Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14696g3.486ON21921910401e-145
Kwal_55.212153.486ON1421425333e-69
SAKL0F02904g3.486ON2222033745e-44
YGR126W3.486ON2301573545e-41
Skud_7.4373.486ON2301643521e-40
Suva_7.4143.486ON2301553398e-39
Smik_6.2223.486ON2301553353e-38
CAGL0I10604g3.486ON2111603204e-36
NCAS0E008503.486ON2301673076e-34
TDEL0D055403.486ON2161653022e-33
KAFR0C019203.486ON2231573006e-33
NDAI0G009803.486ON2341632981e-32
KNAG0B008503.486ON2251632762e-29
KLLA0E04709g3.486ON1661442679e-29
TPHA0D032503.486ON2191661906e-17
Kpol_1017.103.486ON2342091548e-12
CAGL0I10384g3.503ON630941571e-11
TPHA0D033103.503ON613581501e-10
Skud_16.4503.503ON6221101472e-10
KAFR0C020303.503ON624641464e-10
NDAI0I027703.503ON626851421e-09
YPR156C (TPO3)3.503ON622791411e-09
NCAS0E007503.503ON620641411e-09
Smik_16.4083.503ON6221001402e-09
Suva_16.4843.503ON622791374e-09
KNAG0B007303.503ON622831375e-09
SAKL0F02442g3.503ON610631341e-08
TDEL0D057103.503ON616941341e-08
AFR322C3.503ON592571331e-08
KLLA0E03829g3.503ON609641313e-08
NCAS0F036203.503ON634581261e-07
Kwal_47.189193.503ON640861252e-07
TBLA0D029003.503ON6911391252e-07
YGR138C (TPO2)3.503ON614641224e-07
Skud_7.4483.503ON611641224e-07
Suva_7.4253.503ON613641225e-07
KLTH0G02266g3.503ON644791208e-07
Smik_6.2333.503ON614641181e-06
Kpol_1017.33.503ON621581172e-06
ZYRO0G19646g3.503ON59484994e-04
KLLA0E22683g1.457ON136387810.072
NCAS0F026505.311ON69370674.0
Skud_7.3853.425ON935144666.1
TDEL0C052403.386ON49753647.8
KLTH0C06864g7.384ON63635648.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14696g
         (219 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...   405   e-145
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...   209   3e-69
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...   148   5e-44
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   140   5e-41
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   140   1e-40
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   135   8e-39
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   133   3e-38
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   127   4e-36
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   122   6e-34
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   120   2e-33
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...   120   6e-33
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   119   1e-32
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...   110   2e-29
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...   107   9e-29
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...    78   6e-17
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    64   8e-12
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    65   1e-11
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    62   1e-10
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    61   2e-10
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    61   4e-10
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     59   1e-09
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    59   1e-09
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               59   1e-09
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    59   2e-09
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    57   4e-09
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    57   5e-09
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    56   1e-08
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    56   1e-08
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    56   1e-08
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    55   3e-08
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    53   1e-07
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    53   2e-07
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    53   2e-07
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    52   4e-07
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    52   4e-07
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    52   5e-07
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    51   8e-07
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    50   1e-06
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    50   2e-06
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    43   4e-04
KLLA0E22683g Chr5 (2023109..2027200) [4092 bp, 1363 aa] {ON} wea...    36   0.072
NCAS0F02650 Chr6 (536503..538584) [2082 bp, 693 aa] {ON} Anc_5.3...    30   4.0  
Skud_7.385 Chr7 (642159..644966) [2808 bp, 935 aa] {ON} YGR089W ...    30   6.1  
TDEL0C05240 Chr3 complement(933679..935172) [1494 bp, 497 aa] {O...    29   7.8  
KLTH0C06864g Chr3 (596687..598597) [1911 bp, 636 aa] {ON} weakly...    29   8.5  

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score =  405 bits (1040), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 200/219 (91%)

Query: 1   MCSNRNXXXXXXXXXXXXXXXXXXXFEPRAFEGPPSEIKSLEPEGSVQASPSIDSKDFHR 60
           MCSNRN                   FEPRAFEGPPSEIKSLEPEGSVQASPSIDSKDFHR
Sbjct: 1   MCSNRNDGDEASSELELSSLSSSDSFEPRAFEGPPSEIKSLEPEGSVQASPSIDSKDFHR 60

