +   H K ++  ++V +++    K I+ VL  GLIQ +D++L+L HSLD SY NV
Sbjct: 116 TGLDASEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNV 175

Query: 179 SYVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQI 238
             V++FT  +G+ Y F+L DI   K  +KLF++  S    P TEL+SVILE+  L +S++
Sbjct: 176 GLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKM 235

Query: 239 FYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAPESIISFKPISTNRALLTSDNKIFL 298
            YQFG++YRL  + + +Y+LPHFQ S  + LPF+  +  +S + ISTNR LLT  NKIFL
Sbjct: 236 VYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLLTCCNKIFL 295

Query: 299 LDLLHNAILSQREMGHVKIFQLLETAVIPGNST-LNNKTIALGVSIKHGSNPSSSLDIIN 357
           LDLLHNAIL +RE+ ++K FQLL  AVIPG +   +N+T A+GVS K GSNPSS+LD++ 
Sbjct: 296 LDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVT 355

Query: 358 IDVGTGTLRDSMGKGFMSREN-KSQHLQPLISTLNDTEAAEFNYDRILKELSKAADNIEN 416
           I VGTGTL+DS+GKGF+S E+ +++ L+PL  T +D E+   ++  IL EL+ +    + 
Sbjct: 356 IAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGT-DDDESPNIDFAAILAELT-SRTTPKA 413

Query: 417 FDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPVS 476
           FDS+F+KRLG K  YYT+ DRF+N+ EFL  +   IF +F  E+PKAL YLLT+PLFP S
Sbjct: 414 FDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPLFPSS 473

Query: 477 HTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSI 536
           HT  LL KLK HPRLFKQA+VTCPNL LDEL+ ELFTV+NDEL LDLSLR+LQ+F K+ I
Sbjct: 474 HTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDI 533

Query: 537 KEAIKQKSKIDVNNFINFVISENFE-EDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKL 595
           K+ I++ S++D++NF+NFVI ++ + E+R K KP+LFQLLSLV+D+VGL ALE ++L +L
Sbjct: 534 KQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDILHRL 593

Query: 596 TKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITA----YSIEQLE 649
           + +ID Q++V  + VEL  L+E  + K   G+ L   +   E  + A    YS+E L+
Sbjct: 594 SAFIDSQVAVADQLVELLYLLENSSTKK--GKHLNSVTRLDESPVAATIPLYSVEYLD 649

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/622 (49%), Positives = 453/622 (72%), Gaps = 15/622 (2%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60
           M SISQPFRL+ALPKI SLNNYA Q +YLQV D L+P+ N +N+G+SGS++SQY+INPTP
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60

Query: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS 120
           KLV+N PI STN+V+AC V E     +  + EV CYG+++ +V  L    KP+   A  S
Sbjct: 61  KLVFNLPIPSTNIVTACDVVE-----DAANTEVWCYGLEARKVSHLHLATKPMIQDAVSS 115

Query: 121 SFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSY 180
           S  E  +  K  +  ++V++K++   + ++ +LR+GLIQ FD+ELKL +++D SY ++ +
Sbjct: 116 SNAEITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRF 175

Query: 181 VQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFY 240
           VQ F    G  + F+L  +   K+ +KLF++ +S+S +   EL+S+ILEN  L+++++ +
Sbjct: 176 VQFFQDGQGNDFFFVLCQLSDEKICYKLFQV-RSESVS-CIELNSIILENYTLENAKLCF 233

Query: 241 QFGQVYRL-HGNAVSIYNLPHFQHSRTIELPFLAPESIISFKPISTNRALLTSDNKIFLL 299
           +FG++Y L + N +SIY LPH Q   +I+LPF++ ++++S KP+S+NR LLT+DN I+L+
Sbjct: 234 EFGKLYVLKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKPVSSNRVLLTADNTIYLV 293

Query: 300 DLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINID 359
           DLL+NAIL Q+++ ++K  QLL TAV+  NS  N KTIAL V+ K+G+NP+S LD+INID
Sbjct: 294 DLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINID 353

Query: 360 VGTGTLRDSMGKGFMSRENKSQHLQPLISTLNDTEAAEF---NYDRILKELSKAADNIEN 416
           VGTGTL+D+MGKGFM ++   Q LQ L    N+ +  E    +Y+RI+K+L      IEN
Sbjct: 354 VGTGTLKDAMGKGFMVKQ--KQKLQKLFEESNEDDDVELPSPDYERIIKQL-HICKKIEN 410

Query: 417 FDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPVS 476
           FDS+FFK L +   YYTD+DRF+ND + L  +   +F +FK EYPKALTYLLT+PLFP  
Sbjct: 411 FDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFPPV 470

Query: 477 HTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSI 536
           H   LL KLK++PRLFKQAIVTCPN+ LD+L+ ELF + N ELC D++LR+LQD+ K+SI
Sbjct: 471 HAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESI 530

Query: 537 KEAIKQKSKIDVNNFINFVISENFEEDRIK-NKPRLFQLLSLVLDSVGLFALENEMLEKL 595
           K  I++  K+D+ NF++ +++ N  +  +K NKP++FQL+SL++DS+GLFAL++E LEKL
Sbjct: 531 KAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKL 590

Query: 596 TKYIDQQLSVVKENVELYNLVE 617
           + ++D Q+SVV +N+EL +L E
Sbjct: 591 SSFVDAQVSVVSQNIELLHLAE 612

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/658 (49%), Positives = 455/658 (69%), Gaps = 11/658 (1%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60
           MPS SQPFRL  LPKI SL+N  TQ + LQ+AD  +  +N I +G+SGS +SQYIINPTP
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADDFSLESNKITIGISGSTISQYIINPTP 60

Query: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS 120
            LV+N PI STN V+AC +    + ++    E   YG+  N+ ++L  +IK        +
Sbjct: 61  SLVFNVPIPSTNNVTACNIGHFVSDTDGSKLECWAYGLSYNKNHTLNISIKTSDDDKYAT 120

Query: 121 SFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSY 180
           S GE    +     D+I ++K+    K IV VL++GLIQF+DF LKL  S++  Y ++S+
Sbjct: 121 SGGEVVETYSQKCDDKIEHIKINEKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDISF 180

Query: 181 VQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFY 240
           V+HF  E G+++  +LS+I+G K+SFKL+E+  +D  T   ELSS ILE+  L +SQI Y
Sbjct: 181 VEHF-EEDGKQFAIILSNIEGKKISFKLYELFTNDK-TSINELSSTILEDADLGESQICY 238

Query: 241 QFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAPES--IISFKPISTNRALLTSDNKIFL 298
           QFG++YRL  + + IYNLP  Q  +TIELPF+  +   ++SF PI+ NR LLT +NKI+L
Sbjct: 239 QFGKIYRLFEDRLYIYNLPQCQLQQTIELPFIQKKDSDVLSFSPIANNRILLTVNNKIYL 298

Query: 299 LDLLHNAILSQREMGHVKIFQLLETAVIPGNS-TLNNKTIALGVSIKHGSNPSSSLDIIN 357
           LDL+HN+IL++R++ HVK++QLL++ V+P      N+KTIA+GVSIK+G +P SSL++IN
Sbjct: 299 LDLVHNSILAERDLSHVKVYQLLKSIVVPSKGENKNSKTIAIGVSIKNGPSPISSLEVIN 358

