Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14718g3.487ON30030016100.0
Kwal_55.212173.487ON3033029271e-125
SAKL0F02882g3.487ON2982996901e-89
Kpol_1017.93.487ON3103146061e-76
KLLA0E04687g3.487ON3063105991e-75
CAGL0I10582g3.487ON3193195694e-71
NCAS0E008403.487ON3363125681e-70
TDEL0D055503.487ON3103075617e-70
Suva_7.4153.487ON3133165609e-70
YGR127W3.487ON3123155601e-69
Smik_6.2233.487ON3133165522e-68
NDAI0G009703.487ON3323315523e-68
Skud_7.4383.487ON3133165494e-68
KNAG0B008403.487ON3133135443e-67
KAFR0C019303.487ON3133135425e-67
TPHA0D032603.487ON3143175234e-64
Ecym_12423.487ON3113145094e-62
AFR305W3.487ON3093075009e-61
TBLA0D029903.487ON3183044494e-53
ZYRO0D10098g3.487ON2762574447e-53
ZYRO0F12232g8.774ON42686740.71
Smik_16.3203.373ON37765721.5
NDAI0A049303.407ON113041694.0
Kwal_27.102988.834ON88233684.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14718g
         (300 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   624   0.0  
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   361   e-125
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   270   1e-89
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   238   1e-76
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   235   1e-75
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   223   4e-71
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   223   1e-70
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   220   7e-70
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   220   9e-70
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   220   1e-69
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   217   2e-68
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   217   3e-68
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   216   4e-68
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   214   3e-67
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   213   5e-67
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   206   4e-64
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   200   4e-62
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   197   9e-61
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   177   4e-53
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   175   7e-53
ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} simila...    33   0.71 
Smik_16.320 Chr16 complement(572880..574013) [1134 bp, 377 aa] {...    32   1.5  
NDAI0A04930 Chr1 (1120029..1123421) [3393 bp, 1130 aa] {ON} Anc_...    31   4.0  
Kwal_27.10298 s27 (277926..280574) [2649 bp, 882 aa] {ON} YMR275...    31   4.9  

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/300 (100%), Positives = 300/300 (100%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60
           MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60

Query: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPSTDWNSFEKFVSKYPQ 120
           GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPSTDWNSFEKFVSKYPQ
Sbjct: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPSTDWNSFEKFVSKYPQ 120

Query: 121 ITECEFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSSSRWPKVQKADIL 180
           ITECEFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSSSRWPKVQKADIL
Sbjct: 121 ITECEFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSSSRWPKVQKADIL 180

Query: 181 LQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSSIFIPPVEIPEKVDVGA 240
           LQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSSIFIPPVEIPEKVDVGA
Sbjct: 181 LQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSSIFIPPVEIPEKVDVGA 240

Query: 241 SLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKHPKEKLQFNLHVDES 300
           SLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKHPKEKLQFNLHVDES
Sbjct: 241 SLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKHPKEKLQFNLHVDES 300

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  361 bits (927), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/302 (55%), Positives = 229/302 (75%), Gaps = 9/302 (2%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60
           MCIL+AS AHP+YSLI ISNRDEF ER+T  TCLNHDDY++SPLD  L+ NN+P LGTWC
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60

Query: 61  GVNRKGRVAVILNLR----NKEPAKRIPVKSPISRGSVPMKYLMDRGPSTDWNSFEKFVS 116
           G NR GR+AVILNLR    N+   KRI     +SRG+V M+YL D+ P++DWNS+ KF S
Sbjct: 61  GANRNGRIAVILNLRTGNTNQTKTKRI-----VSRGNVTMRYLTDKQPASDWNSYAKFAS 115

Query: 117 KYPQITECEFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSSSRWPKVQK 176
           K P I  CEFNMFYGDC +G+YT IDS G+S E L +  P LV+SND I+S+++WPK++ 
Sbjct: 116 KCPDIKSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISNDSIESATKWPKIEL 175

Query: 177 ADILLQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSSIFIPPVEIPEKV 236
           A+ L+++LV+ S +DSE++L+ +CF+LAS+ +   +D+ DKE+ T S+IF+PP+E+P+  
Sbjct: 176 AEKLMRDLVRDSVNDSEDDLLARCFSLASHKQDYNVDHMDKEKVTSSNIFVPPLEVPKSE 235

Query: 237 DVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKHPKEKLQFNLH 296
           D+GAS+PCGRFYGTRSQIV+LV + +++I F E VL+DSD E       +PK+ + + ++
Sbjct: 236 DLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAANPKKCVSYKIN 295

Query: 297 VD 298
            D
Sbjct: 296 PD 297

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  270 bits (690), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 196/299 (65%), Gaps = 3/299 (1%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60
           MCIL+ + AHP+YSLI ISNRDEFFER+T  TC++ DD+I+SP D ++ +  +   GTWC
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGR-NFGTWC 59

Query: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPS-TDWNSFEKFVSKYP 119
           GVN+ G+VAVILNLR         V+ P SRG VPMK+L  +     +W+S+EKF   YP
Sbjct: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119

Query: 120 QITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSSSRWPKVQKAD 178
            I +   FN+FYGDC  GEY  I SL  +++    +   +V+SND I S  +W K+  A 
Sbjct: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSKKKWGKISLAK 179

Query: 179 ILLQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSSIFIPPVEIPEKVDV 238
            LL+ LV+SS  D+++ +++KCF LAS++  +E      E  T  +I++PP+ +    D+
Sbjct: 180 NLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHESVTNETIYVPPLLVENGQDL 239

Query: 239 GASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKHPKEKLQFNLHV 297
             S+PCG++YGTRSQIVILV + ++ ++F ERVL+  D +V  +  K+PKE+++F   +
Sbjct: 240 DVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKNPKEQIEFEFDI 298

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  238 bits (606), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/314 (42%), Positives = 190/314 (60%), Gaps = 21/314 (6%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDY--ILSPLDTALRSNNKPA--L 56
           MCIL+AS  HP Y LI ISNRDEF +R+T  TC N  +Y  IL P D + +SN K    +
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMS-KSNEKNVNKI 59

Query: 57  GTWCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPST--DWNSFEKF 114
           GTWCG+N  GRV+ ILNL+N +  +     +  SRG++P+K+L ++   +  +W+S+EKF
Sbjct: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119

Query: 115 VSKYPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHID-----SS 168
           V +YP + E  +FN FYGD   G+Y  IDS+G ++E LT + P LV+SND        S+
Sbjct: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSNGKST 179

Query: 169 SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTEPAE--IDNSDKEEFTCSSIF 226
             W K+  A  LL+ L      ++E++LI KCF +AS     E  I + D  E    +I 
Sbjct: 180 KEWEKITLAKNLLKHLPLC---ETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMTETIL 236

Query: 227 IPPVEI---PEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHS 283
           +PP+ +    EK  +GASLP G++YGTRSQIVILV ++   + F ER+L++SD +V    
Sbjct: 237 VPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVTTQK 296

Query: 284 EKHPKEKLQFNLHV 297
              P + L +N  +
Sbjct: 297 LSSPIQDLTYNFTI 310

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  235 bits (599), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 188/310 (60%), Gaps = 17/310 (5%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60
           MCIL A+ AHP Y LI +SNRDEFFERKT  TC NHD +ILSP D A+    +   GTW 
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQ-GYGTWL 59

Query: 61  GVNRKGRVAVILNLRNKEPAKRIPV---KSPISRGSVPMKYLM--DRGPSTDWNSFEKFV 115
           G+NR+GR+AVILNL+   P     V     P SRG VP+++L   D  P  +W+S+EKF 
Sbjct: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119

Query: 116 SKYPQITECE-FNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHI-----DSSS 169
            ++  +     F +FYGD  + EY  ID L +S+      + ++V+SND       + +S
Sbjct: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME-HMVISNDIFHCAVGEHTS 178