Query: 61  VKSNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCA 120
           VKSNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCA
Sbjct: 61  VKSNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCA 120

Query: 121 FPEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTIN 180
           FPEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTIN
Sbjct: 121 FPEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTIN 180

Query: 181 GLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219
           GLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD
Sbjct: 181 GLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score =  209 bits (533), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 102/142 (71%), Positives = 122/142 (85%), Gaps = 1/142 (0%)

Query: 79  MTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQT 138
           MTHNATEGRSETV+SL++NGLN+ +KA+PD NNPAAN+ NC FPEEYQ+ETDTGLVK QT
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNNPAANFTNCEFPEEYQLETDTGLVKVQT 60

Query: 139 LHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTIN-GLDGEKLRRAVEKNQKK 197
           L  LNRLESRTS RSG SQ+KS+R+  ST +S   SA  + N GLD EKLR+AVEKN+++
Sbjct: 61  LQKLNRLESRTSIRSGNSQRKSMRSTPSTDHSISPSAGRSSNSGLDAEKLRKAVEKNKRQ 120

Query: 198 IDKYQKHKSSGGLRRFLGKIFD 219
           IDKYQKHK+SGGL++FLGKIFD
Sbjct: 121 IDKYQKHKASGGLKKFLGKIFD 142

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score =  148 bits (374), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 129/203 (63%), Gaps = 17/203 (8%)

Query: 26  FEPRAFEG--PPSEIKSLEPEGSVQASPSI--------DSKDFHRVKSNGTLRKQDSNAI 75
           FEP+AF G  P  E  +++ E   +  P          +S++   V+S+ TL+K DSNAI
Sbjct: 26  FEPQAFTGADPSVEQPTIDHELEDEIDPEPLSGNPVRPNSEEILSVRSSNTLKKLDSNAI 85

Query: 76  EQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVK 135
           E+++THNA EG +ET+ESLK  GL+L+KKAIPD NNPA +     FPEEYQ+ET+TGLVK
Sbjct: 86  EKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVK 145

Query: 136 AQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTINGLDGEKLRRAVEKNQ 195
            +TL  LNRL++R S  +  S        N    ++ A       G D EKL++AV+KN+
Sbjct: 146 VKTLQSLNRLDTRVSLGNKPS-------TNQNMEAESAHDEQRPVGYDEEKLKKAVDKNK 198

Query: 196 KKIDKYQKHKSSGGLRRFLGKIF 218
           KKI+KYQKHK   G++ F+ ++F
Sbjct: 199 KKIEKYQKHKHEKGIKGFMSRLF 221

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  140 bits (354), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 111/157 (70%), Gaps = 8/157 (5%)

Query: 66  TLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAAN-YKNCAFPEE 124
           TL++  SN+IE+++THNA EG SETV+SLK++GLNL KKA+PDI  P  N   + AFPEE
Sbjct: 79  TLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEE 138

Query: 125 YQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSI--RTANSTTNSDLASANNTINGL 182
           Y++ET+TGLVK +TL  L R +SR S    +++K+ I   T   +T S + + N+  + L
Sbjct: 139 YRLETETGLVKLKTLESLKREDSRVS----STKKEHINDHTDMHSTRSKV-TTNSQGSSL 193

Query: 183 DGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219
           +  KL  AVEKN+K+I+KYQKHKS  G++ F  +IFD
Sbjct: 194 EPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  140 bits (352), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 110/164 (67%), Gaps = 4/164 (2%)

Query: 57  DFHRVKSNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAAN- 115
           D +   S+ TL++  SN+IE+++THNA EG SET +SLK+ GLNL KKA+PDI  P  N 
Sbjct: 70  DVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNS 129

Query: 116 YKNCAFPEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASA 175
             N AFPEEY++ET+TGLVK +TL  L R +SR    S A ++ +   A++ +     + 
Sbjct: 130 AHNGAFPEEYRLETETGLVKLKTLETLKREDSRV---SSAKKEHTNDHADAHSTRSKVTT 186

