Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14674g3.485ON1010101051790.0
Kwal_55.212013.485ON1011100940840.0
SAKL0F02926g3.485ON1050105831040.0
Skud_7.4363.485ON1036104627690.0
Suva_7.4133.485ON1037106527380.0
Smik_6.2213.485ON1036103727370.0
KAFR0C019103.485ON1020102827260.0
YGR125W3.485ON1036104727190.0
NCAS0E009503.485ON1052107627110.0
NDAI0G009903.485ON1054105927000.0
ZYRO0C07986g3.485ON1024106426430.0
CAGL0I10626g3.485ON1070104026320.0
TDEL0D055303.485ON1031104926240.0
KLLA0E04731g3.485ON1060103226210.0
Kpol_480.183.485ON1057106125770.0
KNAG0B008603.485ON1088110225420.0
TBLA0C044403.485ON115090725030.0
TPHA0D042103.485ON1049106724510.0
AFR304W3.485ON1015103524390.0
Skud_16.2868.99ON7452861495e-09
Smik_16.2418.99ON7442871433e-08
YPR003C8.99ON7542871334e-07
Suva_16.3228.99ON7422851319e-07
KLLA0E14059g8.99ON7062731254e-06
TDEL0C012808.99ON7272871254e-06
SAKL0B03124g8.99ON7443011238e-06
Ecym_7084na 1ON6892811221e-05
CAGL0L09207g8.99ON7255071201e-05
ZYRO0F04796g8.99ON7352901183e-05
TBLA0C052708.99ON7763071121e-04
NCAS0B048008.99ON7242691112e-04
KNAG0D023908.99ON7161341084e-04
AGR213Cna 1ON6891961058e-04
SAKL0H08800gna 1ON6202811030.002
Kpol_467.118.99ON7442801030.002
KLTH0G16764g8.99ON7103051000.003
Kwal_27.110398.99ON726303900.060
TPHA0H007208.99ON787124890.085
KAFR0K009205.168ON205132810.27
Smik_12.1518.271ON893219810.65
Suva_10.1768.271ON893219791.2
YLR092W (SUL2)8.271ON893219762.5
Suva_2.2218.177ON56121735.7
Skud_12.1608.271ON893423736.2
CAGL0L12342g8.271ON891130727.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14674g
         (1010 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...  1999   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...  1577   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1200   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1071   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1059   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1058   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1054   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1051   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1048   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1044   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1022   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1018   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1015   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...  1014   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...   997   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...   983   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...   968   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....   948   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   944   0.0  
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    62   5e-09
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    60   3e-08
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    56   4e-07
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    55   9e-07
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    53   4e-06
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    53   4e-06
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    52   8e-06
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    52   1e-05
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    51   1e-05
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    50   3e-05
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    48   1e-04
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    47   2e-04
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    46   4e-04
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    45   8e-04
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    44   0.002
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    44   0.002
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    43   0.003
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    39   0.060
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...    39   0.085
KAFR0K00920 Chr11 (195921..196538) [618 bp, 205 aa] {ON} Anc_5.1...    36   0.27 
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...    36   0.65 
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...    35   1.2  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...    34   2.5  
Suva_2.221 Chr2 (376792..378477) [1686 bp, 561 aa] {ON} YDR062W ...    33   5.7  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...    33   6.2  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...    32   7.1  

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score = 1999 bits (5179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 976/1010 (96%), Positives = 976/1010 (96%)

Query: 1    MGFSRPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVAN 60
            MGFSRPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVAN
Sbjct: 1    MGFSRPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVAN 60

Query: 61   LSPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQLEDLAE 120
            LSPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQLEDLAE
Sbjct: 61   LSPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQLEDLAE 120

Query: 121  NGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYV 180
            NGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYV
Sbjct: 121  NGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYV 180

Query: 181  SLQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVIXXXXXXXXXXXSYGMIIFPIT 240
            SLQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVI           SYGMIIFPIT
Sbjct: 181  SLQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVILGLLLNILDALSYGMIIFPIT 240

Query: 241  EPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMP 300
            EPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMP
Sbjct: 241  EPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMP 300

Query: 301  GEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITG 360
            GEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITG
Sbjct: 301  GEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITG 360

Query: 361  FEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAA 420
            FEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAA
Sbjct: 361  FEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAA 420

Query: 421  LLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTML 480
            LLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTML
Sbjct: 421  LLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTML 480

Query: 481  ALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLF 540
            ALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLF
Sbjct: 481  ALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLF 540