Query: 170 RWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSSIFIPP 229
           RW K +   +LL  L +++   ++EEL++KCF L SN    E    D +  T SSI++PP
Sbjct: 179 RWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNE--GEDVDSVTTSSIYVPP 236

Query: 230 VEIPEKVD-VGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKHPK 288
           + I +  D +G SLP G +YGTRSQIVILV +  R +++ E V+++SD +   +S   PK
Sbjct: 237 LRITKGADAIGTSLPIGDYYGTRSQIVILVDKDNR-VTYEEHVIYESDEDCETYSFMDPK 295

Query: 289 EKLQFNLHVD 298
           E +QF  +++
Sbjct: 296 EVIQFQFNME 305

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  223 bits (569), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 185/319 (57%), Gaps = 21/319 (6%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTAL--RSNNKPALGT 58
           MCIL A+  HP Y LI ISNRDEF ERKT +TC ++DD+ILSP D A      +    GT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 59  WCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDR-GPSTDWNSFEKFVSK 117
           W GVNRKGRVA +LNLR  +      +    SRG++P  +L DR G   DW+++ KF   
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120

Query: 118 YPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTA-NKPNLVLSND-----HIDSSS- 169
           YP I    +FN+FYGD   G Y  IDSLG +    +   K  LV+SN+     H+ S   
Sbjct: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180

Query: 170 -----RWPKVQKADILLQELVQSSQHDSEEELIEKCFALAS-----NTEPAEIDNSDKEE 219
                 W K++K   +++E V+++ +  +E++IE CF LAS     +    E D      
Sbjct: 181 NSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKSLG 240

Query: 220 FTCSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEV 279
            T  +I++ P+  P   ++G+ L  G++YGTRSQIV+LV + +   +F ER+++ SD ++
Sbjct: 241 VTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQDI 300

Query: 280 PLHSEKHPKEKLQFNLHVD 298
            L+S  +PKE+L++   ++
Sbjct: 301 SLYSTSNPKEELRYEYDIE 319

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  223 bits (568), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 182/312 (58%), Gaps = 20/312 (6%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTA--LRSNNKPALGT 58
           MCIL+A+ AHP+Y LI ISNRDEFFERKT  +C ++DD+ILSP D A     + K   GT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 59  WCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPSTD-WNSFEKFVSK 117
           W G+NR  ++A ILNL+ +       +  P SRG +P  +L +     + W+++EKF  K
Sbjct: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136

Query: 118 YPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSS-------- 168
           Y  + +  +FN FYGD +  EY  IDS G + + L+ + P L +SND   +         
Sbjct: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGD-PYLTVSNDMFATGGITVERAS 195

Query: 169 ----SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALAS--NTEPAEIDNSDKEE-FT 221
               + W K++   ILLQ+LV+ S+   E+ LIEKCF LAS  + +P E    ++     
Sbjct: 196 NNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNSTLP 255

Query: 222 CSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPL 281
             +IF+PP+E     D+G SL  G++YGTRSQIVIL+ ++   +   E +L+ SD ++  
Sbjct: 256 METIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDNDIQH 315

Query: 282 HSEKHPKEKLQF 293
           +S  +PKE   F
Sbjct: 316 YSSTNPKEVKSF 327

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  220 bits (561), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 116/307 (37%), Positives = 181/307 (58%), Gaps = 13/307 (4%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60
           MCIL+A+  HPKY L+ +SNRDE+F RK S      D+++L PLD  L S+ +  LGTW 
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGED-LGTWI 59

Query: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPS-TDWNSFEKFVSKYP 119
           G NR G++  +LNL+     +  P   P SRG +P+ +L  RG +  DW++++KF  ++ 
Sbjct: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119

Query: 120 QITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALT-ANKPNLVLSNDHIDSSSR----WPK 173
            +    +FN FYGDC  G+Y  IDSLG +++ L   N+  +V+SND     S     W K
Sbjct: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKNRVWDK 179

