Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14740g3.488ON30230216210.0
Kwal_55.212193.488ON30230210361e-142
YPR147C3.488ON3042937093e-92
SAKL0F02860g3.488ON3053047084e-92
Smik_16.4003.488ON3042937051e-91
Skud_16.4423.488ON3042937023e-91
Kpol_480.173.488ON3133056869e-89
Suva_16.4763.488ON3043046815e-88
TBLA0C044503.488ON3092986731e-86
TPHA0D042203.488ON3163056618e-85
TDEL0D055603.488ON3113036434e-82
AFR306C3.488ON3192806382e-81
CAGL0L08514g3.488ON3123156285e-80
Ecym_12413.488ON3052985963e-75
NCAS0F035303.488ON3132895878e-74
ZYRO0D10076g3.488ON3052995391e-66
NDAI0B058303.488ON3293244958e-60
KAFR0E03110singletonON35696910.006
TPHA0L016008.524ON372108900.009
Smik_2.3458.524ON375134820.078
KLTH0B02728g5.228ON290110760.45
Suva_4.4598.524ON375134760.47
KLTH0H14322g1.460ON68163750.77
Kwal_30.128965.535ON18840711.2
Skud_2.3318.524ON376130721.3
TDEL0B032508.524ON348119721.3
YBR204C (LDH1)8.524ON375130721.6
Kpol_299.68.524ON349107712.0
Kwal_33.152815.228ON287108702.1
ZYRO0F09064g8.524ON349106702.2
Smik_7.778.155ON2672187703.0
NCAS0C025408.473ON109354703.3
SAKL0G12144g5.228ON301105684.4
ZYRO0D12738g5.535ON233114665.4
Suva_7.688.155ON2672184676.8
NCAS0B054608.155ON268868676.8
AGL359CsingletonON37541667.4
KNAG0J016308.662ON28858658.8
TBLA0A028805.310ON594141669.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14740g
         (302 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   629   0.0  
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   403   e-142
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   277   3e-92
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   277   4e-92
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   276   1e-91
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   275   3e-91
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   268   9e-89
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   266   5e-88
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   263   1e-86
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   259   8e-85
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   252   4e-82
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   250   2e-81
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   246   5e-80
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   234   3e-75
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   230   8e-74
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   212   1e-66
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   195   8e-60
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               40   0.006
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    39   0.009
Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON...    36   0.078
KLTH0B02728g Chr2 complement(211394..212266) [873 bp, 290 aa] {O...    34   0.45 
Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON...    34   0.47 
KLTH0H14322g Chr8 (1246601..1248646) [2046 bp, 681 aa] {ON} simi...    33   0.77 
Kwal_30.12896 s30 (4983..5549) [567 bp, 188 aa] {ON} YDR428C - H...    32   1.2  
Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON...    32   1.3  
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    32   1.3  
YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}  ...    32   1.6  
Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON} (14238..15...    32   2.0  
Kwal_33.15281 s33 (1041857..1042720) [864 bp, 287 aa] {ON} YLR00...    32   2.1  
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    32   2.2  
Smik_7.77 Chr7 (125927..133945) [8019 bp, 2672 aa] {ON} YGL195W ...    32   3.0  
NCAS0C02540 Chr3 (473922..477203) [3282 bp, 1093 aa] {ON} Anc_8....    32   3.3  
SAKL0G12144g Chr7 complement(1034186..1035091) [906 bp, 301 aa] ...    31   4.4  
ZYRO0D12738g Chr4 complement(1076930..1077631) [702 bp, 233 aa] ...    30   5.4  
Suva_7.68 Chr7 (126915..134933) [8019 bp, 2672 aa] {ON} YGL195W ...    30   6.8  
NCAS0B05460 Chr2 (1024533..1032599) [8067 bp, 2688 aa] {ON} Anc_...    30   6.8  
AGL359C Chr7 complement(29052..30179) [1128 bp, 375 aa] {ON} Non...    30   7.4  
KNAG0J01630 Chr10 (299901..300767) [867 bp, 288 aa] {ON} Anc_8.662     30   8.8  
TBLA0A02880 Chr1 complement(695847..697631) [1785 bp, 594 aa] {O...    30   9.4  

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/302 (100%), Positives = 302/302 (100%)

Query: 1   MKIEASFVGGEPSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWE 60
           MKIEASFVGGEPSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWE
Sbjct: 1   MKIEASFVGGEPSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWE 60

Query: 61  ILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVT 120
           ILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVT
Sbjct: 61  ILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVT 120

Query: 121 SGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFL 180
           SGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFL
Sbjct: 121 SGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFL 180

Query: 181 TSWIISHFADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCET 240
           TSWIISHFADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCET
Sbjct: 181 TSWIISHFADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCET 240

Query: 241 KGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQH 300
           KGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQH
Sbjct: 241 KGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQH 300

Query: 301 YF 302
           YF
Sbjct: 301 YF 302

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  403 bits (1036), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 191/302 (63%), Positives = 230/302 (76%)

Query: 1   MKIEASFVGGEPSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWE 60
           MK   + V   P S+ H  +G++S G +A LFVFIPGNPGLIE+Y PFL Q+HEKNP WE
Sbjct: 1   MKSIQNCVDPLPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWE 60

Query: 61  ILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVT 120
           ILGISHAGMNSC++   PVY+L++QI+HK+++IN Y    K I IMGHSVGAF+ QK+ T
Sbjct: 61  ILGISHAGMNSCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITT 120

Query: 121 SGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFL 180
           S  L  +V RVGLLTPTVIDIHKSEKG+KLT+IT   P FH +VS L+W  FEKL P  +
Sbjct: 121 SRRLKSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKI 180