Query: 358 IDVGTGTLRDSMGKGF-MSRENKSQHLQPLI----STLNDTEAAEFNYDRILKELSKAAD 412
           +DVG+GTL+DS+GK F ++   K+  LQ L     +     E   F+Y  IL+EL    +
Sbjct: 359 VDVGSGTLKDSLGKSFQVANVKKNIPLQSLFPEDETIYAKGEQKSFDYKNILQELQNNKN 418

Query: 413 NIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPL 472
           +I  FD +FFK+L I   YYT+ DRF+ D++FL DV  LIF +FK +YP+ALT+LLT+PL
Sbjct: 419 DINKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFKKDYPRALTFLLTHPL 478

Query: 473 FPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFN 532
           FP+SHT NLL K ++ PRLFKQA+VTCPNL L EL+ ELFT+ N ELCLD+SLRILQD+ 
Sbjct: 479 FPISHTRNLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQDYT 538

Query: 533 KDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALENEML 592
           +DSIK+ +K  SK+D+ NFI FVI  +  ED+ +  P+LFQLLSLVLD+ GLFALE E L
Sbjct: 539 RDSIKQELKTLSKVDIQNFIEFVIDTD-SEDKSQFNPQLFQLLSLVLDASGLFALEEETL 597

Query: 593 EKLTKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650
           EKL+ YID Q++V + N  L++L++E + K        D +      ++AYS+E LEL
Sbjct: 598 EKLSAYIDNQVNVAERNNRLWHLLDENSDKRSTLNQANDQNVLQTKSLSAYSVEYLEL 655

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/671 (47%), Positives = 461/671 (68%), Gaps = 28/671 (4%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60
           MPSI QPFRL+ LP+I +L+NY  Q +YL+V+  ++P +N I +G+S SA+SQYI+NPTP
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60

Query: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSS-TASD 119
           KL+ N  I STNVVSAC VA +      D +E+ CY ++S + + L A++KPV + T  D
Sbjct: 61  KLLSNISIPSTNVVSACDVATLA-----DDKEIWCYCVKSGKSHFLNASVKPVDADTVLD 115

Query: 120 SSFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVS 179
           +  G+     K+ +  ++V +K+ PD K+IV VL SGLIQ++DF+L+   SLD SY+NV 
Sbjct: 116 TDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVK 175

Query: 180 YVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSA--TPATELSSVILENMCLKDSQ 237
            V +F SE+GQ + F+LS  + +KV FKLFE+   D    TP  ELS+ ILEN  L  S+
Sbjct: 176 VVNYF-SENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSK 234

Query: 238 IFYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPF-LAPES-IISFKPISTNRALLTSDNK 295
           + YQ G++Y+L G+ +  Y LP     +T  LP  L P S  +S  P+STNR LLT +N+
Sbjct: 235 LCYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQ 294

Query: 296 IFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNN-----KTIALGVSIKHGSNPS 350
           ++LLDL+H+++LS+R + H K FQLL +A +  +S+L       +T+A+GV+ K+G+NP+
Sbjct: 295 VYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPT 354

Query: 351 SSLDIINIDVGTGTLRDSMGKGFMS-RENKSQHLQPLIS--------TLNDTEAAEFNYD 401
           S+L++IN+DVGTGTL+DS+GK F S  ++K+ +LQPL S          +  E   F Y+
Sbjct: 355 SALEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYE 414

Query: 402 RILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYP 461
            I KELSK   +I  FDS F KRL I+  +YTD +RF+ D+EFL  V  LI  SF  EYP
Sbjct: 415 DIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYP 474

Query: 462 KALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCL 521
           +ALT+LLT+PLFP   T  LL++ ++HPRLFKQAIVTCPNL LD+L+ ELF++ N ELCL
Sbjct: 475 RALTFLLTHPLFPTDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCL 534

Query: 522 DLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNKP--RLFQLLSLVL 579
           D+SLRILQDF  D IK+ +K+ +K+DV+NF+NF+IS   +E+ I+NK    LFQLLSLV+
Sbjct: 535 DISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPK-DEELIQNKSTYELFQLLSLVI 593

Query: 580 DSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPV 639
           D++GLFAL+  +L++L+ YID+Q+ + + N  L+NL++ +N   G    L  +S + E  
Sbjct: 594 DAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQT 653

Query: 640 ITAYSIEQLEL 650
           +  Y++E LEL
Sbjct: 654 LPKYTVEYLEL 664

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/662 (48%), Positives = 453/662 (68%), Gaps = 25/662 (3%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60
           MPS+SQ F+L  LP++ASL+N+A Q N+LQVAD + PT+N I +G+S SA+SQY++NPTP
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60

Query: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS 120
           KLV + PI STN+V+AC VA        D QE+ CY +Q+ +V +L      V+S  S +
Sbjct: 61  KLVLSIPIPSTNIVTACDVAR------SDEQEIWCYALQAGKVCTL-----NVASKVSHA 109

Query: 121 SFG-ETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVS 179
             G  +    KV V DQ V + V    K+IV VL++GLIQF+DF+LKL HSLD SY +VS
Sbjct: 110 ENGVNSDDVLKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVS 169

Query: 180 YVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSD-SATPATELSSVILENMCLKDSQI 238
             + FT E    + F+L  +   KV FKLFE+   + +  P  ELSS+ILE+  L  S+I
Sbjct: 170 VTKFFT-EGANDFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKI 228

Query: 239 FYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAPESIISFKPISTNRALLTSDNKIFL 298
            YQ G++YRL G+ V +Y LP  Q  + + LP +    +IS KPIS+NR L+T+DNKI+L
Sbjct: 229 CYQSGRLYRLIGHEVLVYALPQCQLVQAVTLPMVQGADVISMKPISSNRILVTADNKIYL 288

Query: 299 LDLLHNAILSQREMGHVKIFQLLETAVIPG---NSTLNNKTIALGVSIKHGSNPSSSLDI 355
           L+L HN+IL QRE+ H+K FQLL++AVI     +S  N KT  +GV  KHG NP+SSL+I
Sbjct: 289 LNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEI 348

Query: 356 INIDVGTGTLRDSMGKGF-MSRENKSQHLQPLISTLNDTEAA------EFNYDRILKELS 408
           +N+DVGTGTL+DS+GKGF +S E  SQ L+PL S  ++           F++++I + L 
Sbjct: 349 VNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFSDEDNEAEDEDNKFEHFDFNQIYQHLE 408

Query: 409 KAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLL 468
           K   +I +FD +F + L IK  +YT+ DRF+ DR+FL +V  LI ++F+ EYPKALT+LL
Sbjct: 409 KNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLL 468

Query: 469 TNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRIL 528
           T+PLFPV  T  LL +L++HPRLFKQAIVTCPNL L EL+ ELF++ N EL LD+SLRIL
Sbjct: 469 THPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRIL 528