Query: 174 VQKADILLQELVQSSQHDSEEELIEKCFALAS-NTEPAEIDNSD----KEEFTCSSIFIP 228
           +  AD  L  LV+      E++ I++CF +AS N   ++ D+ +      E +  ++F+P
Sbjct: 180 ISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSMQTVFVP 239

Query: 229 PVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKHPK 288
           P++      +GAS+P G +YGTRSQ VILV +    I++ ER++HDSD +   +S  H K
Sbjct: 240 PLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQYSRDHYK 299

Query: 289 EKLQFNL 295
           E+ +++ 
Sbjct: 300 EQKRYDF 306

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  220 bits (560), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 182/316 (57%), Gaps = 22/316 (6%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60
           MCILMA+ AHP Y LI ISNRDEF ERKT  TC ++DD+ILSP D A  S  K   GTW 
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60

Query: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMD-RGPSTDWNSFEKFVSKYP 119
           G+N++G++A ILNL+  +  +R   KS  SRG +P  +L   +    DW+ + KF   Y 
Sbjct: 61  GINKEGKLATILNLKMDD--QRSCTKSK-SRGMLPFTFLTSHKARFQDWDDYNKFEKHYD 117

Query: 120 QI-TECEFNMFYGDCIAGEYTCIDSLGYSSEALTAN---KPN--LVLSNDHIDSSSR--- 170
            + T  +FN FYGD I   Y  IDSLG++ + L +     P+  +V+SN    +SS    
Sbjct: 118 GLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISE 177

Query: 171 --WPKVQKADILLQELVQSSQHDSEEELIEKCFALASNT-------EPAEIDNSDKEEFT 221
             W KV+ A   L+ L+  +    EE LI  CF LAS +       +P  +        T
Sbjct: 178 QAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVT 237

Query: 222 CSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPL 281
            ++I++PP+  P   D+GAS+P G +YGTRSQIV+LV +    ++F ERVL+ SD +V  
Sbjct: 238 MNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSH 297

Query: 282 HSEKHPKEKLQFNLHV 297
           +S   PKE+ +F   +
Sbjct: 298 YSASAPKEEKRFEFEL 313

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  220 bits (560), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 128/315 (40%), Positives = 185/315 (58%), Gaps = 21/315 (6%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60
           MCILMA+ AHP Y LI ISNRDEF  RKT  TC +++D+ILSP D A  S  K   GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60

Query: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYL-MDRGPSTDWNSFEKFVSKYP 119
           G+N++G++A ILNL+          +   SRG +P  +L + +    DW++++KF   Y 
Sbjct: 61  GINKEGKLATILNLKLDNEQNNTKSR---SRGLLPFIFLSIHKADFEDWDNYKKFEGHYD 117

Query: 120 QI-TECEFNMFYGDCIAGEYTCIDSLGYSSEALTAN-----KPNLVLSNDHI-DSSS--- 169
            + +  +FN FYGD I  +Y  IDSLG + + L++         +V+SN    DSSS   
Sbjct: 118 GLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPG 177

Query: 170 -RWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTE-PAEIDNSDKEEF-----TC 222
             W KV+ A   L+ LV  +    EE++I  CF LAS +  P+ I N D  +      T 
Sbjct: 178 QAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDPNVTM 237

Query: 223 SSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLH 282
           ++I++PP+  P + D+GAS+P G +YGTRSQIV+LV +    ++F ERVL+ SD +V  +
Sbjct: 238 NTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKY 297

Query: 283 SEKHPKEKLQFNLHV 297
           S   PKE+ +F   +
Sbjct: 298 SVTSPKEEKRFKFKL 312

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  217 bits (552), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 127/316 (40%), Positives = 183/316 (57%), Gaps = 22/316 (6%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60
           MCILMA+ AHP Y LI ISNRDEF  RKT  TC ++DD+ILSP D A  S      GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60