Query: 181 TSWIISHFADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCET 240
           T  IIS   DDP++CLGA T LL+TNSRFVKQALGLA EE++VIRSDW YQK+FL  C+ 
Sbjct: 181 TKSIISLLVDDPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQE 240

Query: 241 KGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQH 300
              KIWWLFS+ DHWVS  TR D+I FY +HSSP L  IDVS+ IEHAFVRRHA +V++ 
Sbjct: 241 NDTKIWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQ 300

Query: 301 YF 302
           YF
Sbjct: 301 YF 302

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  277 bits (709), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 192/293 (65%), Gaps = 2/293 (0%)

Query: 12  PSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS 71
           P SIL++K  V+  G DA L V+IPGNPGL+ YY   L  +H K+PDWEILGISHAGM  
Sbjct: 12  PCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMTL 71

Query: 72  CNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVARV 131
                 P+++LQ+Q++H+V+VIN+++  N+KI IMGHSVGA+I QKV  S  L   V +V
Sbjct: 72  NAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCLSNKLVGSVQKV 131

Query: 132 GLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISHFADD 191
           GL+TPTV+DIH SE G+K+TA     P    +VS   +I F  +  +  + +II  F   
Sbjct: 132 GLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMGC 191

Query: 192 PKTCLGA--ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWLF 249
             T   A  +TR+ LT+ +FV+Q+LGLA +EM+ I ++WE+Q  F++YCE  G  IW+LF
Sbjct: 192 GSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFLF 251

Query: 250 SDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302
           S NDHWVS +TR  L  +Y+     E + IDV+  I H+FV +HA+  +  +F
Sbjct: 252 SSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAINAFF 304

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  277 bits (708), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 139/304 (45%), Positives = 191/304 (62%), Gaps = 3/304 (0%)

Query: 1   MKIEASFVGGEPSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWE 60
           M I+     G  SS+ HLK     + S   LFVFIPGNPGLIE+Y  FL Q+ +K+ +WE
Sbjct: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60

Query: 61  ILGISHAGM-NSCNDIACP--VYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQK 117
           ILGISHAGM   C  +  P  VY+L++Q+ HK+ VIN +   N+ + I GHS+GA+I QK
Sbjct: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120

Query: 118 VVTSGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFP 177
           +     L   V ++ LLTPTVIDIH SEKG KL  I E  P FH  V+   W+ FEK+ P
Sbjct: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180

Query: 178 DFLTSWIISHFADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHY 237
             +T  I+S F    +TC+  A +LL+TN  FV+Q+LGLA EEMQ +R DW +Q  FL +
Sbjct: 181 QTITEKILSLFVGSEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQF 240

Query: 238 CETKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVV 297
           C+++  ++ +LF+  DHWV+S+TR DL +FY  +   + ++ID    I H+FV    + V
Sbjct: 241 CKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTKSV 300

Query: 298 VQHY 301
           V  Y
Sbjct: 301 VDRY 304

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  276 bits (705), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 191/293 (65%), Gaps = 2/293 (0%)

Query: 12  PSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS 71
           P SIL++K  ++    DA L V+IPGNPGL+ YY   LQ +H K+PDWEILGISHAGM  
Sbjct: 12  PCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWEILGISHAGMTL 71

Query: 72  CNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVARV 131
                 PVY+LQ+Q++H+V+VIN+++  N+KI IMGHSVGA+I QKV  S  L   V +V
Sbjct: 72  NAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSHNLVGTVQKV 131

Query: 132 GLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISHFADD 191
           GL+TPTV+DIH SE G+KLT      P    +VS   +I F  +  +  + +II  F   
Sbjct: 132 GLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMGC 191

Query: 192 PKTCLGA--ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWLF 249
             T   A  +TR+ LT+ +FV+Q+LGLA++EM+ I ++WE+Q  F++YCE  G  IW+LF
Sbjct: 192 GSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYCEQNGTLIWFLF 251

Query: 250 SDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302
           S NDHWVS +TR  L  +Y+       + IDV+  I H+FV +HA+  +  +F
Sbjct: 252 SSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAINTFF 304

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  275 bits (702), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 133/293 (45%), Positives = 197/293 (67%), Gaps = 2/293 (0%)

Query: 12  PSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS 71
           P SIL++K  V++   DA L V+IPGNPGL+ YY   LQ +H K+PDWEILG+SHAGM  
Sbjct: 12  PCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWEILGVSHAGMTL 71

Query: 72  CNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVARV 131
                 P+++LQ+Q++H+V+VIN+++  N+KI IMGHSVGA+I QKV  S  L   V ++
Sbjct: 72  NAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSDKLVGSVRKI 131

Query: 132 GLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISHFADD 191
           GL+TPTV+DIH SE G+K+TA+    P    +VS L ++ F  +  + L+ ++I  F   
Sbjct: 132 GLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGLSRFVIDKFMGC 191

Query: 192 PKTCLGA--ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWLF 249
             T   A  +TR+LLT+ +FV+Q+LGLA++EM+ I ++WE+Q +F++YC+     IW+LF
Sbjct: 192 GSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYCQENEIFIWFLF 251

Query: 250 SDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302
           S  DHWV+ +TR  L  +Y+     E + IDV+  I H+FV +HA+  V  +F
Sbjct: 252 STKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAVNTFF 304

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  268 bits (686), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 137/305 (44%), Positives = 192/305 (62%), Gaps = 18/305 (5%)