Query: 176 NNTINGLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219
            +  + L+ +KL  AVEKN+KKI++Y+KHKS  G++ F  +IFD
Sbjct: 187 YSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  135 bits (339), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 74/155 (47%), Positives = 103/155 (66%), Gaps = 4/155 (2%)

Query: 66  TLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAAN-YKNCAFPEE 124
           TL++  SN+IE+++THNA EG SETV+SLKK GLNL KK  PDI  P  N   + AFPEE
Sbjct: 79  TLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTPDITAPVTNSAHDAAFPEE 138

Query: 125 YQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTINGLDG 184
           Y++ET+TGLVK +TL  L R +SR    SGA +       ++ +    A+A +  + L+ 
Sbjct: 139 YRLETETGLVKLKTLETLKREDSRV---SGAKKDHGHDHTDAHSTRSKATAYSQGSSLES 195

Query: 185 EKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219
           +KL  AVEKN+K+I+KYQKHK   G++    ++FD
Sbjct: 196 DKLNIAVEKNKKRIEKYQKHKGEKGIKGLFHRMFD 230

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  133 bits (335), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 107/155 (69%), Gaps = 4/155 (2%)

Query: 66  TLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAAN-YKNCAFPEE 124
           TL++  SN+IE+++T NA EG SET++SLK++GLNL+KKA+PDI  P  N   +  FPEE
Sbjct: 79  TLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEE 138

Query: 125 YQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTINGLDG 184
           Y++ET+TGLVK +TL  L R +SR S  S   +  +  T   +T S + + N+  + L+ 
Sbjct: 139 YRLETETGLVKLKTLETLRREDSRVS--STKKEHNNDHTDIHSTRSKV-TTNSQGSSLEP 195

Query: 185 EKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219
            KL  AVEKN+KKI++YQKHKS  G++ F  +IFD
Sbjct: 196 NKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  127 bits (320), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 98/160 (61%), Gaps = 14/160 (8%)

Query: 63  SNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFP 122
           S  TL+K DS AIE+++T NA  G SET+ESLK  GL++Q+KAIPD N P        FP
Sbjct: 63  SGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFP 122

Query: 123 EEYQMETDTGLVKAQTLHGLNRLE---SRTSGRSGASQKKSIRTANSTTNSDLASANNTI 179
           EEY++ETDTGLVK +TL  L R     SR S  S   +  S   +N +  SD+A      
Sbjct: 123 EEYRLETDTGLVKMKTLETLKRKSTQVSRNSDLSSKDKSISKSQSNKSEVSDIA------ 176

Query: 180 NGLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219
                +K+  AVE+N+K+I KYQKHKS  G++ F  ++FD
Sbjct: 177 -----QKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  122 bits (307), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 100/167 (59%), Gaps = 25/167 (14%)

Query: 63  SNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNP-AANYKNCAF 121
           S  TLR+ DSNAIE+++T NA EG +ET+ SL   GL+L KKA  DIN P  +N  + AF
Sbjct: 79  SMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADVAF 138

Query: 122 PEEYQMETDTGLVKAQTLHGLNRLESRTS----GRSGASQK-----KSIRTANSTTNSDL 172
           PEEY +ET+TGLVKA+T+  L R  SR S    G    S K     KS R+A S      
Sbjct: 139 PEEYNLETETGLVKAKTIETLRRETSRVSSTRRGDDVVSHKSQATGKSQRSAQS------ 192

Query: 173 ASANNTINGLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219
                    L  EKL  AVEKN+K+++K +KHK   GL+ F+ ++FD
Sbjct: 193 ---------LQAEKLNLAVEKNKKELEKIEKHKHQKGLKGFMNRLFD 230

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  120 bits (302), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 100/165 (60%), Gaps = 17/165 (10%)

Query: 66  TLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNP-AANYKNCAFPEE 124
           TL  QDSN IE+ +THNA  G SET +SL++ GL+ +KKAIPDIN P   N     FPEE
Sbjct: 58  TLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEE 117

Query: 125 YQMETDTGLVKAQTLHGLNRLESRTS-GRSGASQKKS---------IRTANSTTNSDLAS 174
           Y++ET TGLVK +TL+ L+R ++R S G  G   +KS         I     T  ++  +
Sbjct: 118 YRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDTAKAEQEA 177