Query: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPS-TDWNSFEKFVSKYP 119
           G+N++G++A ILNL  K  ++R  +KS  SRG +P  +L +   +  DW+S+ KF + Y 
Sbjct: 61  GINKEGKLATILNL--KLGSERSTIKSK-SRGLLPYIFLSNHEANFKDWDSYSKFGNHYD 117

Query: 120 QITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTAN-----KPNLVLSNDHIDSSSR--- 170
            +    +FN FYGD I  +Y  IDSLG + + L++         +V+SN    ++S    
Sbjct: 118 GLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPE 177

Query: 171 --WPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTE-PAEIDNSDKEEF------T 221
             W KV+ A   L++LV  +    EE +I  CF LAS +  P  +   D  +       T
Sbjct: 178 KAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVT 237

Query: 222 CSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPL 281
            S+I++PP+  P   D+GAS+P G FYGTRSQIV+L+ +     +F ER+++ SD +V  
Sbjct: 238 MSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQ 297

Query: 282 HSEKHPKEKLQFNLHV 297
           +S   PKE+ +F   +
Sbjct: 298 YSVSAPKEEKRFEFEL 313

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  217 bits (552), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 181/331 (54%), Gaps = 33/331 (9%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTA--LRSNNKPALGT 58
           MCIL+A+ AHP Y LI ISNRDEF +RKT  +C ++DD+ILSP D A   + N+K   GT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 59  WCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPST--DWNSFEKFVS 116
           W G+N+ G++A +LNL+  +      + +P SRG +P  YL D    +  +W+ ++ F  
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120

Query: 117 KYPQI-TECEFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSSSR----- 170
           KYP + +  +FN+FYGD    +Y  +DS+G +   L +N   LV+SND    + +     
Sbjct: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGELQ 180

Query: 171 ------------------WPKVQKADILLQELVQSS--QHDSEEELIEKCFALASNTEPA 210
                             W KV+    LLQ LV  S  +   E+ +I +CF L+S     
Sbjct: 181 SNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCSVT 240

Query: 211 EIDNSDKEEFTC---SSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISF 267
             D+    + +     +I +PP+      DVG SLP G +YGTRSQIVIL+KR    + F
Sbjct: 241 VEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEVKF 300

Query: 268 TERVLHDSDFEVPLHSEKHPKEKLQFNLHVD 298
            E V++ SD ++   S  +PKE ++F+  ++
Sbjct: 301 AEHVIYTSDSDIKTFSPANPKETVRFDFTLN 331

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  216 bits (549), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 128/316 (40%), Positives = 181/316 (57%), Gaps = 22/316 (6%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60
           MCILMA+ AHP Y LI ISNRDEF  RKT  TC ++DD+ILSP D A  S  K   GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60

Query: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYL-MDRGPSTDWNSFEKFVSKYP 119
           G+NR+G++A ILNL  K   +R  +KS  SRG +P  +L   +    +W++++KF   Y 
Sbjct: 61  GINREGKLATILNL--KLDGQRDTIKSK-SRGLLPFTFLSTHKADFQNWDNYDKFEMNYD 117

Query: 120 QI-TECEFNMFYGDCIAGEYTCIDSLGYSSEALTAN-KPNL----VLSNDHIDSS----- 168
            + T  +FN FYGD I  +Y  IDSLG +   L +  K NL     +SN    +S     
Sbjct: 118 GLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISE 177

Query: 169 SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALASN-------TEPAEIDNSDKEEFT 221
             W KV+ A   L++LV  +    EE +I  CF LAS        ++P  +         
Sbjct: 178 QAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVI 237

Query: 222 CSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPL 281
            ++I++PP+  P   D+GAS+P G +YGTRSQIV+LV ++   ++F ER+L+ SD +V  
Sbjct: 238 MNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNH 297