Query: 12  PSSILHLKSGVSSLG-SDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMN 70
           P+SI+HL      L   D+ LFV+IPGNPGL+EYYV FL  VH+KNP WE+LGISHAGM+
Sbjct: 13  PTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMS 72

Query: 71  ----------SCNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVT 120
                     S ND    V+ L+EQ+ HKVD+IN ++  N+ + IMGHSVGA++ Q+V+ 
Sbjct: 73  YDGNEKKKKTSSND-KFKVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGAYLTQRVIM 131

Query: 121 SGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFL 180
           +  LN ++ +VG LTPTV+DIH S+KG+K+T +          V  +    F KL P F 
Sbjct: 132 TNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFF 191

Query: 181 TSWIISHF---ADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHY 237
             + IS     ++D    L + T  LL N+  ++QALGLAT EM+ I  DW + K  + Y
Sbjct: 192 VKFFISKMIKCSEDSNAVLASGT--LLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDY 249

Query: 238 CETKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVV 297
           C   G K W+LF+++DHWV+  TRK++I FY+ H+ PE + ID+ T I HAFV + ++ +
Sbjct: 250 CNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDT-IPHAFVIKKSKYI 308

Query: 298 VQHYF 302
           V  YF
Sbjct: 309 VDQYF 313

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  266 bits (681), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 195/304 (64%), Gaps = 2/304 (0%)

Query: 1   MKIEASFVGGEPSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWE 60
           M I+       P SIL++K  V++   DA L V+IPGNPGL+ YY   +  +H K+PDWE
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60

Query: 61  ILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVT 120
           ILGISHAGM+S      P+++LQ+Q++H+V VIN+++  N+KI IMGHSVGA+I QKV  
Sbjct: 61  ILGISHAGMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCL 120

Query: 121 SGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFL 180
           S  L   V +VGL+TPTV+DIH SE G+K+T      P    ++S + ++ F  +  + L
Sbjct: 121 SNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGL 180

Query: 181 TSWIISHFADDPKTCLGA--ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYC 238
           +  II  F         A  +TRL LT+ +FV+Q+LGLA++E++ I ++WE+Q  F+++C
Sbjct: 181 SKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHC 240

Query: 239 ETKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVV 298
           E KG   W+LFS  DHWV+ ETRK L  +Y      E + IDV+  + H+FV +HA+  +
Sbjct: 241 EEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAI 300

Query: 299 QHYF 302
             +F
Sbjct: 301 NAFF 304

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  263 bits (673), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 129/298 (43%), Positives = 183/298 (61%), Gaps = 7/298 (2%)

Query: 12  PSSILHLKSGVS-SLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMN 70
           P+SI+H        +  D  LF++IPGNPGL+EYY   L+ +H+K P WEILG+SHAGM+
Sbjct: 12  PTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMS 71

Query: 71  SCNDI----ACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLND 126
           + N I    +  VYTL EQ++HKV+VIN+++   + I IMGHSVGA++AQ+V+    L  
Sbjct: 72  NGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIG 131

Query: 127 EVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIIS 186
            V ++GL+TPTV+DIH+S KG+K+T     F      +  L  +AF KLFP   T W+++
Sbjct: 132 NVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKLFPAIFTRWLLT 191

Query: 187 HF--ADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAK 244
                 +       A+ + LTN  FVKQ LGLA+ EM+ IR DW +QK  + YC  +   
Sbjct: 192 IIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVS 251

Query: 245 IWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302
            W+LFS  DHWVS +TR +LI FY  +   +++ + VS  I H+FV   +   V  YF
Sbjct: 252 TWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINFSDFTVNSYF 309

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  259 bits (661), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 135/305 (44%), Positives = 193/305 (63%), Gaps = 14/305 (4%)

Query: 12  PSSILHLKSG--VSSLGSD-------ACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEIL 62
           P+SIL +K       L  D       + LFV+IPGNPGL+EYY  FL+ +H KNP+W+IL
Sbjct: 12  PTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKLLHVKNPEWDIL 71

Query: 63  GISHAGMNSCN----DIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKV 118
           GISHAGM+S N    +  C VYTL EQI+HK+++IN +A   +++ +MGHSVGAF+AQKV
Sbjct: 72  GISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMGHSVGAFMAQKV 131

Query: 119 VTSGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPD 178
           V S  L  +V ++GLL PTVIDIH SEKG +++ I    P   QL   +    F    P 
Sbjct: 132 VMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWVSEKIFGGFLPI 191

Query: 179 FLTSWIISHFAD-DPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHY 237
            L  +IIS F + + +     AT   L +S FV+Q+LGLA  EMQ+IR DWE+Q++ +  
Sbjct: 192 TLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKM 251

Query: 238 CETKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVV 297
           C     ++W LF+++DHWVS++TR +LI+ Y    + +  S  ++  + HAFV +++  V
Sbjct: 252 CNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQVPHAFVIKNSCHV 311

Query: 298 VQHYF 302
           V +YF
Sbjct: 312 VDNYF 316

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  252 bits (643), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 189/303 (62%), Gaps = 18/303 (5%)

Query: 12  PSSILHLKSGVSSLGSDAC-LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMN 70
           P+SI+H KS +S  G   C LFV+IPGNPGLIEYY  FL  +H ++P+WE+LGISHAGM+
Sbjct: 12  PTSIVHFKS-ISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMS 70

Query: 71  SC----------NDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVT 120
           +           ND    VY+L++QI+HK+++I  ++  N+ + IMGHSVGA++ Q +V 
Sbjct: 71  TASVSKSEKSERND----VYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYMVQHIVL 126

Query: 121 SGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFL 180
           S  L  +VA++GLLTPT++DIH S+KG+ LT +        QL      + F    P F+
Sbjct: 127 SDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGFFLPSFI 186