Query: 175 ANNTINGLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219
           A N       E L  A+EKN+ +I+K++KH+   GL+ F+ ++FD
Sbjct: 178 AQN------AENLEHAIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score =  120 bits (300), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 99/157 (63%), Gaps = 17/157 (10%)

Query: 63  SNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFP 122
           S+  L+KQ S  IE+I+T NA  G++ETV+SL+  GL+L K+A+PDIN+P ++       
Sbjct: 84  SSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPISH--ESKLI 141

Query: 123 EEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTINGL 182
           +E + ETDTGL+K +TL  LNR  +R S     S K+ I          L + N+  +GL
Sbjct: 142 DESKFETDTGLIKTKTLETLNRSNTRNS-----SSKRKI----------LGNDNSNTSGL 186

Query: 183 DGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219
           D E++   VE+N+KK++KYQ+HK   GL+ F  KIFD
Sbjct: 187 DPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  119 bits (298), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/163 (46%), Positives = 101/163 (61%), Gaps = 14/163 (8%)

Query: 63  SNGTLRKQDSNA--IEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCA 120
           S  TL+K DSN   IE+ MT N    ++ET++SL K GLN +KK++ DIN P  N     
Sbjct: 80  STATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPL-NAGTAE 138

Query: 121 FPEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQK----KSIRTANSTTNSDLASAN 176
           FPEEY++ET+TGLVKA+T+  L R ES  S  S  SQ     KS RT N+T  S  +S+ 
Sbjct: 139 FPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSFKSART-NNTRKSRASSS- 196

Query: 177 NTINGLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219
                LD  KL  AVEKN+K+++KY KHK   G++ F  ++FD
Sbjct: 197 -----LDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score =  110 bits (276), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 102/163 (62%), Gaps = 5/163 (3%)

Query: 57  DFHRVKSNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKA-IPDINNPAAN 115
           D +   S+ TL K+DSNAIE+++T NA   +SE+ ++L+  GL+  K+  IPDIN P   
Sbjct: 66  DLNSKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLT- 124

Query: 116 YKNCAFPEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASA 175
                FPEEYQ+ET+TGLVK +T+  L    S  +  S  S+  S R+ NS T+S     
Sbjct: 125 LTQSHFPEEYQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSS---ME 181

Query: 176 NNTINGLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIF 218
            +   GL+ EKL  AVE+N+K++++Y+K++   G++ FL K+F
Sbjct: 182 EHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score =  107 bits (267), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 88/144 (61%), Gaps = 20/144 (13%)

Query: 75  IEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLV 134
           +E  +  N  +G +++++SLK   L+L KKAIP  N P A  +   FPEEY++ET TGLV
Sbjct: 42  VEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPIA--EGAEFPEEYEIETRTGLV 99

Query: 135 KAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTINGLDGEKLRRAVEKN 194
           K  TLH LNRL++R +  S    KKS +  N++             G D +KL++ +E+N
Sbjct: 100 KVATLHQLNRLDTRVTTHSS---KKSTKEKNTSC------------GYDNDKLQKCIERN 144

Query: 195 QKKIDKYQKHKSSGGLRRFLGKIF 218
           QK+ID Y  HK S G ++F+GK+F
Sbjct: 145 QKEIDSY--HKKS-GFKKFIGKLF 165

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score = 77.8 bits (190), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 91/166 (54%), Gaps = 25/166 (15%)

Query: 64  NGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPE 123
           N T++   SN + +I++ N  +   E+ E+LK    N++ +   DI  PA+   N  FPE
Sbjct: 67  NNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADIILPASMEGNSNFPE 125

Query: 124 EYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTAN---STTNSDL--ASANNT 178
           EY MET TGLV  +TL  + +             KK+I + N   S  +S+L  + +NNT
Sbjct: 126 EYTMETTTGLVPVKTLEDIKK-------------KKTIDSENSRKSLVSSELKASKSNNT 172

Query: 179 IN-----GLDGEKLRRAVEKNQKKIDKYQKHKSSGG-LRRFLGKIF 218
           +      GL+  KL  AVEKN+++++KYQ HK+    +++ L K+F
Sbjct: 173 VKSRNEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 63.9 bits (154), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 109/209 (52%), Gaps = 33/209 (15%)