Query: 529 QDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALE 588
           QD+  D IK+ +++ +KIDV NFI FVIS N +E+ I++  +LFQLLSLVLDS+GLFAL+
Sbjct: 529 QDYTTDMIKQEVRKLNKIDVQNFIEFVISSN-DENAIRSSHQLFQLLSLVLDSIGLFALD 587

Query: 589 NEMLEKLTKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQL 648
             +L++L  YI +++++ + N +L +L+++K    GF +    +  S    +  Y++E L
Sbjct: 588 GVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYL 647

Query: 649 EL 650
           +L
Sbjct: 648 DL 649

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/681 (48%), Positives = 461/681 (67%), Gaps = 41/681 (6%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVAD-TLTPTTNNINVGVSGSAVSQYIINPT 59
           MPS+SQPFRLT LPKIASL+N+A Q +Y+QV D T +PTTN I +G+SGS+VSQYI+NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 60  PKLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIK-------- 111
           PKL++N PI STN+V+AC V E   +SE    E  C+   +N+  +L    K        
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSE----ETWCFATMANKTSTLNLINKNQYQTNEE 116

Query: 112 -PVSSTASDSSFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHS 170
               S  SDSS    +   K+   D +V++K+    K IV VL++G IQ +DFELKL +S
Sbjct: 117 ESGDSAPSDSSVTSEF---KIKADDHVVDIKILNKKKIIV-VLKNGKIQTYDFELKLLNS 172

Query: 171 LDSSYKNVSYVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSAT--PATELSSVIL 228
           ++ +Y NV +V+HF  E G+ + F+L D++  KV  KLF+I ++       A EL+S IL
Sbjct: 173 INMAYNNVRFVEHF-HEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTIL 231

Query: 229 ENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAP----ESIISFKPIS 284
           EN  L++++  YQFG+ Y+L  + + +Y+LP FQ   +I LP +      E ++SFKPIS
Sbjct: 232 ENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPIS 291

Query: 285 TNRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIK 344
            NR LLT +NKI+LLDL+HN+ILS+RE+ H+K FQLL+TAV+  N    N+T+A+GVS K
Sbjct: 292 PNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNIN-QNRTLAIGVSTK 350

Query: 345 HGSNPSSSLDIINIDVGTGTLRDSMGKGFM--SRENKSQHLQPLISTLND-----TEAAE 397
            GSNP+SSL+++N+DVGT T++DS+GK F   S EN  Q L+ L    ND      +   
Sbjct: 351 FGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQVKN 410

Query: 398 FNYDRILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK 457
           FNY++I KEL  + +++  FD +FFK   IK  YYT+ DRF+ + EFL  +  LIF++FK
Sbjct: 411 FNYEKIYKELVDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFETFK 470

Query: 458 SEYPKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVIND 517
            EYPK  TYLLT+PLFP+  T  LL +L +HPRLFKQAIVTCPNL L+EL+ ELFT+ N 
Sbjct: 471 EEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTISNG 530

Query: 518 ELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSL 577
           EL LD+SLRILQD+ +DSIK+ +K+  KI+V NFI F+I E  +     N P LFQLLSL
Sbjct: 531 ELSLDISLRILQDYTRDSIKKELKKLPKIEVENFIEFIIDEESDIKDTTNAPHLFQLLSL 590

Query: 578 VLDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEKN---FKNG--FGQPLGDT 632
           V+DS+GLFAL+N +LE+L+KYID+Q+++ + N EL++L++  N   +KN         D+
Sbjct: 591 VVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDS 650

Query: 633 STS---GEPVITAYSIEQLEL 650
           +TS    E V+  YS+E L+L
Sbjct: 651 NTSLKLQEEVLPKYSVEYLDL 671

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/660 (48%), Positives = 451/660 (68%), Gaps = 18/660 (2%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60
           MPS+SQPFRL  LPKIA L++Y  Q   LQVAD  T  +N I +GVSG AVSQY+INPTP
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60

Query: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS 120
            +    PI STN V+AC VA+      ++  E+  Y +  N+  +L   IK V      +
Sbjct: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFST 120

Query: 121 SFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSY 180
           +  +    + V     +V +K+  + K+IV  L +G IQ FDF+LKL +S+++SY N+ +
Sbjct: 121 TQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYF 180

Query: 181 VQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFY 240
            +HF  E+ + +  +LS I+G+K+S+KL+E+   D  T   ELSS ILE++  KDS+I Y
Sbjct: 181 SEHFV-ENKKSFAIILSTIEGNKLSYKLYELFGQDK-TSIKELSSTILEDIQCKDSKISY 238

Query: 241 QFGQVYRLHGNAVSIYNLPHFQHSRTIELPF--LAPESIISFKPISTNRALLTSDNKIFL 298
           QFG++YRL+ N + +Y+LP  Q   TI LP   L     ISFKP+S NR LLT DNKIF+
Sbjct: 239 QFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFI 298

Query: 299 LDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNN-KTIALGVSIKHGSNPSSSLDIIN 357
           LDL+H A L++R +GHVK+FQLL++ VI  N   NN KTIA+GVS+K+G +P ++L+IIN
Sbjct: 299 LDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIIN 358

Query: 358 IDVGTGTLRDSMGKGF-MSRENKSQHLQPLIST-LNDTEAAEFNYDRILKELSKAADNIE 415
            +VGTGTL+DS+G  F +S+  KS  LQPL +   N  +  +F Y+ ILK+LS   ++I+
Sbjct: 359 ANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVKRHDFKYEAILKKLSSTENDIK 418

Query: 416 NFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPV 475
            FD +FF  L I+ NYYTD++RF+ D  FL DV  LIFK+F+ EYP ALT+LLT+PLFP+
Sbjct: 419 KFDDIFFGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTHPLFPI 478

Query: 476 SHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDS 535
             T NLL KL++HPRLFKQA+VTCPNL +DEL+ ELF++ N EL +D+SLRILQD+ KDS
Sbjct: 479 HQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDS 538

Query: 536 IKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKL 595
           IK  +K  +KID+ NFI+FVI  N EE++ K+  +LF LLSLVLD+ GLF++E  +L +L
Sbjct: 539 IKLELKNLNKIDIQNFIDFVIDPNNEEEK-KHNEQLFVLLSLVLDASGLFSIEGPLLTQL 597

Query: 596 TKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPV-----ITAYSIEQLEL 650
           ++YID+Q+ +++++ +L++L++        G+      TSG  V     +TAYS+E LEL
Sbjct: 598 SEYIDKQVEMIEKSNKLWHLID-----GTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/715 (44%), Positives = 464/715 (64%), Gaps = 67/715 (9%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADT-LTPTTNNINVGVSGSAVSQYIINPT 59
           MPS+SQPFRL  LPKIASL+N++ Q +Y+QVAD      TNNI +G+SGS++SQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVYNQPISSTNVVSACAVA--------------------EITTTSEKDSQEVICYGIQ 99
           PKL ++ PI STN+++AC                       E+T    K   E+  +G+ 
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTNFQSKRDVEIWSFGLM 120

Query: 100 SNRV-YSLCATIKPV---SSTASD-----SSFGETYAA-------HKVSVSDQIVNLKVF 143
            N+  Y+L    K V     T++D      +  + YA        +K+   D+++N+K+ 
Sbjct: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180