Query: 282 HSEKHPKEKLQFNLHV 297
           +S   PKE+ +F   +
Sbjct: 298 YSVATPKEEKRFEFKL 313

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  214 bits (544), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/313 (39%), Positives = 176/313 (56%), Gaps = 14/313 (4%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDT--ALRSNNKPALGT 58
           MCIL+ +  HP Y L+ ISNRDEFFER T  T  +  DYILSP D    L    K   GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 59  WCGVNRKGRVAVILNLRNKEPAKRIPVKSPI---SRGSVPMKYLMDRGPSTDWNSFEKFV 115
           W G+NR GRV+ +LNL+ +  A R   K+P+   SRG +P  +L DRG    W+SFEKF 
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGFIDQWDSFEKFR 120

Query: 116 SKYPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALT-ANKPNLVLSNDHI-----DSS 168
            +YP + +  +FN+F GD    +Y  +DS G +   L      N+V+SND       +  
Sbjct: 121 DRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFNENDI 180

Query: 169 SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALAS--NTEPAEIDNSDKEEFTCSSIF 226
           S W KV+   + L ELV ++ +  +   I+KCF  AS  + E +  D S   E   ++IF
Sbjct: 181 SEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKTPEVISNTIF 240

Query: 227 IPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKH 286
           +PP++   + DVG +   G ++GTRSQ+V LV +  R ++  ER+LH SD +   +S  +
Sbjct: 241 VPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRDFNSPHN 300

Query: 287 PKEKLQFNLHVDE 299
           PKE  QF   + +
Sbjct: 301 PKEVKQFTFDLSD 313

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  213 bits (542), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 117/313 (37%), Positives = 182/313 (58%), Gaps = 19/313 (6%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNN-KPALGTW 59
           MCIL A+ +H +Y LI ISNRDE+  RKT  TC ++D++ILSP D +   N+     GTW
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60

Query: 60  CGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPSTD----WNSFEKFV 115
            G+N+KG++A ILNLR         +  P SRG +P  +L     + D    W +FEKF 
Sbjct: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120

Query: 116 SKYPQI-TECEFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSND---HID---SS 168
           SKYP + +  +FN FYGD   G Y  IDSLG + + L  N  N+++SND   H D     
Sbjct: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDEYEGK 180

Query: 169 SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALAS----NTEPAEIDNSDKEEFTCSS 224
             W K++     L + ++ ++  +E+E++ KCF LAS    ++     +N +KE     +
Sbjct: 181 PTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKE-LAAET 239

Query: 225 IFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSE 284
           I++PP+++    D+G +   G++YGTR+QIV+LV +  + ++  E  +H+SD E+  +S 
Sbjct: 240 IYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIYKYSG 299

Query: 285 KHPKE--KLQFNL 295
            +PKE  +L F +
Sbjct: 300 LNPKEVQRLDFTI 312

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  206 bits (523), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 120/317 (37%), Positives = 178/317 (56%), Gaps = 24/317 (7%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDY--ILSPLDTALRSNNKPALGT 58
           MCIL  + +HP Y LI ISNRDEF +RKT+ +C N      +L P D +    +    GT
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60

Query: 59  WCGVNRKGRVAVILNLR---NKEPAKRIPVKSPISRGSVPMKYLMDRGPST--DWNSFEK 113
           WCG+N  GRV+ +LNL+   NK   K +  KS   RG +P+K+L +R  ++  DWNS+ K
Sbjct: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKS---RGYLPVKFLDNRKENSFNDWNSYSK 117

Query: 114 FVSKYPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTA----NKPNLVLSNDHIDSS 168
           F+ +YP + +   FN+F GD    EY  IDS G +   L       K ++V+SN    S+
Sbjct: 118 FLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISN 177

Query: 169 S--RWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTEPAEI---DNSDKEEFTCS 223
              RW K+   + L+ E +     D E  +IE CF +AS +E        + D  +    
Sbjct: 178 DKERWHKISNGEKLMDEFLSKDIRD-ENSVIESCFKIASTSELTNEYLHSHDDILDLMTE 236