Query: 541  IKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKL 600
            IKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKL
Sbjct: 541  IKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKL 600

Query: 601  NNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRR 660
            NNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRR
Sbjct: 601  NNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRR 660

Query: 661  DYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFK 720
            DYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFK
Sbjct: 661  DYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFK 720

Query: 721  NINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLN 780
            NINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLN
Sbjct: 721  NINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLN 780

Query: 781  SALEWCENEFLRQFRDLRNKTKLKAVRKQERQLSKGALPFNTPRNNHFVSVAQKLFTDEQ 840
            SALEWCENEFLRQFRDLRNKTKLKAVRKQERQLSKGALPFNTPRNNHFVSVAQKLFTDEQ
Sbjct: 781  SALEWCENEFLRQFRDLRNKTKLKAVRKQERQLSKGALPFNTPRNNHFVSVAQKLFTDEQ 840

Query: 841  SMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQ 900
            SMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQ
Sbjct: 841  SMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQ 900

Query: 901  SLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKME 960
            SLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKME
Sbjct: 901  SLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKME 960

Query: 961  TDCALWILDXXXXXXXXXXXXXXXXXXXXXXXCMNQDRLKELLGHCLVSS 1010
            TDCALWILD                       CMNQDRLKELLGHCLVSS
Sbjct: 961  TDCALWILDEANLAKLKKENLALYTELLLVTLCMNQDRLKELLGHCLVSS 1010

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score = 1577 bits (4084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 788/1009 (78%), Positives = 887/1009 (87%), Gaps = 3/1009 (0%)

Query: 4    SRPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVANLSP 63
            +RP+NK S+SEAISVSLGLQSQ  S+ D+  +PR NPFS+  DGSPHYYLGRSYVANLSP
Sbjct: 4    NRPKNKPSISEAISVSLGLQSQSNSDQDSSYIPRANPFSHTGDGSPHYYLGRSYVANLSP 63

Query: 64   PPLA-IKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQLEDLAEN- 121
            PPLA +     G+   S RPEQSQSIHQS+SLRRQTAALSNEF+ TFEFEDQL  ++E+ 
Sbjct: 64   PPLARLPGGLPGELPLSYRPEQSQSIHQSVSLRRQTAALSNEFEDTFEFEDQLAGVSEDD 123

Query: 122  GNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYVS 181
            G++   +E  M G+ ISP SS P+  + D  + SN LLPPN + DLEYGSID ++HQYVS
Sbjct: 124  GHSTTAEEPSMNGTLISPVSSVPDTPI-DINEPSNALLPPNAEHDLEYGSIDGYEHQYVS 182

Query: 182  LQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVIXXXXXXXXXXXSYGMIIFPITE 241
            LQS+R+G+N+  I P+AS+R+K +FT RR+ NY+PAVI           SYGMIIFPITE
Sbjct: 183  LQSRRSGANTHNIGPDASLREKMMFTARRMVNYMPAVILGLLLNILDALSYGMIIFPITE 242

Query: 242  PLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMPG 301
            PLFSHLGP+G+SMFY+SS++SQL+YS GFSAFGNAVGSEMIEITPFYH+MAASI+A +PG
Sbjct: 243  PLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPG 302

Query: 302  EKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGF 361
            EKDRVL+TTIVCYA+SSI+TGLVFFLLGRL+LGKIVGFFPRHILIGCIGGVGYFL+ITG 
Sbjct: 303  EKDRVLSTTIVCYALSSIITGLVFFLLGRLRLGKIVGFFPRHILIGCIGGVGYFLLITGL 362

Query: 362  EVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAAL 421
            EVTTR +KFEYSFEFLSSL T+ E+LGKWGLPALMAVLLVV+Q A  NSLVLP FYIAAL
Sbjct: 363  EVTTRVAKFEYSFEFLSSLFTNIEVLGKWGLPALMAVLLVVVQHAFGNSLVLPAFYIAAL 422

Query: 422  LLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLA 481
            LLFHFIVALIPSLSL  LRDSGW+FPAT +TEHWFDFY LYNFKLVSWP++LKQ+PTMLA
Sbjct: 423  LLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLA 482

Query: 482  LTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFI 541
            LTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSG++GSVQNYLVYTNS+LFI
Sbjct: 483  LTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFI 542

Query: 542  KAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLN 601
            +AG DD+LAGLMLAAATFGIM++GPVIVAYIPVCIVGSLIFLLGYELLKEAL DTWGKLN
Sbjct: 543  RAGGDDALAGLMLAAATFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLN 602