Query: 144 PDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGHK 203
                ++AVL++GL++F+DF+LKL HS D SY N+ Y + FT E+G  + F+L  ++  K
Sbjct: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFT-ENGTEFVFVLCPLEDDK 239

Query: 204 VSFKLFEIG--QSDSATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHF 261
           V +KLFE+   +   ++P  ELSS I+E    + S+  YQFG++Y+L+   + +Y+LPH 
Sbjct: 240 VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHC 299

Query: 262 QHSRTIELPFL----APESIISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVKI 317
           Q  + I++P +    +   +ISF+P+S NR LLT +N I+LLDLLH +IL+QRE+ HV+ 
Sbjct: 300 QLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRT 359

Query: 318 FQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMSRE 377
           FQLL +AVI    + N+KTIA+G+S K+G NP+SSL+IINIDVGT TL+DS+GK F   +
Sbjct: 360 FQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGK 419

Query: 378 NKSQH--LQPLISTLN-------------DTEAAEFNYDRILKELSKAADN-IENFDSVF 421
           N +    L+PL    N             +     F YD I+K++S   +N + +FD +F
Sbjct: 420 NDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIF 479

Query: 422 FKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK-SEYPKALTYLLTNPLFPVSHTHN 480
           FK L +K  +YT+ DRF++D EFL  V  LIF+ F  ++YPKALT+LLT+PLFP++ THN
Sbjct: 480 FKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLNRTHN 539

Query: 481 LLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAI 540
           LL +L+D PRLFKQAIVTCPNL L+EL++ELF++ N EL LD+S RILQDF +DSIK+ +
Sbjct: 540 LLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEM 599

Query: 541 KQKSKIDVNNFINFVISENFEEDRIKN-----KPRLFQLLSLVLDSVGLFALENEMLEKL 595
           K  SK+D+ NFI+F+ + + E+  ++N       +LFQLLSLVLDS+GLF+LE  +L+ L
Sbjct: 600 KNLSKLDIQNFIDFITNTD-EDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNL 658

Query: 596 TKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650
             YID+Q+ + + N EL+NLVE K  ++GF     D+ TS +  +  Y++E LE+
Sbjct: 659 ASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/373 (72%), Positives = 321/373 (86%)

Query: 278 ISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTI 337
           +SF PIS NRALLT DNK++LLDLLHNAILSQRE  HVK FQLL TAVIPGNS+ NN TI
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 338 ALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMSRENKSQHLQPLISTLNDTEAAE 397
           A+GV+ K G+  +SSLD++NIDVGTGTL+DSMGKGF+S + K Q  Q L+ T NDTE  E
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDTEVQE 120

Query: 398 FNYDRILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK 457
            NY +ILK+L+K   N + FDSVFFK+L IKN+YYTDSDRF+ND+EFL +   LIF++F+
Sbjct: 121 HNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFENFQ 180

Query: 458 SEYPKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVIND 517
           SEYPKALTYLLT+PLFP++ TH+LLQKLKDHPRLFKQAIVTCPNL L +L+QELFTVIND
Sbjct: 181 SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTVIND 240

Query: 518 ELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSL 577
           ELCLDLSLRILQDF+KDSIK AIKQ+SK+DVN FINFV++EN +EDR+KNKPRLFQLL+L
Sbjct: 241 ELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPRLFQLLNL 300

Query: 578 VLDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGE 637
           VLDSVGLFALE+E L+KL+ YID+QLSVVK+NV+LYNLV+E+NFKN  GQ   D+ + GE
Sbjct: 301 VLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFKNILGQHHADSLSVGE 360

Query: 638 PVITAYSIEQLEL 650
             ITAYS+EQLEL
Sbjct: 361 GAITAYSVEQLEL 373

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/703 (43%), Positives = 456/703 (64%), Gaps = 58/703 (8%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVA-DTLTPTTNNINVGVSGSAVSQYIINPT 59
           MPS+SQPFRL  LPKIASL+NY+ Q +YLQVA DT T  TN + +G+SGS +SQYIINPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 60  PKLVYNQPISSTNVVSACAV---------AEITTTSEKD--------------------- 89
           PKL++N  I STN V+A  +         A  T T++K                      
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 90  ----SQEVICYGIQSNRVYSLCATIKPVSSTASDSSFGETYAAHKVSVSDQIVNLKVFPD 145
               S E+  YG+ +N+  +L  ++K        ++ GE      + V  ++VN+K+F +
Sbjct: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180

Query: 146 TKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGHK-- 203
            K+IV VL++GL++ FDF+L L+ SLD +Y +V +VQHFT ES Q +  +LS+ID  K  
Sbjct: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFT-ESKQNFLLILSNIDEEKSS 239

Query: 204 VSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHFQH 263
           V FKL+++     +   +ELS  IL++  L  S++ YQFG++YRL G+ + +Y+LP  Q 
Sbjct: 240 VCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQL 299

Query: 264 SRTIELPFLAPESI--ISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLL 321
            + I L  + P +I   S KP++ NR +L  +N ++L+D LH +IL++RE  HVK FQLL
Sbjct: 300 LQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQLL 359

Query: 322 ETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMSRENKSQ 381
           ++A I G+S +  +TIA+GVS K G   +S+L++INI+VG+GTL+DS+GKG   + ++  
Sbjct: 360 QSATI-GDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEGS 418

Query: 382 H--LQPLISTLNDTEA------------AEFNYDRILKELSKAADNIENFDSVFFKRLGI 427
           H  L+PL    ND ++              FN+++IL +L K++D I +FD  FF+ L I
Sbjct: 419 HSDLKPLFDE-NDEKSLIGTPVHDISNVKSFNFNKILADL-KSSDTISDFDKTFFESLEI 476

Query: 428 KNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPVSHTHNLLQKLKD 487
           K N+YT++DRF++D++F+ +   LIFK F +E+PKA T+LLT+PLFP+  T  LL KLKD
Sbjct: 477 KENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLKD 536

Query: 488 HPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAIKQKSKID 547
           HPRLFKQAIVTCPNL L EL+ +LFTV N EL LD+SLR+LQD++++ +K+ IK+   +D
Sbjct: 537 HPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVD 596

Query: 548 VNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKLTKYIDQQLSVVK 607
           + NFI F+I+   EE +  N P+LFQLLSLVLDS+GLFAL+  +LE+L+ YI++Q+++ +
Sbjct: 597 IENFIEFIITPTTEEIQ-TNTPQLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAE 655

Query: 608 ENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650
            + EL++L++       F      +    +  ++ YS++ L++
Sbjct: 656 RSSELWHLLDTSTTPRPFKNAYLKSVIGNKETLSVYSVDYLDI 698

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/712 (44%), Positives = 461/712 (64%), Gaps = 69/712 (9%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVAD-TLTPTTNNINVGVSGSAVSQYIINPT 59
           MPS+SQPFRL ALPKIASL+N++ Q NY+QVAD T   +TNNI +G+SGS+VSQYIINPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 60  PKLVYNQPISSTNVVSACAVAE-------------ITTTSEKDSQEVICYGIQSNRV-YS 105
           PKL+++ PI STN+++AC   E             +  +  K + E+  +G+  N+  Y+
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120