Query: 35  PSEIKSLEPEGSVQASPSIDSKDFHRVKS----NGTLRKQDSNAIEQIMTHNATEGRSET 90
           P E K     G++ ++   D+  F++ KS      TL+   SN IE+I+T NA E  +ET
Sbjct: 32  PQEFK-----GNLDSNNDNDTGVFNKTKSGTSETNTLKVNSSNEIEKIVTRNALENNTET 86

Query: 91  VESLKKNGLNLQKKAIPDINN-PAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLESRT 149
           V +L++    L K  +P  N  PA    N AFPEEY++ET TGLV  +TL  ++   +++
Sbjct: 87  VATLRETESKLSK--VPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEMHS--NKS 142

Query: 150 SGRSGASQKKSIRTANSTT------------NSDLAS-----ANNTING-LDGEKLRRAV 191
           +G++  ++  + +  +               + D+       A +  +G L+ + +   V
Sbjct: 143 NGKNEENEHHNHQHNHHNHHNHHHHHEKNDEDKDVEQKEKHPAEHLPHGKLEQKNIDIVV 202

Query: 192 EKNQKKIDKYQKHKSS-GGLRRFLGKIFD 219
           E+N+K+++K+++HK     +++F+ K  D
Sbjct: 203 ERNKKQLEKWEEHKHEINPVKKFIYKFLD 231

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (58%), Gaps = 5/94 (5%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           R+ETV+SL++ G+  Q   IPD+N P    KN  FPEEY MET TGLV   TL  L    
Sbjct: 50  RTETVKSLQEMGMT-QDAPIPDVNAPQTTTKNAIFPEEYTMETPTGLVPVATLQSLG--- 105

Query: 147 SRTSGRSGASQKKSIRTANSTTNSDLASANNTIN 180
            RTS     S+ + I  + S  + ++A+++N+ N
Sbjct: 106 -RTSTAISKSRTRQIERSVSRRSQNIAASSNSSN 138

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNR 144
           R+ETV+SL+  GL      IPD+N P +N K+  FPEEY MET TGLV   TLH L R
Sbjct: 44  RTETVKSLQDMGLT-SDAPIPDVNAPTSN-KHSIFPEEYTMETPTGLVPVATLHSLGR 99

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 59/110 (53%), Gaps = 13/110 (11%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           R+ETV+SL+  G++  K  IPD+N P ++ KN  FPEEY +ET TGLV   TLH + R  
Sbjct: 49  RTETVKSLQDMGVS-SKAPIPDVNAPQSS-KNKIFPEEYTLETPTGLVPVATLHSIGRTS 106

Query: 147 -----SRTSGRSGASQKKSIRTANSTTN------SDLASANNTINGLDGE 185
                +RT    GAS   S   A  + N       D + AN+   GLD E
Sbjct: 107 TAISRTRTRQIDGASTPSSNEDALESDNNEKGKEGDSSGANDEAPGLDPE 156

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 2/64 (3%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           R+ETV+SL+  G+N    A+PD+N P +N +N  FPEEY +ET TGLV   TL  L R  
Sbjct: 51  RTETVKSLQDMGMN-ATPAVPDVNAPQSN-RNAIFPEEYTIETTTGLVPVATLQSLGRTS 108

Query: 147 SRTS 150
           +  S
Sbjct: 109 TAIS 112

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           R+ETV++L+  G+  +   +PD+N P  + +N  FPEEY MET TGLV   TL  L R  
Sbjct: 51  RTETVKTLQDLGVT-RDAPVPDVNAPQTSARNTIFPEEYTMETTTGLVPVSTLQSLGRTA 109

Query: 147 -SRTSGRSGASQKKSIRTANSTTNS 170
            S T  R+   +++S    ++T+NS
Sbjct: 110 TSITRTRTRQIERRSTSGFSTTSNS 134

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 48/79 (60%), Gaps = 7/79 (8%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           R+ETV+SL+  G++  K  +PD+N P ++ KN  FPEEY +ET TGLV   TLH + R  
Sbjct: 49  RTETVKSLQDMGVS-SKAPVPDVNAPQSS-KNKIFPEEYTLETPTGLVPVATLHSIGRTS 106