Query: 181 TSWIISHFADDPKTCLGA-ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCE 239
              ++S F    +   G   T +LL N  FVKQALGL+  EM+ IRSDW +Q+  + +C 
Sbjct: 187 LRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCN 246

Query: 240 TKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQ 299
            +G   W LFSD+DHWV+  TR+DLI+FY  H   + + I  +  I H+FV  H++ ++ 
Sbjct: 247 ERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLNHSKYLIS 305

Query: 300 HYF 302
            YF
Sbjct: 306 EYF 308

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  250 bits (638), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 179/280 (63%), Gaps = 7/280 (2%)

Query: 30  CLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCN--DIACPVYTLQEQIN 87
           C+ +F+PGNPGLI +Y  FL+ +HEKNP WEI+GISH GM++    +    VYTL EQ+ 
Sbjct: 40  CILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVE 99

Query: 88  HKVDVINSYAQ--GNKKITIMGHSVGAFIAQKVVTSGLLNDEVARVGLLTPTVIDIHKSE 145
           HKV  IN + +  GN  + ++GHS+GA++AQKVV    L   V  VGLLTPT+IDIH+S 
Sbjct: 100 HKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSP 159

Query: 146 KGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISHFADDPKTCLGAATRLLLT 205
           KG++LT I+E FPRF++ VS +D +  E L P    SW+          C+  +   L+ 
Sbjct: 160 KGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGSDECVLQSAEKLVK 219

Query: 206 NSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWLFSDNDHWVSSETRKDLI 265
           N  +V+QALG+A  EM  +R+ W++Q++F+  C+ + + +W LFS +DHWV S+T KD++
Sbjct: 220 NPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKDIV 279

Query: 266 QFYERH---SSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302
           +FYE     ++  L+ I +   I H+FV +    VV  YF
Sbjct: 280 EFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  246 bits (628), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 134/315 (42%), Positives = 188/315 (59%), Gaps = 16/315 (5%)

Query: 1   MKIEASFVGGEPSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWE 60
           M ++       P+ I+H+K  V++    + LFV+IPGNPGL+EYY  FL +VH+KNP WE
Sbjct: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60

Query: 61  ILGISHAG-------MNSCNDIACPVYTLQEQINHKVDVINSYAQG-NKKITIMGHSVGA 112
           ILGISHAG       +        P+Y L++Q  HK+D+IN      N+++ IMGHSVGA
Sbjct: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVGA 120

Query: 113 FIAQKVVTSGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAF 172
           +IAQ VV+S  L   V+++GL+TPT+ DIHKS  GL  T +       ++ +S +    F
Sbjct: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180

Query: 173 EKLFPDFLTSWIISHFA-----DDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSD 227
            KL P + T  +IS FA     D+    LG  T LLLT    ++Q LGLA  EM  IR D
Sbjct: 181 NKLIPAYWTKLLIS-FAMGCSFDEYHIILG--TFLLLTQRETLRQVLGLAAHEMLEIRDD 237

Query: 228 WEYQKDFLHYCETKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEH 287
           W +Q++ L  C+  G K+W LFSDNDHWVS  T+ +LI+F +      L+ +DV   I+H
Sbjct: 238 WAFQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKH 297

Query: 288 AFVRRHAQVVVQHYF 302
           +FV +   +V + YF
Sbjct: 298 SFVVKDVDLVTRRYF 312

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  234 bits (596), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 186/298 (62%), Gaps = 11/298 (3%)

Query: 13  SSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSC 72
           + ILH+ S  +  G    L +FIPGNPGLI +Y  FL+ +HE+NP WE++GI H GM+S 
Sbjct: 11  ADILHIYSQSTPPGP---LLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSL 67

Query: 73  ---NDIACPVYTLQEQINHKVDVINSY--AQGNKKITIMGHSVGAFIAQKVVTSGLLNDE 127
              N ++  V+TL EQI  KV VIN +  A G++ I ++GHS+GA++ QK+     L  +
Sbjct: 68  RENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGK 127

Query: 128 VARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISH 187
           +  V LLTPT+IDIH+S KG++LT I++ FP+F++    +D + F+ + P     WI   
Sbjct: 128 IDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARK 187

Query: 188 FADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWW 247
                  C+  + + L++   FVKQALGLA  EM  +R+ W++Q +F+ +C+    K+ +
Sbjct: 188 LIGGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRF 247

Query: 248 LFSDNDHWVSSETRKDLIQFYE-RHSSPE--LVSIDVSTAIEHAFVRRHAQVVVQHYF 302
           LFS +DHWV  +T KD+I+ YE ++SS E  L++I +   I H+FV +    VV  YF
Sbjct: 248 LFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  230 bits (587), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 176/289 (60%), Gaps = 21/289 (7%)

Query: 31  LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS--------CNDIACPVYTL 82
           +FV+IPGNPG++EYY   L  +HEK+P WEIL ISH GMN+         +     V+TL
Sbjct: 29  VFVWIPGNPGILEYYQEMLINLHEKHPTWEILAISHIGMNTKTTSLFKGSHQDNSRVFTL 88

Query: 83  QEQINHKVDVINSYAQ-GNKKITIMGHSVGAFIAQKVVTSGLLNDEVARVGLLTPTVIDI 141
           +EQI HK+ +IN++ +  N  I I GHSVGA++ QK+V S  L  +V ++GL+TPT+IDI
Sbjct: 89  KEQIQHKIKIINNFVKDSNVPIYISGHSVGAYMVQKIVASDELIGQVLKMGLITPTIIDI 148