Query: 106 LCATIKPVSSTA--SDSSFGET-------------YAAHKVSVSDQIVNLKVFPDTKSIV 150
           L    K + +T   +D +  E               + +K+    +++++K+      I+
Sbjct: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180

Query: 151 AVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGHKVSFKLFE 210
           A+L++GLI+F+DF+LKL HS D SY N+ Y + FT E+G  + F+L  +   KV +KL E
Sbjct: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFT-ENGIEFIFVLCPLQDDKVCYKLLE 239

Query: 211 IG--QSDSATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHFQHSRTIE 268
           +   ++   +P  ELSS I+E     DS++ YQFG++Y+L+   + +Y+LPH Q  + IE
Sbjct: 240 LTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIE 299

Query: 269 LPFLA----PESIISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLLETA 324
           LP +        +ISF+P+S NR LLT +N ++LLDLLH + L QRE+ HVK FQLL TA
Sbjct: 300 LPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTA 359

Query: 325 VIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMS-RENKSQHL 383
           VI    + ++KTIA+G+S K+G+NP+SSL+IINIDVGT TL+DS+GK F + +++ S  L
Sbjct: 360 VINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVIL 419

Query: 384 QPLISTLNDTEAAE----------------FNYDRILKELSKAADN-IENFDSVFFKRLG 426
           +PL    +D E  E                F YD I+ +LS    N I +FD +FFK L 
Sbjct: 420 KPL---FDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLK 476

Query: 427 IKNNYYTDSDRFVNDREFLEDVSTLIFKSFK-SEYPKALTYLLTNPLFPVSHTHNLLQKL 485
           IK  +YT+ DRF++D  FL  V  LIF+ F  ++YPK LT+LLT+PLFP+  T NLL  L
Sbjct: 477 IKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNLLSLL 536

Query: 486 KDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAIKQKSK 545
           +D PRLFKQAIVTCPNL L+EL++ELF++ N EL LD+S RILQDF +DSIK+ +K+ SK
Sbjct: 537 RDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSK 596

Query: 546 IDVNNFINFVIS-------ENFEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKLTKY 598
           +D+ NFI F+ S       E F   +     +LFQLLSLVLDS+GLF+LE  +LE LT Y
Sbjct: 597 LDIQNFIEFMTSTENDNSLEGFNHSQ---STQLFQLLSLVLDSIGLFSLEGALLESLTSY 653

Query: 599 IDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650
           ID+Q+ + + N EL+NL++ K+ ++GF     ++++S +  +  Y++E L++
Sbjct: 654 IDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/716 (44%), Positives = 465/716 (64%), Gaps = 69/716 (9%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVAD-TLTPTTNNINVGVSGSAVSQYIINPT 59
           MPS+SQPFRL  LPKIASL+N++ Q +Y+QVAD T   +TNNI +G+SGS++SQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVYNQPISSTNVVSACAVAEITTTSEKDSQ---------------------EVICYGI 98
           PKL ++ PI STNV++AC+ AE+    E+D +                     E+  +G 
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 99  QSNRV-YSLCATIKPVSSTAS--------DSSFGETYAA-------HKVSVSDQIVNLKV 142
             N+  Y+L  T K + S  +        DS     +A        HK+    +++N+K+
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 143 FPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGH 202
                 I+AVL++GLI+F+D +LKL +S D SY N+ Y + FT E+G  + F+L  ++  
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFT-ENGTDFVFVLCPLEDD 239

Query: 203 KVSFKLFEIG--QSDSATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPH 260
           KV +K+ E+   +S   +P  ELSS I+E    + S++ YQFG++Y+L+   + +Y+LPH
Sbjct: 240 KVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPH 299

Query: 261 FQHSRTIELPFL----APESIISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVK 316
            Q  + IELP +    + + +ISF+P+S NR LLT +N I+LLDLLH +IL+ RE+ HVK
Sbjct: 300 CQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVK 359

Query: 317 IFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGF-MS 375
            FQLL++A+I    + N+KTIA+G+S K+G NP+SSL+IINIDVGT TL+DS+GK F + 
Sbjct: 360 TFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419

Query: 376 RENKSQHLQPL---------ISTLNDTEA----AEFNYDRILKELSKAADN-IENFDSVF 421
           + + S  L+PL         +   ND +       F+YD ++++LS   +N I +FD +F
Sbjct: 420 KNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIF 479

Query: 422 FKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK-SEYPKALTYLLTNPLFPVSHTHN 480
           F  L +K  +YT+ DRF++D  FL  V  LIF  F  ++YPKALT+LLT+PLFP++ TH 
Sbjct: 480 FNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRTHG 539

Query: 481 LLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAI 540
           LL  L+D PRLFKQAIVTCPNL L+EL++ELF++ N EL LD+S R+LQDF +DSIK+ +
Sbjct: 540 LLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQEM 599

Query: 541 KQKSKIDVNNFINFVISENFEED------RIKNKPRLFQLLSLVLDSVGLFALENEMLEK 594
           K+ SK+D+ NFI  +   N EED         +  +LFQLLSLVLDS+GLF+LE  +LE 
Sbjct: 600 KKLSKLDIQNFIECIT--NTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLEN 657

Query: 595 LTKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650
           LT YID+Q+ + + N EL+NL++ K  ++GF      ++TS +  + AY++E L++
Sbjct: 658 LTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/714 (44%), Positives = 454/714 (63%), Gaps = 65/714 (9%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVAD-TLTPTTNNINVGVSGSAVSQYIINPT 59
           MPS+SQPFRL  LPKIASL+N++ Q +Y+QVAD T   +TNNI +G+SGS++SQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVYNQPISSTNVVSACAVA----------EITT-----------TSEKDSQEVICYGI 98
           PKL ++ PI STN+++AC             E +T           T +K + E+  +G+
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 99  QSNRV-YSLCATIKPVSSTASDSS---------------FGETYAAHKVSVSDQIVNLKV 142
             N+  Y+L    K +  T   S+                 E  + +K+    +++++K+
Sbjct: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180

Query: 143 FPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGH 202
                 ++A+L++GLI+ FDF+L L HS D SY N+ Y + FT E+G  Y F+L  +   
Sbjct: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFT-ENGTEYVFVLCPLQDD 239

Query: 203 KVSFKLFEIGQSDS--ATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPH 260
           KV +KL E+    S  ++P  ELSS I+E    ++S++ YQFG++Y+L+   + IY+LPH
Sbjct: 240 KVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPH 299

Query: 261 FQHSRTIELPF---LAP-ESIISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVK 316
            Q  + IE P    L+P + +ISF+P+S NR LLT +N I+LLDLLH + LSQRE+ HVK
Sbjct: 300 CQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVK 359

Query: 317 IFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMSR 376
            FQLL++AVI    + N+KTIA+G+S K+G NP+SSL+IINIDVGT TL+DS+GK F   
Sbjct: 360 TFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419