Query: 147 ---SRTSGRS--GASQKKS 160
              SRT  R   GAS   S
Sbjct: 107 TAISRTRTRQIDGASSPSS 125

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           R+ETV++L+  G+      +PDIN P ++ KN  FPEEY MET TGLV   TL  + R  
Sbjct: 45  RTETVKTLQDLGVT-SHVPVPDINAPQSSKKNAIFPEEYTMETTTGLVPVATLQSMGRTA 103

Query: 147 SRTS 150
           S  S
Sbjct: 104 SAIS 107

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 7/100 (7%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           R+ETV+SL+  G++  K  +PD+N P +  KN  FPEEY +ET TGLV   TLH +    
Sbjct: 49  RTETVKSLQDMGVS-SKAPVPDVNAPQSG-KNKIFPEEYTLETPTGLVPVATLHSIG--- 103

Query: 147 SRTSGRSGASQKKSIRTANS-TTNSDLASANNTINGLDGE 185
            RTS     ++ + I  A+S ++N D   ++N   G +G+
Sbjct: 104 -RTSTAISRTRTRQIEGASSPSSNEDALESDNNEKGKEGD 142

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 48/79 (60%), Gaps = 7/79 (8%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           R+ETV+SL+  G++  +  +PD+N P ++ KN  FPEEY +ET TGLV   TLH + R  
Sbjct: 49  RTETVKSLQDMGVS-SRAPVPDVNAPQSS-KNKIFPEEYTIETPTGLVPVATLHSIGRTS 106

Query: 147 ---SRTSGRS--GASQKKS 160
              SRT  R   GAS   S
Sbjct: 107 TAISRTRTRQIDGASSPSS 125

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           R+ETV+SL+  G+  +   IPD+N P    K   FPEEY MET TGLV   TL  + R  
Sbjct: 50  RTETVKSLQDMGMT-KNAPIPDVNAPQTAKKTAIFPEEYTMETPTGLVPVATLQSIGRTA 108

Query: 147 SRTSGRSGASQKKSIRTANSTTN 169
           +  S        +SI   +S +N
Sbjct: 109 TSISRTRTRQMDRSISMRSSHSN 131

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 2/63 (3%)

Query: 88  SETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLES 147
           +ET +SL++ G++  +  IPDIN P  N K+  FPEEY MET TGLV   TLH + R  S
Sbjct: 44  TETAKSLQEMGVS-SEAPIPDINAPQ-NVKSPIFPEEYTMETPTGLVPVATLHSIGRTTS 101

Query: 148 RTS 150
             S
Sbjct: 102 AVS 104

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 4/94 (4%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           R+ETV+SL++ G+      +PD+N P    +   FPEEY MET TGLV   TL  + R  
Sbjct: 44  RTETVKSLQEMGMT-ATAPVPDVNAPQTTARPQIFPEEYTMETPTGLVPVATLQSIGRTS 102

Query: 147 SRTSGRSGASQKKSIRTANSTTNSDLASANNTIN 180
           +  S RS   Q +  RT++ +++ D  +++  IN
Sbjct: 103 TAIS-RSRTRQME--RTSSESSSMDGTNSDAEIN 133

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 2/57 (3%)

Query: 88  SETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNR 144
           +ETV+SL++ GL+  +K IPD+N P+ +     FPEEY +ET TGLVK  TL  L R
Sbjct: 45  TETVKSLQEMGLS-SEKPIPDVNAPSTS-AGVIFPEEYTLETPTGLVKIATLVSLGR 99

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 88  SETVESLKKNGLNLQKKAIPDINNPAANY-KNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           +ET +SL+  GL   +  IPD N P  +  KN  FPEEY +ET TGLV   TLH L R  
Sbjct: 48  TETAKSLQDMGLT-SEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLHSLGRTP 106

Query: 147 SRTS 150
           +  S
Sbjct: 107 TAIS 110

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNR 144
           R+ET ++L+  G+   +  +PDIN P  + K   FPEEY MET TGLV   TL  + R
Sbjct: 49  RTETAKTLQDMGMT-SEAPLPDINAPQGSKKPAIFPEEYTMETPTGLVPVVTLQSIGR 105