Query: 602  NFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRD 661
            NFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQT+NGEFDGQVARSTV RD
Sbjct: 603  NFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRD 662

Query: 662  YIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFKN 721
            YIQTQFLNKIGEQIHVLKLQNLLFFGTI+SIEEKIDKLLELSDKD+SKKRIKYLILDFKN
Sbjct: 663  YIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKN 722

Query: 722  INADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNS 781
            INADNIDYSAAEGFNRIKRFT SKRIHLIISSIKT+DRIYRAFNKVG L+GVELFDDLNS
Sbjct: 723  INADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNS 782

Query: 782  ALEWCENEFLRQFRDLRNKTKLKAVRKQERQLSKGALPFNTPRNNHFVSVAQKLFTDEQS 841
            ALEWCENEFL QF+DLRNKTKLKA +KQ+R++SK  LPFNTPRNN FVSVAQKLFTDEQS
Sbjct: 783  ALEWCENEFLIQFKDLRNKTKLKAGKKQDRRMSKVPLPFNTPRNNQFVSVAQKLFTDEQS 842

Query: 842  MPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQS 901
            M HLK+ Y+E+ PVL LLLSALQR+RP+IMS +K VKE EE++WS+L K+F+K+RLAA S
Sbjct: 843  MTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHS 902

Query: 902  LLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMET 961
            LL HK+NIF V+E+GMVKVTYNLRQGQLYE +SGKTCYGR++ PN++  PIS VE++MET
Sbjct: 903  LLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMSIPNNNNNPISCVEVEMET 962

Query: 962  DCALWILDXXXXXXXXXXXXXXXXXXXXXXXCMNQDRLKELLGHCLVSS 1010
            DC+LWI+D                       C+NQDRLKELLGHCLVSS
Sbjct: 963  DCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1200 bits (3104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/1058 (59%), Positives = 762/1058 (72%), Gaps = 66/1058 (6%)

Query: 7    RNKHSLSEAISVSLGLQS----QPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVANLS 62
            +N+ S+SEAI++SLGL S    QP       S+   NP     + S +YYLGRSYV + S
Sbjct: 5    KNRKSISEAITISLGLHSDNIKQPSQANRRSSM---NP-----ENSSNYYLGRSYVGSFS 56

Query: 63   PPPLAIKERFSGDPTS--SSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQLEDLA- 119
             P    +E  S D     S   + S+SIH+S+ L RQTAALSN FD + + +    D+A 
Sbjct: 57   SPSFLQRES-SADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDEIDVAA 115

Query: 120  --ENGNTAVPDE-SVMAGS--------------AISPTSSGPEPSVLDNTDVSNLLLPPN 162
              E  N A+  E S+  GS              A S  +   E + L+  + + LL P +
Sbjct: 116  SQEFQNEALQRELSLENGSYSNSNNNNNNNNQIAYSEDAITQENNGLN--ECTRLLSPTS 173

Query: 163  TQ-RDLEYG---------SIDEFDHQYVSLQS----------QRAGSNSRAIDPNASMRD 202
                DLEYG         S      QYVSL +          Q  G    A +   S+R 
Sbjct: 174  AAATDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQ 233

Query: 203  KTLFTFRRLG--------NYVPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPSGLSM 254
              + ++            NY+PAVI           SYGMIIFPITEP+FSHLGP+GLSM
Sbjct: 234  PVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSM 293

Query: 255  FYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMPGEKDRVLTTTIVCY 314
            FY+S+++SQLVYSCGFSAFGN +GSEMIEITPF+H+MA SIM S+PG  D +++TTIVCY
Sbjct: 294  FYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCY 353

Query: 315  AMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSF 374
            A+SSI TGL FFLLG+L+LGKIVGFFPRHILIGC+GGVGYFL+ITG EV TR SKFEYS+
Sbjct: 354  ALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSW 413

Query: 375  EFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSL 434
             FL  L  + E+LGKW LP ++ + L+V Q    NSLVLP+FYI  L LFHF+VA++P+L
Sbjct: 414  PFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNL 473

Query: 435  SLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINV 494
            SL+SLR+SGW+FP   ++ HW+DFYKLY+F+ V W LVLKQVPTMLALTFFGILHVPINV
Sbjct: 474  SLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINV 533

Query: 495  PALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLML 554
            PALAMSIG+DK DVDKELIAHGYSN LSG  GS+QNYLVYTNS LFI+AG+D S AG +L
Sbjct: 534  PALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLL 593