Query: 377 ENKSQH-LQPLISTLN-------------DTEAAEFNYDRILKELSKAADN-IENFDSVF 421
            N S   L+PL    +             D+     + + ++++LS   DN I +FD +F
Sbjct: 420 NNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIF 479

Query: 422 FKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKS-EYPKALTYLLTNPLFPVSHTHN 480
           FK L IK  +YT+ DR+++D  FL  V  LIF  F   +YPK LT+LLT+PLFP+S T N
Sbjct: 480 FKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRN 539

Query: 481 LLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAI 540
           LL  L+D PRLFKQAIVTCPNL L+EL++ELF++ N EL LD+S RILQDF +DSIK+ +
Sbjct: 540 LLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEM 599

Query: 541 KQKSKIDVNNFINFVISENFEEDRIKNKP----RLFQLLSLVLDSVGLFALENEMLEKLT 596
           K+ SK+DV NFI F+ S   +       P    +LFQLLSLVLDS+GLF+LE  +LE LT
Sbjct: 600 KKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLT 659

Query: 597 KYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650
            YID+Q+ + + N EL+NL++ K F++GF     D  TS +  +  Y++E L++
Sbjct: 660 LYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/677 (46%), Positives = 452/677 (66%), Gaps = 54/677 (7%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVA-DTLTPTTNNINVGVSGSAVSQYIINPT 59
           MPS+SQPFRLT LPKIASL+NY+ QG+Y+QV   T  PTTN + +GVSGSA+SQYIINPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 60  PKLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIK-PVSSTAS 118
           PKL++N PI STN+V+AC V  +   ++  + EV C+G+ +N+ Y+L    K    S+A+
Sbjct: 61  PKLIFNYPIPSTNIVTACDV--LENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSAT 118

Query: 119 DSSFGETYAAHKVSVSDQIVNLKV------------FPDTKSIVAVLRSGLIQFFDFELK 166
                +       ++ D+  N+K+              D  SI+ VL +GLIQFF+  LK
Sbjct: 119 MEDDEDVVDVIDTTIKDEF-NVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLK 177

Query: 167 LQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDI-DGHKVSFKLFEIGQSDSATPATELSS 225
           L +++  +YKNV +V+HF  E  + + F + D+ D +KV  KLF+I  +DSA    EL+S
Sbjct: 178 LLNTVKINYKNVKFVEHF-KEDNKDFMFTICDLGDNNKVCIKLFQIN-NDSAI---ELNS 232

Query: 226 VILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFL-APESIISFKPIS 284
           +I+EN   ++++  YQFG+ Y+L  N + +Y+LP FQ   T  +P +   + I+S KPIS
Sbjct: 233 IIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPIS 292

Query: 285 TNRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIK 344
           TNR LLT +NKI+LLDL+HN+ILS+RE+ H+K  QLL +AVI G    NNKTI +GVS K
Sbjct: 293 TNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVI-GKGENNNKTITIGVSTK 351

Query: 345 HGSNPSSSLDIINIDVGTGTLRDSMGKGF--MSRENK----SQHLQPLISTLNDTEA--- 395
            G NP+SSL+IIN+DVG+ TL+DS+GK F  ++ +N+    +Q L+PL     D +    
Sbjct: 352 FGVNPTSSLEIINVDVGSNTLKDSLGKCFQNLNLQNQIQISTQALKPLFDPNTDGDKDDD 411

Query: 396 --------AEFNYDRILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLED 447
                    +FNYD IL +LS+  ++I  FD +FF+   IK  +YT++DRF+ + EF   
Sbjct: 412 LFKKLVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLK 471

Query: 448 VSTLIFKSFKS--------EYPKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTC 499
           +  LIF+ F S        EYPK LT+LLT+PLFP+  T +LL +  +HPRLFKQAIVTC
Sbjct: 472 LIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVTC 531

Query: 500 PNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISEN 559
           PNL L EL+ EL T+ N+EL LD+SLRILQD++KDSIK+ ++   ++++ NFI+F++++ 
Sbjct: 532 PNLPLPELLNELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDE 591

Query: 560 FEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEK 619
            ++D+  N P+LFQLL+LVLDS+GLFAL + +LE L+ YID+Q+S+V++N EL+ L++  
Sbjct: 592 IKDDQ--NSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSN 649

Query: 620 NFKNGFGQPLGDTSTSG 636
           N  N F     D S S 
Sbjct: 650 N--NIFSHNKKDNSFSS 664

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  500 bits (1288), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 275/655 (41%), Positives = 423/655 (64%), Gaps = 43/655 (6%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60
           MPS+SQPFRL  LPKIASL+N++ +  Y++VAD+ TP +N++ +G+SGS++S+Y+I PTP
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDSNSVLLGISGSSISKYVITPTP 60

Query: 61  KLVYNQPISSTNVVSACAVAEITTTS-------------------------EKDSQEVIC 95
           +L++N PI ST++VSAC +   + TS                         E    E+ C
Sbjct: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIWC 120

Query: 96  YGIQSN-RVYSLCATIKPVSSTASDSSFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLR 154
           Y + +N + ++L   I+ V +  +++S  E          +QI+N++V    K IV +  
Sbjct: 121 YALSANNKTHTLNCLIREVDN--NNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFE 178

Query: 155 SGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQS 214
           +GL+QF+D +LKL +S+++ Y+++  V+ F  E+G  Y  L+SD+   KV+ +L+E+   
Sbjct: 179 TGLVQFYDLQLKLLNSINTPYRDIKIVKTF-EENGLEYMLLISDLKDQKVALQLYEVSTE 237

Query: 215 DSATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLA- 273
           +      EL+S I+EN  L+DS + YQFG++YRL  + + +Y++P  Q +  +++PFL+ 
Sbjct: 238 EKK--VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSE 295

Query: 274 ---PESIISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNS 330
                 +IS KPI+TNR LLT  NKI+LLDLLH +ILS+RE+ H+K FQ+L+TA+    S
Sbjct: 296 IEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGS 355

Query: 331 TLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMSRENKSQHLQPLISTL 390
             +  T+ALG+S K+G NP+S+L+IINIDVG+ +L+DS+GK F+ R N+ Q     +   
Sbjct: 356 E-SKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPE 414

Query: 391 NDTEAAEFNYDRILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVST 450
              E    N+  IL +L K A++ E FD  FF  L IK   +T++ RF+ND+ FL  V  
Sbjct: 415 PKYELPSINFPEILGKL-KNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASVLD 473

Query: 451 LIFKS--FKSEYPKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELV 508
           LIF    +    P++L +LLT+PLFP      LL K+K + RLFKQAIVTCPNL L EL+
Sbjct: 474 LIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCPNLPLQELL 533

Query: 509 QELFTVINDELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKN- 567
           QELFT+ N EL +D+S+RILQD+ KD+IKE IK+  ++ V NF+NF+I  N  E  + + 
Sbjct: 534 QELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVSDF 593

Query: 568 ---KPRLFQLLSLVLDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEK 619
               P++F+LLSL+LDS+GLF LE  +L +L+  I++++ + + NVEL+N+++ K
Sbjct: 594 TMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIAERNVELWNIMDAK 648

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  325 bits (833), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 153/213 (71%), Positives = 184/213 (86%), Gaps = 3/213 (1%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60
           MPSISQPFRLTALPKIASLNNYATQG+YLQVADTLTP TN +NVG+SGSA+SQY+INPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVADTLTPATNRVNVGISGSAISQYVINPTP 60

Query: 61  KLVYNQPISSTNVVSACAVAEITTTSEK---DSQEVICYGIQSNRVYSLCATIKPVSSTA 117
           KLVYN PISSTNVV+AC VAE+  T+ +   ++ EV+CY +Q+N+ +S+CA  KP+ S A
Sbjct: 61  KLVYNLPISSTNVVTACDVAEVAGTNNEGTAEAHEVLCYALQANKTFSICAVKKPIPSAA 120

Query: 118 SDSSFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKN 177
           +DSSFGETYA HKV++++Q VN+KVFP TKSIVAVL SGLIQFFD++LKLQHS+DSSY N
Sbjct: 121 TDSSFGETYATHKVALANQAVNVKVFPATKSIVAVLSSGLIQFFDYDLKLQHSIDSSYGN 180

Query: 178 VSYVQHFTSESGQRYTFLLSDIDGHKVSFKLFE 210
           V +VQHF SES Q + FLLSD+DG KVSFKL +
Sbjct: 181 VQFVQHFVSESKQDFMFLLSDLDGRKVSFKLLK 213

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  313 bits (801), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 228/673 (33%), Positives = 350/673 (52%), Gaps = 94/673 (13%)

Query: 3   SISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTPKL 62
           SISQPF +  +P+ AS      Q   L    +LT   N ++V VS  ++SQYIINPTPKL
Sbjct: 4   SISQPFTIANVPRQAS------QTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKL 57

Query: 63  VYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDSSF 122
           V ++ I S   V+A                   Y  QSN   S C  +            
Sbjct: 58  VNSKAIPSNLTVTAFDNG--------------VYATQSNN-KSFCLYLD----------- 91

Query: 123 GETYAAHKVSVSDQIVNL---KVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVS 179
                +H++ +   +VN    K+  ++    A+L+ G +Q               YK   
Sbjct: 92  ----ESHQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQ--------------KYKGGE 133

Query: 180 --YVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKD-- 235
             + +H   +  ++  F    IDG    + L    QS +      L+ + +      +  
Sbjct: 134 QVFAKHLPLKDIKQVEF----IDGQ---YALIVAAQSTALYELENLTELRVSTTLHFEQF 186

Query: 236 SQIFYQFGQVYR--LHGNAVSIYNLPHFQHSRTIELPFLAPE--SIISFKPISTNRALLT 291
            QI    G++Y+  L  N   I+ L        + +PFL+    + ++F  +  +R  L 
Sbjct: 187 KQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLA 246

Query: 292 SDNKIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSS 351
             N+I+LLDL   ++LS     H K  QL +  +I G      +  +  +++ HG   ++
Sbjct: 247 LANEIYLLDLHLGSVLS-----HNKFAQLKQVELIAGA-----RDGSFAIALSHGPQDNA 296

Query: 352 -SLDIINIDVGTGTLRDSMGKGFMS--RENKSQH----LQPLISTLNDTEAAEFNYDRIL 404
            SLDIIN+++G+ +++DS+GKGF +  +E +S      L+P++   + T+ + F+Y  IL
Sbjct: 297 VSLDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTKRS-FDYASIL 355

Query: 405 KELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK----SEY 460
           K+L+ AA +   FD +FFK L I    YT+ DRF+ D+ FL +   +I K++     S+Y
Sbjct: 356 KKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKY 415

Query: 461 PKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELC 520
           P A TYLLT+PLFP   T +LL K+K  PRL+KQ IVTCPNL LDEL+ E F + N+EL 
Sbjct: 416 PAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELS 475

Query: 521 LDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVIS--ENFEEDRIKNKPRLFQLLSLV 578
           LDLSL+ILQD+ KDSIK+ +K   +++V NFI FVI    N +E  +   P+LFQLLSLV
Sbjct: 476 LDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVAT-PQLFQLLSLV 534

Query: 579 LDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEKNFKNGF-GQPLGDTSTSGE 637
           +DS+GLFAL+ E+L +L  YID  + + + N EL+NL+E +  K    G        + +
Sbjct: 535 IDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKTQK 594

Query: 638 PVITAYSIEQLEL 650
            V   Y ++ LE+
Sbjct: 595 KVFPPYLVDHLEI 607

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  304 bits (778), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 213/641 (33%), Positives = 361/641 (56%), Gaps = 94/641 (14%)

Query: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60
           MPSISQPF +T +PK +S +      +      +LT  +N+++V +S  AVS+++INPTP
Sbjct: 1   MPSISQPFAITTVPKQSSTSPIIVSSH------SLTANSNSLDVAISKYAVSKFVINPTP 54

Query: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS 120
           KL+ + PI S  VV+A               + +      N+ Y+L    K         
Sbjct: 55  KLINSIPIPSNEVVTAF-------------HDTVFATATVNQKYTLHLNGK--------- 92

Query: 121 SFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSY 180
                    KV +  +I  +K+F D    + +L +G I+ +D  L ++ +  + +K++  
Sbjct: 93  ---------KVPIQSKI--MKLFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVN 140

Query: 181 VQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFY 240
           V+   S    +Y  L+S     + S  L++I           +  ++  +    D ++ Y
Sbjct: 141 VEFIES----KYALLIS-----QNSISLYDINTMIELRNVANVQDIVDSDFKSLDGKL-Y 190

Query: 241 QFGQVYRLHGNAVSIYNLPHFQHSRTIELPFL--APESIISFKPISTNRALLTSDNKIFL 298
           QF Q      +   I+ +        I +PF+    + ++SF  +  N  ++  ++ I+ 
Sbjct: 191 QFNQ----KLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYA 246

Query: 299 LDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINI 358
           L+L  ++++S  E+ ++K F+L++         L+N+ + LG+S    +N +   ++IN+
Sbjct: 247 LNLHLSSVISMSELLNLKWFKLIDN--------LSNQFV-LGLSF---NNENYKFELINL 294

Query: 359 DVGTG-TLRDSMGKGFMS------RENKSQHLQPLIST-------LNDTEA---AEFNYD 401
           D+ +   L+DS+GKGF +       E ++  L+ L S         ND+++     FNYD
Sbjct: 295 DLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYD 354

Query: 402 RILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK---- 457
           +I+ +L+KA  N   FD +FF++  IK  +YT++DRF+ +++FL  V  LI +++K    
Sbjct: 355 KIIVDLNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVIELILQNYKFDTD 414

Query: 458 -SEYPKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVIN 516
            + YPK LTYLLT+PLFPVS T NLL K ++ PRL+KQAIVTCPNL L EL+ +LFT+ N
Sbjct: 415 GNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIEN 474

Query: 517 DELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLS 576
           +EL LD+SLR+LQD+ KDSIKE IK   K+D+ NFI FV  +  E+ ++ +  +LFQLLS
Sbjct: 475 NELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQD--EDQQVSS--QLFQLLS 530