Query: 224 SIFIPPVEIP---EKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVP 280
           ++F+PP+++    EK ++GASLP G+FYGTRSQIVILV +   T+ + ERVL++ D +V 
Sbjct: 237 TVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVS 296

Query: 281 LHSEKHPKEKLQFNLHV 297
               + P  +L F  ++
Sbjct: 297 KAGIEKPINELNFEYNI 313

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  200 bits (509), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 115/314 (36%), Positives = 174/314 (55%), Gaps = 21/314 (6%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPA----- 55
           MCIL+A+  HP Y LI ISNRDEF+ER+T  TC + D  IL+P D +   N   A     
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 56  -LGTWCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMD--RGPSTDWNSFE 112
             GTW G+NR G V+V+LNL+    A      +  SRG+V + +L D   G    WN++E
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120

Query: 113 KFVSKYPQITECE-FNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHI---DSS 168
           KF   +  + + + F +FYGD   G++  IDS   S    ++ +P +V+SN  +   D  
Sbjct: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCEDEG 180

Query: 169 SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSS---- 224
            RW KV + + LL+ELV+ + + S+E L++KCF LA     ++ D +   + T +S    
Sbjct: 181 PRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAG---TSQFDVNGVIQVTDTSLPEK 237

Query: 225 -IFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHS 283
            IF+P ++      +G S   G +YGTR+ IVILV      ++  E V+HDSD ++ L S
Sbjct: 238 TIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVDNFNH-VTMHEHVIHDSDKDIGLSS 296

Query: 284 EKHPKEKLQFNLHV 297
             +PK K+ +   +
Sbjct: 297 AMNPKTKVAYEFDI 310

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  197 bits (500), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 114/307 (37%), Positives = 179/307 (58%), Gaps = 23/307 (7%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRS----NNKPAL 56
           MCIL A+ AHPKY L+ ISNRDE+F RKT  TC +H+D IL+P D AL+     ++    
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 57  GTWCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYL--MDRGPSTDWNSFEKF 114
           GTW G+NR G V+V+LNL  K+           SRG+V M+YL   D      WN++EKF
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120

Query: 115 VSKYPQITECE-FNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSS---SR 170
            + +P + + + F  FYGD +  +++ I+SLG + +  +   P  V+SN   D +    +
Sbjct: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFS-QSPYYVVSNGPSDGAKALGQ 179

Query: 171 WPKVQKADILLQELVQSSQHDSEEELIEKCFALAS-----NTEPAEIDNSDKEEFTCSSI 225
           WPKV + + L ++++Q S   SEEEL+++CF LAS     + +P  + +   +     +I
Sbjct: 180 WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHD---DSIPKRTI 236

Query: 226 FIPPV-EIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSE 284
           F+P +  +  + ++  S   G +YGTRS IV+LV      ++  E V+HDSD ++  +S 
Sbjct: 237 FVPALYNLSGQANL--SFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQDLDSYSI 293

Query: 285 KHPKEKL 291
            +PKE++
Sbjct: 294 LNPKEQV 300

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  177 bits (449), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 112/304 (36%), Positives = 163/304 (53%), Gaps = 31/304 (10%)

Query: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTAL--------RSNN 52
           MCIL+ + AHP Y LI ISNRDE FER+T +TC NH+  IL P D +             
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 53  KPALGTWCGVNRKGRVAVILNLRNKEPAKRIP--VKSPISRGSVPMKYLMDRGPS-TDWN 109
           K   GTWCG+N+ G++  +LNL  +E A+R      S  SRG +P+KYL D      DWN
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDWN 120

Query: 110 SFEKFVSKYPQITE--CEFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDS 167
           +++KF+ +   I      FN+F GD  + EY+ I+S+G S   L    P +V+SN +   
Sbjct: 121 TYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNINWGD 180

Query: 168 SSR---WPKVQKADILLQELVQSSQHDS---EEELIEKCFALAS--NTEPAEID-NSDKE 218
             +   W K++    LL+ L+     +S   E E++E CF ++S  N    +ID N ++ 
Sbjct: 181 PKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGNIERL 240