Query: 555  AAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFT 614
            A  TF +M+IGPVI+++IP+CIVGSLIFLLGYEL+KEAL DTWGKLN FEY T+V IVFT
Sbjct: 594  ALGTFVVMIIGPVIISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFT 653

Query: 615  MGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQ 674
            MG FDFVLGIIVGILIACFSFLVDSTKLQTINGEF+GQVARSTV RDYIQT+FLNK+GEQ
Sbjct: 654  MGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQ 713

Query: 675  IHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFKNINADNIDYSAAEG 734
            IHVLKLQNLLFFGTIISIEEKID LLE+SDKD+S++RIKYLILDFKNINADNIDYSAAEG
Sbjct: 714  IHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEG 773

Query: 735  FNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQF 794
            FNRIKRFT +KRI LIISSI   DRIY AFNKVG L  VELF DLNSALEWCENEFL Q+
Sbjct: 774  FNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQY 833

Query: 795  RDLRNKT--KLKAVRKQERQLSKGALPFNTPRNNHFVSVAQKLFTDEQSMPHLKTHYKEK 852
            + +R +T  KL+A +KQE+ LSK  LP NTPRNN  V+VAQK+F DEQ++ HL+T Y+++
Sbjct: 834  KQIRTRTKAKLQAQKKQEKHLSKSLLPINTPRNNQIVTVAQKIFPDEQNVTHLRTQYQKR 893

Query: 853  TPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLV 912
             PVL LLL AL+++RP+IMS +K VK+ EE  WS+L  +F ++R A  SLL H NN+F +
Sbjct: 894  EPVLPLLLVALKKFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSLLLHNNNLFFL 953

Query: 913  VESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDXXX 972
            VESGM+K+TY+L QGQ YE +S KTCYGRI+  N+       V IK ETDCA+WI+D   
Sbjct: 954  VESGMLKITYDLHQGQFYETMSSKTCYGRISG-NAEFTTNLYVNIKTETDCAVWIIDATN 1012

Query: 973  XXXXXXXXXXXXXXXXXXXXCMNQDRLKELLGHCLVSS 1010
                                 +NQ R KELLG+ LVSS
Sbjct: 1013 LANLKEKNLALYAELLLVVMSINQYRSKELLGYSLVSS 1050

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1071 bits (2769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/1046 (54%), Positives = 710/1046 (67%), Gaps = 74/1046 (7%)

Query: 14   EAISVSLGL-QSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVANL---SPPPLAIK 69
            EAISVSLG+ Q    ++    SV   +P        P   L RSY++        P+   
Sbjct: 16   EAISVSLGINQDSSKNKMHRASVSAMSP--------P---LCRSYMSGFFTGGSSPMV-- 62

Query: 70   ERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQLEDLAENGNTAVPDE 129
            +  S      S  +    IH S +L RQTA LSNEF  +         + EN  T     
Sbjct: 63   KNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSS--------SVEENSPTIKDYM 114

Query: 130  SVMAGSAISPTSSGPEPSVLDNTD------VSNLLLPPNT-------QRDLEYGSIDEFD 176
             ++         S    ++++N D       S LLL P +        R L+ G I E +
Sbjct: 115  DIIDSDDRKDDQS--MRTIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELE 172

Query: 177  HQYVS-LQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVIXXXXXXXXXXXSYGMI 235
              Y    QS R   N R   P    +  T F F+   +Y+PA +           SYGMI
Sbjct: 173  DDYGGGYQSLRPSHNLR-FRPRNIWQWCTSFPFK-FAHYLPAAVLGLLLNILDALSYGMI 230

Query: 236  IFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASI 295
            IFPITEP+FSHLGP+G+SMFY+S+++SQ VYS G+S+F + +GSEMIEITPFYH+MA ++
Sbjct: 231  IFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAV 290

Query: 296  MASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYF 355
              ++ G  D ++TTTI CY +SS++TG+VF++LG+L+LGKIVGFFPRHILIGCIGGVGYF
Sbjct: 291  KDALEGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYF 350

Query: 356  LVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPT 415
            L+ITG EVTTR +KFEYS+ F S L T+ + L KW LP L+ V+L+  QR  KNSLVLPT
Sbjct: 351  LIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPT 410

Query: 416  FYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQ 475
            FYI  L+LFHFIVA+IP+LSL +LR++GW+FP   +   W+D YKL+N   V W LVL+Q
Sbjct: 411  FYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQ 470