Query: 142 HKSEKGLKLTAITERFPRFH-----QLVSALDWIAFEKLFPDFLTSWIISHFADDPKTCL 196
           H SEKG  +T    R+ R+       ++S L +I F  L P  L S+II +         
Sbjct: 149 HLSEKGKSMT----RYARWSCRQLPHILSFLCYIVFGWLVPGILRSYIIGYVMGCHHDSQ 204

Query: 197 GA-ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWLFSDNDHW 255
            A +T L LT   FV+Q+LGLA EEM  I  DW++Q + + YC     KI +LFS  DHW
Sbjct: 205 AAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQFQAELIEYCLKNSIKIQFLFSATDHW 264

Query: 256 VSSETRKDLIQFYERH--SSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302
           V   TRK++IQFY+     +  L+ IDVS    H+FV R ++ VV+HYF
Sbjct: 265 VREATRKEIIQFYQERCKGAKALLKIDVSDQFPHSFVVRRSKYVVEHYF 313

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  212 bits (539), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 118/299 (39%), Positives = 178/299 (59%), Gaps = 13/299 (4%)

Query: 12  PSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS 71
           P+S+LH+K    S    + LFV+IPGNPG+++YY  FL  +HEK   +EIL ISHAGM +
Sbjct: 12  PTSVLHIKPKSPS--PSSPLFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMAT 69

Query: 72  ----CNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDE 127
                      +YTL +QI HKV++IN ++  ++ + +MGHSVGA++AQ VV +  L   
Sbjct: 70  EDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGR 129

Query: 128 VARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIA---FEKLFPDFLTSWI 184
           V ++GL+TPTV+DIH+S+KG   T +T  F     L     W++   F KL     T  +
Sbjct: 130 VVKLGLITPTVVDIHRSQKG---TQLTRAFYWVKYLPDIAAWVSDMLFNKLSSIMFTDQV 186

Query: 185 ISHFAD-DPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGA 243
           IS F   D ++   A ++ L+ N   ++QALGLA  EMQ IR  W +QK  + +C +   
Sbjct: 187 ISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEI 246

Query: 244 KIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302
           +  ++FS ND WVS+ TR+ L+ FY  +     + I VS  + H+F+ +H++ +V  YF
Sbjct: 247 ETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHSKYIVDEYF 305

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  195 bits (495), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 184/324 (56%), Gaps = 39/324 (12%)

Query: 12  PSSILHLKSG--VSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGM 69
           P+SI+H+++   + +  S   LF++IPGNPG+++YY  FL  +H+K+P WEIL I HAGM
Sbjct: 12  PTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPHWEILAIPHAGM 71

Query: 70  NSCNDIACPVYT--------LQEQINHKVDVINSY---------AQGNKKITIMGHSVGA 112
               D + PVY         L EQI HK++VI ++             + + IMGHSVG 
Sbjct: 72  ----DTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVIMGHSVGT 127

Query: 113 FIAQKVVTSGLLNDEV-------ARVGLLTPTVIDIHKSEKGLKLT---AITERFPRFHQ 162
           ++ Q++V +    D +        ++G +TPT+IDI+ S KG+ ++    +T  +  +  
Sbjct: 128 YMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTHGYLPY-- 185

Query: 163 LVSALDWIAFEKLFPDF--LTSWIISHFADDPKTCLGA-ATRLLLTNSRFVKQALGLATE 219
           ++S L +  F  +   F  +   +I++      T   A  T +LLTNS  VKQ+LGLA+ 
Sbjct: 186 ILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSLGLASI 245

Query: 220 EMQVIRSDWEYQKDFLHYCETKGAKIWWLFSDNDHWVSSETRKDLIQFYE-RHSSPELVS 278
           EMQ IR +W+ QK F+  C     ++W LF + DHWV++ TR DLI+FY+  +     + 
Sbjct: 246 EMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNYKDISRLQ 305

Query: 279 IDVSTAIEHAFVRRHAQVVVQHYF 302
           I+VS+   H+FV  H+  VV+ +F
Sbjct: 306 IEVSSEFPHSFVVNHSDWVVERFF 329

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 4/96 (4%)

Query: 21  GVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCNDIACPVY 80
            V  + SD+ LF+ IPG  G +E + P ++ +   N ++  L I   G     D +    
Sbjct: 73  NVDRIDSDS-LFLCIPGLGGNLEQFEPLVRLIDASNKNF--LAIDLPGFGKSEDYSNYSM 129

Query: 81  T-LQEQINHKVDVINSYAQGNKKITIMGHSVGAFIA 115
           T +   I+  ++ +   A  N KI +MGHS+G  +A
Sbjct: 130 THIATLIDQMLETVIGTAPDNYKINVMGHSMGTHLA 165

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 49/108 (45%), Gaps = 2/108 (1%)

Query: 31  LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCND-IACPVYTLQEQINH- 88
           +++FI G  G +E ++P L+     N  +  + +   G +  ND      Y++   I   
Sbjct: 91  IYIFIHGLGGSLEQFLPLLKLTDLSNKSFIAVDLPGFGQSEFNDEYNIANYSMSSIIGFL 150

Query: 89  KVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVARVGLLTP 136
           K  V + Y   N KI + GHS+G ++A           ++ ++ LL P
Sbjct: 151 KSQVFSRYLTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 36.2 bits (82), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 62/134 (46%), Gaps = 16/134 (11%)

Query: 31  LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS-CND------------IAC 77
           +FVF+PG  G +E + P L+ V      +  L +   G +S  +D            + C
Sbjct: 88  VFVFVPGLAGNLEQFEPLLKLVDSDRKAFLALDLPGFGDSSEWSDYPMLKVVELIFILLC 147