Query: 219 EFTCSSIFIPPVEIPE---------KVDVGASLPCGRFYGTRSQIVILVKRHERTISFTE 269
           E T   IF+PP++  E              A     ++YGTRSQIV+L +R    ++F E
Sbjct: 241 EQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKSNKVTFVE 300

Query: 270 RVLH 273
           R+LH
Sbjct: 301 RILH 304

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  175 bits (444), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 150/257 (58%), Gaps = 17/257 (6%)

Query: 56  LGTWCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPSTD-WNSFEKF 114
            GTWCG+N+ GRV  +LNL+  + A+R       SRG VP  +L       + WNS+ KF
Sbjct: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82

Query: 115 VSKYPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTANKPN-----LVLSND--HID 166
            +++ ++    +FN FYGDC  G+Y  IDSL  + + LT N+       +V+SND     
Sbjct: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRYQ 142

Query: 167 SSSRWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKE-----EFT 221
               WPKVQ A   L++L++ + ++ ++  I KCF +AS T P  +D   +E     + T
Sbjct: 143 GEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVAS-TSPG-LDWQSEELLKSSDVT 200

Query: 222 CSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPL 281
             SIF+PP++ P  +++G +   G FYGTRSQIV+LV +  + ++F ERVLH+SD +V  
Sbjct: 201 KQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSDEQVSQ 259

Query: 282 HSEKHPKEKLQFNLHVD 298
            S  HP E+L+F   ++
Sbjct: 260 RSPDHPAEQLKFQFDLN 276

>ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 426

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 5/86 (5%)

Query: 87  SPISRGSVPMKY---LMDRGPSTDWNSFEKFVSKYPQITECEFNMFYGDCIAGEYTCIDS 143
           +PI    +P  Y   L    P  D  SF  F+S++P     +F  F+ D +A    C D 
Sbjct: 6   TPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPY--AIDFLDFWIDLMAHVRLCRDY 63

Query: 144 LGYSSEALTANKPNLVLSNDHIDSSS 169
           +    E++ A    L+  + H D S+
Sbjct: 64  VRGVKESIEARNSELIADDAHSDESN 89

>Smik_16.320 Chr16 complement(572880..574013) [1134 bp, 377 aa] {ON}
           YPR075C (REAL)
          Length = 377

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 175 QKADILLQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSSIFIPPVEIPE 234
           +++D  +Q+LV + Q    +++ +    +A N E  + +N D EE      FI  +EIPE
Sbjct: 296 EESDKEIQDLVVTEQQTEADDVADNLLHIAENNESQDQNNDDDEE---EGSFILDLEIPE 352

Query: 235 KVDVG 239
            +  G
Sbjct: 353 SIREG 357

>NDAI0A04930 Chr1 (1120029..1123421) [3393 bp, 1130 aa] {ON}
           Anc_3.407 YPR095C
          Length = 1130

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 10  HPKYSLIAISNRDEFFERKTSNTCL-NHDDYILSPLDTALR 49
           + K+  + ++ +D+ F+RKT N  L NH D+   P+D ALR
Sbjct: 463 YGKFIGVILTKKDDEFQRKTLNYFLTNHFDFENDPIDVALR 503

>Kwal_27.10298 s27 (277926..280574) [2649 bp, 882 aa] {ON} YMR275C
           (BUL1) - Rsp5p ubiquitin ligase binding protein [contig
           37] FULL
          Length = 882

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 181 LQELVQSSQHDSEEELIEKCFALASNTEPAEID 213
           LQE +Q   HDS+   I+K ++L   T P EID
Sbjct: 169 LQEPIQDDVHDSDNIYIDKLYSLPKLTTPIEID 201

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,021,871
Number of extensions: 1506698
Number of successful extensions: 4152
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4182
Number of HSP's successfully gapped: 31
Length of query: 300
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 191
Effective length of database: 40,982,805
Effective search space: 7827715755
Effective search space used: 7827715755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)