Query: 476  VPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYT 535
            +PTM+ALTFFGILHVPINVPALAMS+ +DK DVD+ELIAHGYSNF SG++GSVQNYLVYT
Sbjct: 471  IPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYT 530

Query: 536  NSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVD 595
            NS+LFI+AGAD S AG +L A T  +M+IGPVI+++IP+CIVGSLIFLLGYELL EALVD
Sbjct: 531  NSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVD 590

Query: 596  TWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVAR 655
            TW KLN FEY TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTKLQTINGE++G VA+
Sbjct: 591  TWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAK 650

Query: 656  STVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYL 715
            STV RDY+QT+FL+ IGEQI+VLKLQN+LFFGTIISIEEKI+KLL++S+KDA K+RIKYL
Sbjct: 651  STVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIEKLLQISNKDAKKRRIKYL 710

Query: 716  ILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVEL 775
            ILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISSIK  DRIY AFN VG L+ VEL
Sbjct: 711  ILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVEL 770

Query: 776  FDDLNSALEWCENEFLRQFRDLRNKTKLKAVRKQERQ--------------------LSK 815
            F DLNSALEWCENEFL Q++ LR K K +   +++                      LS 
Sbjct: 771  FADLNSALEWCENEFLFQYKQLREKAKKRLEERKQSSVASAIMAATQNKKIDGLGNGLST 830

Query: 816  G----------ALPFNTPRNNHFVSVAQKLFT-DEQSMPHLKTHYKEKTPVLHLLLSALQ 864
            G          +LP NTPRN   +SVAQ +F  DEQ++ + K  YK   P+L +LL AL+
Sbjct: 831  GENRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALK 890

Query: 865  RYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNL 924
            +YRP+I+S  + V+E E K W++L  +F +RRLA+QSLL H +NIF +VE+GM+K TY L
Sbjct: 891  QYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYEL 950

Query: 925  RQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDXXXXXXXXXXXXXXX 984
             QG LYEI S  TC+G+I AP ++      + I+ ETD  LW++D               
Sbjct: 951  PQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALY 1010

Query: 985  XXXXXXXXCMNQDRLKELLGHCLVSS 1010
                    C+   R KELLG+ LVS+
Sbjct: 1011 VEVTLMVMCIKDTRFKELLGYTLVSA 1036

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1059 bits (2738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/1065 (53%), Positives = 715/1065 (67%), Gaps = 111/1065 (10%)

Query: 14   EAISVSLGLQSQPGSET-------DTLSVPRGNPFSNG---ADGSPHYYLGRSYVANLSP 63
            EAI+VSLG+  Q  S+         T+S P    + +G      SP  Y       N+S 
Sbjct: 16   EAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNY-------NMSD 68

Query: 64   PPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEF------------------ 105
            P L             S  +  + IH S +L RQTA LSNEF                  
Sbjct: 69   PKLPF-----------SNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDI 117

Query: 106  -DGTFEFEDQ-LEDLAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNT 163
             D     +DQ +  + EN +    DE   +   +SP SS  +       D  N  L  + 
Sbjct: 118  IDSDDRKDDQSMRTIEENIDEEYADE--YSRLLLSPASSNVD-------DERNRALQGSP 168

Query: 164  QRDLEYGSIDEFDHQYVSLQSQRAGSNSRAIDPNASMR--DKTLFTF-----RRLGNYVP 216
              DLE G                 G   +++ P+  +R   ++++ +      +   Y+P
Sbjct: 169  TSDLEDGH----------------GGGYQSVHPSHDLRFGPRSVWQWFTSFPSKFAQYLP 212

Query: 217  AVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNA 276
            A +           SYGMIIFPITEP+FSHLGP+G+SMFY+S+++SQ VYS G+S+F + 
Sbjct: 213  AAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFPSG 272

Query: 277  VGSEMIEITPFYHSMAASIMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKI 336
            VGSEMIEITPFYH+MA  I  ++ G  D ++TTTI CY +SS++TG+VF++LG+L+LGKI
Sbjct: 273  VGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKI 332

Query: 337  VGFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALM 396
            VGFFPRHILIGCIGGVGYFL+ITG EVTTR +KFEYS+ F+S L T+ + L KW LP L+
Sbjct: 333  VGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLL 392

Query: 397  AVLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWF 456
             V+L+  QR  KNSLVLPTFYI  L+LFHFIVA+IP+LSL +LRDSGW+FP  ++   W+
Sbjct: 393  TVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWY 452