Query: 78  PVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVAR-VGLLTP 136
            V   +  +  K D +N +     K+ ++GHS+G F+A  +    L++ +V + + LLTP
Sbjct: 148 DVLKGRPAVLSKDDNLNFF--NGHKLVLVGHSMGCFLACHLYEQHLVDAKVVKTLVLLTP 205

Query: 137 TVIDIHKSEKGLKL 150
               I +  K  ++
Sbjct: 206 PKAHIEQLSKDKRI 219

>KLTH0B02728g Chr2 complement(211394..212266) [873 bp, 290 aa] {ON}
           similar to uniprot|Q07897 YLR003C Saccharomyces
           cerevisiaeCMS1 Hypothetical ORF
          Length = 290

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 49/110 (44%), Gaps = 12/110 (10%)

Query: 52  VHEKNPDWEILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSV- 110
           + EKNPD   L +        + I+   Y  +  +++ +D +N++++  + I +   ++ 
Sbjct: 104 IREKNPDLSALELEELYFKKTDFISTERYDKERSLHNILDFVNNFSKSPRAIVLSTSNLR 163

Query: 111 ---------GAFIAQKVVTSGLLNDEVARVGLL--TPTVIDIHKSEKGLK 149
                    G+  A K+ +   L +++ARV  L   P+  D     KG K
Sbjct: 164 VADVFRGLGGSKNAVKLFSKNKLKEDLARVDQLLKAPSSKDRQAKNKGKK 213

>Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 16/134 (11%)

Query: 31  LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS-CNDIACPVYTLQEQINHK 89
           +FVF+PG  G +E + P L+ +  +   +        G +S  ND   P+  + E I   
Sbjct: 88  VFVFVPGLGGNLEQFEPLLKLLDSERKAFLAFDSPGFGQSSEWNDY--PMLKVVELIFVL 145

Query: 90  V-DVINSYAQG-----------NKKITIMGHSVGAFIAQKVVTSGL-LNDEVARVGLLTP 136
           V DV+  +               +KI ++GHS+G F+A  +    L + + V R  LLTP
Sbjct: 146 VCDVLKKWPTAVSKDDDTNLLNGRKIVLVGHSMGCFLACHLYEQHLAILNVVKRFVLLTP 205

Query: 137 TVIDIHKSEKGLKL 150
               I +  K  +L
Sbjct: 206 PKAHIEQLSKDRRL 219

>KLTH0H14322g Chr8 (1246601..1248646) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39992 Saccharomyces cerevisiae YEL023C
           Hypothetical ORF
          Length = 681

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 79  VYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVARVGLLTPTV 138
            +TL + +      +  Y + N KI + G S GAFIA+      +L   + RVGLL   +
Sbjct: 106 AFTLDQHVCSAYLFLMRYYRPNDKIFMFGFSRGAFIAR------ILAGMIERVGLLNEGL 159

Query: 139 IDI 141
            DI
Sbjct: 160 EDI 162

>Kwal_30.12896 s30 (4983..5549) [567 bp, 188 aa] {ON} YDR428C -
           Hypothetical ORF [contig 326] FULL
          Length = 188

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 29/40 (72%), Gaps = 5/40 (12%)

Query: 87  NHKVDVINSYAQ-----GNKKITIMGHSVGAFIAQKVVTS 121
           +H VDVI++ AQ       +++TI+GHSVGA +A ++++S
Sbjct: 16  DHIVDVIDNLAQLIAQEHIEELTILGHSVGATLAWQLLSS 55

>Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON}
           YBR204C (REAL)
          Length = 376

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 57/130 (43%), Gaps = 16/130 (12%)

Query: 31  LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCNDIA-CPVYTLQEQINHK 89
           +F+F+PG  G +E + P L+ +         L +   G    ++ A  P+  + E I   
Sbjct: 89  VFLFVPGLAGNLEQFEPLLKLIDSDQK--AFLALDLPGFGHSSEWADYPMLKVVELIFVL 146

Query: 90  V-DVINSYAQG-----------NKKITIMGHSVGAFIAQKVVTSGLLNDEVA-RVGLLTP 136
           V DV+  +              N+KI + GHS+G F+A  +    L   +V  ++ LLTP
Sbjct: 147 VCDVLKKWPAAVPKDREVNPFDNRKIVLTGHSMGCFLACHLYEQHLAALKVVEKMVLLTP 206

Query: 137 TVIDIHKSEK 146
               I +  K
Sbjct: 207 PKAHIEQLSK 216

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 61/119 (51%), Gaps = 8/119 (6%)

Query: 31  LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCNDIACPVYTLQEQINHKV 90
           LF+FI G  G +E + P L+++ ++N  +    +   G +   D   P+  + + I+  +
Sbjct: 80  LFLFIHGLGGTLEQFEPVLRELDQRNKSFLAFDLPGFGKSDEWD-QYPMLDVVKSIDWLI 138

Query: 91  DVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDE---VARVGLLTPTVIDIHKSEK 146
             + +  +  +K+ ++GHS+G ++A   V   LL  E   ++R+ LL P   ++ +  K
Sbjct: 139 HQLTNNLKF-EKLNLIGHSMGCYLA---VHFYLLFHESWCISRLVLLAPPKPNVDQLSK 193

>YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}
           LDH1Serine hydrolase; exhibits active esterase plus weak
           triacylglycerol lipase activities; proposed role in
           lipid homeostasis, regulating phospholipid and non-polar
           lipid levels and required for mobilization of LD-stored
           lipids; localizes to the lipid droplet (LD) surface;
           contains a classical serine containing catalytic triad
           (GxSxG motif)
          Length = 375