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 50/86 (58%), Gaps = 3/86 (3%)

Query: 88  SETVESLKKNGLNLQKKAIPDINNPAANYKNCA-FPEEYQMETDTGLVKAQTLHGLNRLE 146
           +ETV+SL++ G+   +  +PD+N PAA     A FPEEY +ET TGLV   TL  L R  
Sbjct: 51  TETVKSLQEMGVT-PEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQSLGRTT 109

Query: 147 SRTSGRSGASQKKSIRTANSTTNSDL 172
           S  + R+ +   ++  TA +   +DL
Sbjct: 110 SGVT-RTRSRVLRARDTATAAGGADL 134

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 42/139 (30%), Positives = 66/139 (47%), Gaps = 10/139 (7%)

Query: 38  IKSLEPEGSVQASPSIDSKDFHRVKSNGTLRKQDSNAIEQIMTHNATE-GRSETVESLKK 96
           ++  +P+  +  S S  S+D  +   N  L    +N      T+   +  ++ETV+SL  
Sbjct: 20  LEDTQPQQYIYQSVSRQSRDDLQSSINSYLTTTPTNRSSNASTNQRLKLVKTETVKSLID 79

Query: 97  NGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGAS 156
            G++      P IN P  + K   FPEEY +ET+TGLV   TLH L R  +  S      
Sbjct: 80  MGVS-SYIPNPAINAPKTS-KKAIFPEEYTLETETGLVPVSTLHSLGRTNTNLS------ 131

Query: 157 QKKSIRTANSTTNSDLASA 175
            ++  R   S  N+ +AS+
Sbjct: 132 -RQRTRHTLSRRNTRIASS 149

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           ++ETV+SL+  G+      +PDIN P    KN  FPEEY MET +GLV   TL  + R  
Sbjct: 44  KTETVKSLQDLGVT-SAAPVPDINAPQTA-KNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 147 SRTS 150
           S  S
Sbjct: 102 SALS 105

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           ++ETV+SL+  G+      +PDIN P    KN  FPEEY MET +GLV   TL  + R  
Sbjct: 44  KTETVKSLQDLGVT-SAAPVPDINAPKTA-KNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 147 SRTS 150
           S  S
Sbjct: 102 SALS 105

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           ++ETV+SL+  G+      +PDIN P    KN  FPEEY MET +GLV   TL  + R  
Sbjct: 44  KTETVKSLQDLGVT-SAAPVPDINAPQTA-KNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 147 SRTS 150
           S  S
Sbjct: 102 SALS 105

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 8/79 (10%)

Query: 88  SETVESLKKNGLNLQKKAIPDINNPAANYKNCA-FPEEYQMETDTGLVKAQTLHGLNRLE 146
           +ETV+SL+  G+   +  +PD+N P       A FPEEY +ET TGLV   TL  L R +
Sbjct: 57  TETVKSLQDMGVT-PEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQSLGRTQ 115

Query: 147 SRTS------GRSGASQKK 159
           S  S       R GA+ ++
Sbjct: 116 SAVSRTRTRVMREGAAARR 134

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLE 146
           ++ETV+SL+  G+      +PDIN P    KN  FPEEY MET +GLV   TL  + R  
Sbjct: 44  KTETVKSLQDLGVT-SNAPVPDINAPQTA-KNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 147 SRTS 150
           +  S
Sbjct: 102 TALS 105

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 87  RSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGLNR 144
           R+ETV+SL+  G+   +  IP +N P  + +   FPEEY MET TGLV   TL  L R
Sbjct: 47  RTETVKSLQDMGMT-SEAPIPGVNAPQTS-RVQIFPEEYTMETPTGLVPVATLQSLGR 102

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 68  RKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNC-AFPEEYQ 126
           R++    +EQ +T  A   R ET E+L+  G+  +   +PD+  P   Y     FPEEY 
Sbjct: 21  REKPQQLLEQDVTSRALS-RHETAETLQTMGMA-RGTPLPDVVAP--TYAAAPVFPEEYT 76