Query: 457  DFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHG 516
            D YKL+N   V W LVL+Q+PTM+ALTFFGILHVPINVPALAMS+ +DK DVDKELIAHG
Sbjct: 453  DHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHG 512

Query: 517  YSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCI 576
            YSNF SG++GSVQNYLVYTNS+LFI+AGAD S AG +L A T  IMVIGPVI+++IP+CI
Sbjct: 513  YSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICI 572

Query: 577  VGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFL 636
            VGSLIFLLGYELL EALVDTW KLN FEY TVV IVFTMG FDFVLGIIVGILIACFSFL
Sbjct: 573  VGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFL 632

Query: 637  VDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKI 696
            VDSTKLQT+NGE++G VA+STV RDY+QT+FL+ IGEQI+VLKLQN+LFFGTIISIEEKI
Sbjct: 633  VDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKI 692

Query: 697  DKLLELSDKDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKT 756
            ++LLE+S+KD++K+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISSIK 
Sbjct: 693  ERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKE 752

Query: 757  TDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNKTKLK-AVRKQER---- 811
             D IY AFN VG L+ VELF DLN ALEWCENEFL Q++ LR K K +   RKQ      
Sbjct: 753  RDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYKQLREKAKKRLEERKQNNVVSA 812

Query: 812  ---------------QLSKG----------ALPFNTPRNNHFVSVAQKLF-TDEQSMPHL 845
                            L+KG          +LP NTPRN+  +SVAQ +F  DEQ++ +L
Sbjct: 813  IMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNL 872

Query: 846  KTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPH 905
            K  YKE  PVL +LL AL++YRP+I+S  + V+E E K W++L  +F +RRLA+QSLL H
Sbjct: 873  KKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFSRRRLASQSLLLH 932

Query: 906  KNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCAL 965
             +N+F ++E+GM+K  Y L QG LYEI+S  TC+G+I AP ++      + I+ ETD  L
Sbjct: 933  ADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNTMPREQKLTIETETDSIL 992

Query: 966  WILDXXXXXXXXXXXXXXXXXXXXXXXCMNQDRLKELLGHCLVSS 1010
            W++D                       C+   R KELLG+ LVS+
Sbjct: 993  WVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1058 bits (2737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/1037 (53%), Positives = 709/1037 (68%), Gaps = 56/1037 (5%)

Query: 14   EAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVANL---SPPPLAIKE 70
            EAISVSLG+           S+ + +  S  A   P   L RSY++        P+    
Sbjct: 16   EAISVSLGINQDS-------SINKMHRASVSAMSPP---LCRSYMSGFFTGGNSPMINSM 65

Query: 71   RFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFED-----QLEDLAENGNTA 125
              S  P S+   +  + IH S +L RQTA LSNEF  +   E+        D+ ++G+  
Sbjct: 66   SDSKLPLSNK--QHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSGDRK 123

Query: 126  VPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYVS-LQS 184
                       I    S     +L +   SN+    +  R L+ G   E +  Y    QS
Sbjct: 124  DDQSMRTIEEDIDEEYSDEYSRLLLSPASSNI--NDDRNRGLQNGLTSELEDDYEGGYQS 181

Query: 185  QRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVIXXXXXXXXXXXSYGMIIFPITEPLF 244
             R+  N R+  P    R  T F   +  +Y+PA +           SYGMIIFPITEP+F
Sbjct: 182  LRSSHNLRS-RPRNFRRLCTSFP-SKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVF 239

Query: 245  SHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMPGEKD 304
            SHLGP+G+SMFY+S+++SQ VYS G S+F + +GSEMIEITPFYH+MA ++  ++ G+ D
Sbjct: 240  SHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDD 299

Query: 305  RVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVT 364
             ++TTTI CY +SS++TG VF++LG+L+LGKIVGFFPRHILIGCIGGVGYFL+ITG EVT
Sbjct: 300  EIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVT 359

Query: 365  TRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAALLLF 424
            TR +KFEYS+ F   L T+ + L KW LP ++ V+L+  QR  KNSLVLP+FYI  L+LF
Sbjct: 360  TRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLF 419

Query: 425  HFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTF 484
            HFIVA+IP+LSL +LR +GW+FP   +   W+D YKL+N   V W LVL+Q+PTM+ALTF
Sbjct: 420  HFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTF 479