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 55/130 (42%), Gaps = 16/130 (12%)

Query: 31  LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS-CND------------IAC 77
           +FVF+PG  G +E + P L+ V      +  L +   G +S  +D            + C
Sbjct: 88  VFVFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELIFVLVC 147

Query: 78  PVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDE-VARVGLLTP 136
            V           D +N +     KI ++GHS+G F+A  +    + + + V  + LLTP
Sbjct: 148 DVLRKWSTAVPNNDNVNPF--NGHKIVLVGHSMGCFLACHLYEQHMADTKAVQTLVLLTP 205

Query: 137 TVIDIHKSEK 146
               I +  K
Sbjct: 206 PKAHIEQLSK 215

>Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON}
           (14238..15287) [1050 nt, 350 aa]
          Length = 349

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 51/107 (47%), Gaps = 6/107 (5%)

Query: 31  LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCNDI-ACPVYTLQEQINHK 89
           +++FI G  G  E + P L+ V     D + L +   G    +++ +  ++ + E IN+ 
Sbjct: 84  VYLFIHGLGGNFEQFEPLLRLVDAS--DKKFLTMDLPGFGKSDELESYGMFDIIEVINY- 140

Query: 90  VDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVARVGLLTP 136
             V   + +  K I ++GHS+G  ++   +        + ++ LLTP
Sbjct: 141 --VAKKFIKDGKSINVIGHSMGCLLSIHFMEKFSKELNITQLVLLTP 185

>Kwal_33.15281 s33 (1041857..1042720) [864 bp, 287 aa] {ON} YLR003C
           - Hypothetical ORF [contig 94] FULL
          Length = 287

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 47/108 (43%), Gaps = 12/108 (11%)

Query: 37  GNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSY 96
            +P  I  Y+  L  + EKNPD   L +        + ++   Y     +++  D +NS+
Sbjct: 83  SSPERITEYLATL--IREKNPDLSGLELEELYFKKSDFLSTERYAKDRVLDNLQDFVNSF 140

Query: 97  AQGNKKITIMGHSV----------GAFIAQKVVTSGLLNDEVARVGLL 134
           ++  + I +   ++          G+  A K+ +   L ++VARV  L
Sbjct: 141 SKSPRAIVLSTSNIRVADVFRGLGGSKHAVKLFSKNKLKEDVARVDQL 188

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 31  LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCNDIACPVYTLQEQINHKV 90
           LF+FI G  G +E + P L+ V   +  +  L +   G +   D   P+  + E I    
Sbjct: 85  LFLFIHGLGGELEQFEPLLRLVDAMDQRFLALDLPGFGKSDEWD-EYPMLKVVETIEEIA 143

Query: 91  DVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVARVGLLTP 136
              N+      KI ++GHS+G ++      +      + R+ LL+P
Sbjct: 144 AKFNA-----AKIVLVGHSMGCYLTSHFYEAYHKVHSINRIVLLSP 184

>Smik_7.77 Chr7 (125927..133945) [8019 bp, 2672 aa] {ON} YGL195W
            (REAL)
          Length = 2672

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 79/187 (42%), Gaps = 43/187 (22%)

Query: 42   IEYYVPFLQQVHEK--NPDWEILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSYAQG 99
            ++  +P+L  + E   N  + +LG+    M+  +D+  P+  +   ++  +D   + A G
Sbjct: 1987 VDEVLPYLLHMLESSDNSGFALLGLQEI-MSKKSDVIFPIL-IPTLLSPPIDAFRASALG 2044

Query: 100  N----------KKITIMGHSVGAFIAQKVVTSGLLNDEVARVGL---------------- 133
            +          K+++I+   + A +   + TS   NDE  +  L                
Sbjct: 2045 SLAEVAGSALYKRLSII---INALVDAIITTS---NDESTKTALELSLDRVFLSVTDDEG 2098

Query: 134  ---LTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISHFAD 190
               L   ++ + K++   K  AI ER P F    + LD   F+   PDF++  I+S   +
Sbjct: 2099 LHPLLQQIMSLLKNDNIQKRIAILERLPNFFD-KTVLD---FDIYIPDFVSHAILSLDDE 2154

Query: 191  DPKTCLG 197
            DP+   G
Sbjct: 2155 DPRVVNG 2161

>NCAS0C02540 Chr3 (473922..477203) [3282 bp, 1093 aa] {ON} Anc_8.473
           YPL022W
          Length = 1093

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 155 ERFPRFHQLVSALDWIAFEKLFPDFLTSWIISHFADDPKTCLGAATRLLLTNSR 208
           E  P++ QL+S LD IA E+L  D   + +I+    D  TC    TR+L  + R
Sbjct: 468 EEMPKWEQLISILDDIAHERLTKDSQGTTLIA--CSDSATC-AQLTRVLACSDR 518

>SAKL0G12144g Chr7 complement(1034186..1035091) [906 bp, 301 aa]
           {ON} similar to Q07897 YLR003C uniprot|Q07897
           Saccharomyces cerevisiaeCMS1 Hypothetical ORF
          Length = 301

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/105 (19%), Positives = 45/105 (42%), Gaps = 13/105 (12%)

Query: 40  GLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSYAQG 99
            + EY   F   + E+NPD   L +        + I+   Y  +  +++  D IN++++ 
Sbjct: 106 SIAEYLATF---IRERNPDLSALELDELYFKKSDFISTERYEKERNLDNFQDFINTFSKS 162