Query: 127 METDTGLVKAQTLHGLNRLESRTS 150
           MET +G+V    L  L R  +  S
Sbjct: 77  METPSGIVPLAQLESLGRTVTTVS 100

>KLLA0E22683g Chr5 (2023109..2027200) [4092 bp, 1363 aa] {ON} weakly
           similar to uniprot|P47104 Saccharomyces cerevisiae
           YJR033C RAV1 Subunit of the RAVE complex (Rav1p Rav2p
           Skp1p) which promotes assembly of the V-ATPase
           holoenzyme required for transport between the early and
           late endosome/PVC and for localization of TGN membrane
           proteins potential Cdc28p substrate
          Length = 1363

 Score = 35.8 bits (81), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 9/87 (10%)

Query: 122 PEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSD--LASANNTI 179
           P  YQ ++D  L+ + T  G+ R+    + +SG   KKS  T  + TN+     S+N+ I
Sbjct: 552 PVRYQFQSDRSLIASITKLGVIRIYKAQADQSGIRWKKSYETITNITNASKITGSSNDKI 611

Query: 180 NGLDGE-------KLRRAVEKNQKKID 199
           + +D +        LRR+V + +   D
Sbjct: 612 SVIDEKGTTMTLWDLRRSVLEYETTFD 638

>NCAS0F02650 Chr6 (536503..538584) [2082 bp, 693 aa] {ON} Anc_5.311
           YDR295C
          Length = 693

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 8/70 (11%)

Query: 83  ATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVKAQTLHGL 142
           A   R  T + +K N L         ++N A   KN     EYQ ++   + KAQTL  L
Sbjct: 548 AEYTRDNTFKDIKLNELT--------VDNKAKTTKNDDLRMEYQTKSTIAVEKAQTLQDL 599

Query: 143 NRLESRTSGR 152
            R++  T  R
Sbjct: 600 KRIKKETEER 609

>Skud_7.385 Chr7 (642159..644966) [2808 bp, 935 aa] {ON} YGR089W
           (REAL)
          Length = 935

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 72/144 (50%), Gaps = 19/144 (13%)

Query: 66  TLRKQDSNAIEQIMTHNAT--EGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPE 123
           +L +Q+ +  +  +  NAT  E  +  VE+LK   + LQ+  I  +N      K      
Sbjct: 748 SLLRQEIDYFKSRIAQNATNDEKSTSKVENLK---VALQQSEIA-VNKLEKQLKKLT--- 800

Query: 124 EYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTN------SDLASANN 177
           E +++ +   +K + LH  N+LE    G+   S  K ++ + S  N      S +AS  +
Sbjct: 801 EKELDLEEEYLKKKDLHLKNQLEY---GKLEESLSKDLKNSESKFNKLNQELSQVASKLD 857

Query: 178 TINGLDGEKLRRAVEKNQKKIDKY 201
            +N    EKL++ V++N+K+I+K+
Sbjct: 858 RLNA-RNEKLQKEVDQNEKEIEKF 880

>TDEL0C05240 Chr3 complement(933679..935172) [1494 bp, 497 aa] {ON}
           Anc_3.386 YBR126C
          Length = 497

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 158 KKSIRTANSTTNSDLASANNTINGLDGEKLRRAVEKNQKKIDKYQKHKSSGGL 210
           KK + T N+ +NSD  +  N I  +   +L   + KNQ+   KY+   SSGGL
Sbjct: 7   KKDLPTVNTESNSDKPAPGNII--VVSNRLPVTINKNQET-GKYEYKMSSGGL 56

>KLTH0C06864g Chr3 (596687..598597) [1911 bp, 636 aa] {ON} weakly
           similar to uniprot|P34225 Saccharomyces cerevisiae
           YBL060W Hypothetical ORF
          Length = 636

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 81  HNATEGRSETVESLKKNGLNLQKKAIPDINNPAAN 115
           HN+    S T+E  ++N +N  +K  PDI+ P+ N
Sbjct: 160 HNSEADLSFTIEEFRENTINALQKESPDIDVPSFN 194

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.125    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,965,477
Number of extensions: 858306
Number of successful extensions: 4402
Number of sequences better than 10.0: 173
Number of HSP's gapped: 4362
Number of HSP's successfully gapped: 173
Length of query: 219
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 114
Effective length of database: 41,441,469
Effective search space: 4724327466
Effective search space used: 4724327466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 63 (28.9 bits)