Query: 485  FGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAG 544
            FGILHVPINVPALAMS+ +DK DVD+ELIAHGYSNF SG++GSVQNYLVYTNS+LFI+AG
Sbjct: 480  FGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAG 539

Query: 545  ADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFE 604
            AD S AG +L A T  IM+IGPVI+++IP+CIVGSLIFLLGYELL EAL+DTW KLN FE
Sbjct: 540  ADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFE 599

Query: 605  YATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQ 664
            Y TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTKLQTINGE++G VA+STV RDY+Q
Sbjct: 600  YLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQ 659

Query: 665  TQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFKNINA 724
            T+FL+ IGEQI+VLKLQNLLFFGTI+SIEEKI+KLL++S+KDA+K+RIKYLILDFKNINA
Sbjct: 660  TKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINA 719

Query: 725  DNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSALE 784
            DNIDYSAAEGFNRIKRFT +K+I LIISSI+  DRIY AFN VG L+ VELF DLNSALE
Sbjct: 720  DNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALE 779

Query: 785  WCENEFLRQFRDLRNKTKLKAVRKQERQ--------------------LSKG-------- 816
            WCENEFL Q++ LR K K +   +++                      L+KG        
Sbjct: 780  WCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQNKNINALGNGLNKGNNIDPVRN 839

Query: 817  --ALPFNTPRNNHFVSVAQKLF-TDEQSMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSP 873
              +LP NTPRN   +SVAQ +F  DEQ++ + K  YK+  PVL +LL AL++YRP+I+S 
Sbjct: 840  LMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISE 899

Query: 874  EKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEIL 933
             + V+E E K W++L  +F +RRLA+QSLL H +N+F +VE+GM+K TY L QG LYEI 
Sbjct: 900  IQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIF 959

Query: 934  SGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDXXXXXXXXXXXXXXXXXXXXXXXC 993
            S  TC+G+I AP ++      + I+ ETD  LW++D                       C
Sbjct: 960  SNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMC 1019

Query: 994  MNQDRLKELLGHCLVSS 1010
            +   R KELLG+ LVS+
Sbjct: 1020 IKDTRFKELLGYTLVSA 1036

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/1028 (53%), Positives = 709/1028 (68%), Gaps = 38/1028 (3%)

Query: 4    SRPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVANLSP 63
            +R   + SLS++IS SLGLQ Q  +   T      N  SN    S   YL RSY+  L P
Sbjct: 10   ARASKRLSLSDSISRSLGLQDQESNIAGT-----DNELSN----SKSNYLSRSYMYGLLP 60

Query: 64   PPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFE--FEDQLEDLAEN 121
                ++E    +    S   +++SIHQS  L +QTAA+  +F+ + E   +D L D  EN
Sbjct: 61   SATPVEE-LETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFNESDEGSMKDYL-DFIEN 118

Query: 122  GNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDE-FDHQYV 180
             +    +E       ++   S P   V +  + S LLL P++  + E  SI E   H Y 
Sbjct: 119  TDRDNINEH-KESLPVTVVLSTPADEVEEQDESSRLLLTPSSS-NAEVSSIAEGLRHHYS 176

Query: 181  SLQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVIXXXXXXXXXXXSYGMIIFPIT 240
            S++S +  +       + ++ +K    F     Y PA +           SYGMIIFPI+
Sbjct: 177  SIESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPIS 236

Query: 241  EPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMP 300
            EP+FSHLGP+G+SMFY+S+++ Q +YS G+S+F + +GSEMIEITPF+H+MA +IM S+P
Sbjct: 237  EPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLP 296

Query: 301  GE--KDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVI 358
            GE  +D ++TTTI CY +SS+ TGL F  LG+L+LGKIVGFFPRHILIGCIGGVGYFL+I
Sbjct: 297  GEENQDAIITTTIFCYVISSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLI 356

Query: 359  TGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYI 418
            TG EVTTR +KFEYS   +  L TD  +L KW  P L+ V+L++ Q+  K SLVLP+FYI
Sbjct: 357  TGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYI 416

Query: 419  AALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPT 478
            A L+LFHFIVA+IP LSL  LR++GW+F  T     W+D YKL++F  V W LV KQ+PT
Sbjct: 417  ATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPT 476

Query: 479  MLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSL 538
            MLALTFFGILHVPINVPALAMS+ +DK DVDKELIAHG SN +SGM GS+QNYLVYTNS+
Sbjct: 477  MLALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSV 536