Query: 577 LVLDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVE 617
           L++DS+GLFAL+ ++L +++ +I+++  V K+N EL +L++
Sbjct: 531 LIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLD 571

>CAGL0J00451g Chr10 complement(36171..37169) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P00359 Saccharomyces
           cerevisiae YGR192c TDH3 glyceraldehyde-3-phosphate
           dehydrogenase 3 or uniprot|P00358 Saccharomyces
           cerevisiae YJR009c TDH2 or uniprot|P00360 Saccharomyces
           cerevisiae YJL052w TDH1
          Length = 332

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 82/201 (40%), Gaps = 40/201 (19%)

Query: 437 RFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTN------PLFPVSHTHNLLQKLKDHP- 489
           + VND ++  DV+ +   S  +     L  +L +       L    H+    QK  D P 
Sbjct: 131 KGVNDDKYTSDVTVISNASCTTNCLAPLAKVLQDNFGIEEALMSTVHSQTATQKTVDGPS 190

Query: 490 -RLFKQAIVTCPNLL-------------LDELVQEL----FTVIN-DELCLDLSLRILQD 530
            + ++       N++             L EL  +L    F V   D   +DL++R  +D
Sbjct: 191 KKDWRGGRTASANIIPSSTGAAKAVTKVLPELEGKLTGMAFRVPTVDVSVVDLTVRFAKD 250

Query: 531 FNKDSIKEAIKQKSKIDVNNFINF----VISENFEEDR----------IKNKPRLFQLLS 576
              D IK AIK+ S+ ++   + +    V+S +F  D           I+  PR  +L+S
Sbjct: 251 VTYDEIKAAIKKASEGEMKGILAYTEDAVVSTDFLGDTHSSIFDASAGIQLSPRFVKLVS 310

Query: 577 LVLDSVGLFALENEMLEKLTK 597
              +  G  A   +M+E ++K
Sbjct: 311 WYDNEYGFSARVVDMVELVSK 331

>Kwal_55.20703 s55 (524084..526804) [2721 bp, 906 aa] {ON} YLL026W
           (HSP104) - 104 kDa heat shock protein [contig 140] FULL
          Length = 906

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 349 PSSSLDIINID-VGTGTLRDSMGKGFMSRENKSQHLQPLISTL-NDTEAAEFNYDRILKE 406
           P S+LD+++I   G    RDS  +   S+E + Q LQ  I  L  D EA     +R+L+ 
Sbjct: 389 PDSALDLVDISCAGVAVARDSKPEELDSKERQLQLLQVEIKALERDEEADPTTKERLLQA 448

Query: 407 LSKAA 411
             K A
Sbjct: 449 RQKEA 453

>Ecym_4068 Chr4 (148971..150863) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ADR192C
          Length = 630

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 20/95 (21%)

Query: 300 DLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKT--IALGVSIKHGSNPSS----SL 353
           D  H+ +   R+M   +IF         G  T+N+ +  +A    IK G +  +      
Sbjct: 43  DKTHDILNETRDMMMSRIF---------GEGTINHGSGNLAADRMIKEGEDDGNEDDFGA 93

Query: 354 DIINIDVGTGT-----LRDSMGKGFMSRENKSQHL 383
           D + +D  T T     LRD M  G +S  +K+QHL
Sbjct: 94  DTVLVDSATHTANSSYLRDRMSSGHLSNSSKTQHL 128

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 390  LNDTEAAEFNYDRILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVS 449
            ++DT+  ++N   + K +S      + FD        I++N     DR V D +  E +S
Sbjct: 1138 IDDTDICKWNLSSLRKHISMVEQKAKFFDG------SIRDNLIYGLDRIVTDSQIFEVLS 1191

Query: 450  TLIFKSFKSEYPKAL 464
             +    F  E P+ L
Sbjct: 1192 LVGIADFVKELPQGL 1206

>Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 5/102 (4%)

Query: 152 VLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQ-RYTFLLSDIDGHKVSFKLFE 210
           VL+ GL        KL     +SY       +F   SGQ  YT     + G  +S K  +
Sbjct: 13  VLKRGLTTLTPVSTKLAPPAAASYSQAIKANNFVYVSGQIPYTAENKPVQG-SISDKAEQ 71

Query: 211 IGQSDS---ATPATELSSVILENMCLKDSQIFYQFGQVYRLH 249
           + Q+     A   + L+SV+  N+ L D + F +F  VY  H
Sbjct: 72  VFQNVKNILAESNSSLNSVVKVNVFLADMKNFAEFNSVYAKH 113

>Kpol_478.4 s478 (15750..18491) [2742 bp, 913 aa] {ON}
           (15750..18491) [2742 nt, 914 aa]
          Length = 913

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 349 PSSSLDIINID-VGTGTLRDSMGKGFMSRENKSQHLQPLISTL-NDTEAAEFNYDRILKE 406
           P S+LD+++I   G    RDS  +   S+E + Q LQ  I  L  D +A     DR+ + 
Sbjct: 389 PDSALDLVDISCAGVAVARDSKPEELDSKERQLQLLQVEIQALERDKDADASTKDRLKQA 448

Query: 407 LSKAADNIENFD 418
             + A  IE  +
Sbjct: 449 KKREASLIEELE 460

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 68/147 (46%), Gaps = 26/147 (17%)

Query: 509  QELFTVINDELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNK 568
            QE + ++N      L+L+    F +  I     Q+SKI +      +I+    E++I ++
Sbjct: 1038 QEEYEMVNIPFLQKLTLKKYLRFFQAKISIYSTQRSKISI------MIASPMAEEKIASR 1091

Query: 569  PRLFQLLSLVLDSVGLFALENEMLEKLTKYIDQQLSVVKENV--------ELYNL----- 615
             R+F  L   L   G FA++NE L+K+ ++ +    ++ +N+        E + L     
Sbjct: 1092 -RIFLQLEAFLKIKG-FAIKNEDLKKIVEHSEGSPMLLVKNLFTHFRKRNEAFKLGTVVL 1149

Query: 616  -----VEEKNFKNGFGQPLGDTSTSGE 637
                 +   NFK G+G  LG +S + E
Sbjct: 1150 QEILKIIGMNFKQGYGSVLGFSSHNSE 1176

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 33/78 (42%), Gaps = 4/78 (5%)

Query: 122 FGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSYV 181
           FG +     + V   +++L + PD K +      G I  FD E   Q       +++   
Sbjct: 499 FGRSQQVDPIEVYSDVLSLTIRPDGKQVAVSTLKGQISMFDVENGTQAGNIDCRRDIFSG 558

Query: 182 QH----FTSESGQRYTFL 195
           +H    FTSE+ +R  F 
Sbjct: 559 RHLEDRFTSENSERSKFF 576

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,775,833
Number of extensions: 3393150
Number of successful extensions: 13425
Number of sequences better than 10.0: 111
Number of HSP's gapped: 13868
Number of HSP's successfully gapped: 113
Length of query: 650
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 534
Effective length of database: 40,180,143
Effective search space: 21456196362
Effective search space used: 21456196362
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)