Query: 100 NKKITIMGHSV----------GAFIAQKVVTSGLLNDEVARVGLL 134
            + +     ++          G+  A K+ +   L +++ RV +L
Sbjct: 163 PRALVFSVSNIRVADTFRSLGGSKQAVKLFSKNKLKEDLERVNML 207

>ZYRO0D12738g Chr4 complement(1076930..1077631) [702 bp, 233 aa]
           {ON} similar to uniprot|Q04066 Saccharomyces cerevisiae
           YDR428C Hypothetical ORF
          Length = 233

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 54/114 (47%), Gaps = 16/114 (14%)

Query: 74  DIACPVYTLQEQIN-------HKVDVI-NSYA----QGNKKITIMGHSVGAFIAQKVVTS 121
           D  C +Y ++ +++       H  DVI N Y     Q   ++ ++GHSVGA +A +V T 
Sbjct: 49  DYQCGLYGIEYRLSPGVKHPTHLKDVIENLYRLVNDQDLDQLQLVGHSVGATLAWQVATC 108

Query: 122 GLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVS-ALDWIAFEK 174
            L   +  +V L+   +  I   +    +  + E +P +   VS A D + FE+
Sbjct: 109 EL---DDYKVRLVKSKLNAIWLVDGIYSILELLEEYPDYSSFVSKAFDDVPFEE 159

>Suva_7.68 Chr7 (126915..134933) [8019 bp, 2672 aa] {ON} YGL195W
            (REAL)
          Length = 2672

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 79/184 (42%), Gaps = 37/184 (20%)

Query: 42   IEYYVPFLQQVHEK--NPDWEILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSYAQG 99
            ++  +P+L  + E   N  + +LG+    M+  +D+  P+  +   +   +D   + A G
Sbjct: 1987 VDEVLPYLLHMLESSDNSGFALLGLQEI-MSKKSDVIFPIL-IPTLLAPPIDAFRASALG 2044

Query: 100  N----------KKITIMGHSVGAFIAQKVVTSG------LLNDEVARVGL---------- 133
            +          K+++I+   + A +   + TSG       L   + RV L          
Sbjct: 2045 SLAEVAGSALYKRLSII---INALVDAIITTSGDDSTKTALEGALDRVFLSVTDDEGLHP 2101

Query: 134  LTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISHFADDPK 193
            L   ++ + K++   K  AI ER P F    + LD   F+   PDF++  I+S   +DP+
Sbjct: 2102 LLQQIMSLLKNDNIEKRIAILERLPNFFD-KTTLD---FDIYIPDFVSHAILSLDDEDPR 2157

Query: 194  TCLG 197
               G
Sbjct: 2158 VVNG 2161

>NCAS0B05460 Chr2 (1024533..1032599) [8067 bp, 2688 aa] {ON} Anc_8.155
            YGL195W
          Length = 2688

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 126  DEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWII 185
            DE   V  L   ++ + KSE   K   I ER P F +  + LD   F+   PDF++  ++
Sbjct: 2112 DEEQGVHPLLQQIMSLLKSEDKAKRIVILERLPNFFE-NTVLD---FDLYIPDFVSFAVL 2167

Query: 186  SHFADDPK 193
            S    DP+
Sbjct: 2168 SLDDKDPR 2175

>AGL359C Chr7 complement(29052..30179) [1128 bp, 375 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YER187W
          Length = 375

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 246 WWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIE 286
           W LF++N   ++  +R  +I   E+H +P L +  +STA+E
Sbjct: 70  WQLFAENSQGLTKRSRWAMIA--EKHHAPLLAAASLSTAVE 108

>KNAG0J01630 Chr10 (299901..300767) [867 bp, 288 aa] {ON} Anc_8.662
          Length = 288

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 84  EQINHKVDVINSYAQGN-KKITIMGHSVGAFIAQKVVTSGLLNDEVARVGLLTPTVID 140
           E++   VD + S   G+ KKI IMGHS G   +Q V+   L   +  + G+L  +V D
Sbjct: 81  EEMKELVDYLRSEEGGSRKKIVIMGHSTG---SQDVIHYLLTYGDSVQGGILQASVSD 135

>TBLA0A02880 Chr1 complement(695847..697631) [1785 bp, 594 aa] {ON}
           Anc_5.310 YDR294C
          Length = 594

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 55/141 (39%), Gaps = 13/141 (9%)

Query: 21  GVSSLGSDACLFVFIPGNPGLIEYYVPFL-QQVHEKNPDWE--ILGISHAGMNSCNDIAC 77
           GV+S+  D   + F P     I Y  P L QQ +  +P W   + G      +    +  
Sbjct: 367 GVTSISCDTHKYGFAPKGSSTIMYRTPELRQQQYYVDPHWTGGLYGSPTLAGSRPGALMA 426

Query: 78  PVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVARVGLLTPT 137
             +     I       + Y + +  +  +   +  FI + +    ++ D +  V  L   
Sbjct: 427 GCWATMVNIGD-----DGYTKSSHDLVTIARRMKKFIQENIKQVQIIGDPLLTVVALRSN 481

Query: 138 VIDIHK-----SEKGLKLTAI 153
           VIDIH+     S+KG  L ++
Sbjct: 482 VIDIHEMADKMSKKGWHLCSL 502

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,980,514
Number of extensions: 1353714
Number of successful extensions: 3225
Number of sequences better than 10.0: 47
Number of HSP's gapped: 3264
Number of HSP's successfully gapped: 47
Length of query: 302
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 193
Effective length of database: 40,982,805
Effective search space: 7909681365
Effective search space used: 7909681365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)