Query: 539  LFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWG 598
            LFI+AGAD   AG +L   T  +M+IGPVI+++IP+CIVGSLIFLLGYELL EAL+DTW 
Sbjct: 537  LFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWD 596

Query: 599  KLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTV 658
            KL  FEY TVV IV TMG  DFVLGIIVGILIACF FL+DS+KLQTINGEF G+VA+STV
Sbjct: 597  KLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTV 656

Query: 659  RRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILD 718
             RD IQ++FLN IG+QI+VLKLQNLLFFGTIISIEEKIDKLLE+SD+++SK++IKYLILD
Sbjct: 657  NRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILD 716

Query: 719  FKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDD 778
            F+NINADNIDYSAAEGFNRIKR T SK I LIISSIK  DRIY +FNKVG L GVELF+D
Sbjct: 717  FRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFND 776

Query: 779  LNSALEWCENEFLRQFRDLRNKTKLKAVR----KQERQLSKGA---LPFNTPRNNHFVSV 831
            LN ALEWCENEFL Q++ +R + K+K V+      +  LSK +   L  NTPRN    SV
Sbjct: 777  LNGALEWCENEFLYQYKMIRERIKIKNVKTATHSSDGNLSKPSAMTLSINTPRNYQIYSV 836

Query: 832  AQKLF-TDEQSMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGK 890
            AQ +F  +EQ++  LK  ++++TPVL LLL AL++YRP+I+S +K  K  E + WS+L  
Sbjct: 837  AQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAP 896

Query: 891  FFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEV 950
            +F K+R+A+QS+L H NNIF +VE G++KVT++L QG++YE +S + CYG+I      ++
Sbjct: 897  YFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMG----KI 952

Query: 951  PISSVE--------IKMETDCALWILDXXXXXXXXXXXXXXXXXXXXXXXCMNQDRLKEL 1002
            P+S  +        IK E D  +WI+D                        +   R K L
Sbjct: 953  PVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSL 1012

Query: 1003 LGHCLVSS 1010
            LGH LVS+
Sbjct: 1013 LGHALVST 1020

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1051 bits (2719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/1047 (54%), Positives = 710/1047 (67%), Gaps = 76/1047 (7%)

Query: 14   EAISVSLGL-QSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRS-YVANLSPPPLAIKER 71
            EAISVSLG+ Q    ++    SV   +P    +  S  +  G S  + NLS   L I   
Sbjct: 16   EAISVSLGINQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSPMINNLSDSKLPI--- 72

Query: 72   FSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQ--LEDLAEN-GNTAVPD 128
                    S  +  + IH S +L RQTA LSNEF  +   E+   ++D  +  GN    D
Sbjct: 73   --------SNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNGDRKD 124

Query: 129  ESVMAGSAISPTSSGPEPSVLDNTD------VSNLLLPP-------NTQRDLEYGSIDEF 175
            +  M              ++ +N D       S LLL P       +  R L+  S+ E 
Sbjct: 125  DQSMR-------------TIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPEL 171

Query: 176  DHQYVS-LQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVIXXXXXXXXXXXSYGM 234
            +  Y    QS R   N R   P       T F   +  +Y+PA +           SYGM
Sbjct: 172  EDGYAGGYQSLRPSHNLR-FRPRNLWHMCTSFP-SKFAHYLPAAVLGLLLNILDALSYGM 229

Query: 235  IIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAAS 294
            IIFPITEP+FSHLGP+G+SMFY+S+++SQ VYS G+S+F + +GSEMIEITPFYH+MA +
Sbjct: 230  IIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALA 289

Query: 295  IMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGY 354
            I  ++ G  D ++TTTI CY +SS++TG+VF+ LG+L+LGKIVGFFPRHILIGCIGGVGY
Sbjct: 290  IKEALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGY 349

Query: 355  FLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLP 414
            FL+ITG EVTTR +KFEYS+ F S L TD + L KW LP L+ V+L+  QR  KNSLVLP
Sbjct: 350  FLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLP 409

Query: 415  TFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLK 474
            +FYI  L+LFHFIVA+IP+LSL +LR +GW+FP   +   W+D Y+L+N   V W LVL+
Sbjct: 410  SFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQ 469

Query: 475  QVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVY 534
            Q+PTM+ALTFFGILHVPINVPALAMS+ +DK DVD+ELIAHGYSNF SG++GSVQNYLVY
Sbjct: 470  QIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVY 529

Query: 535  TNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALV 594
            TNS+LFI+AGAD   AG +L A T  IM+IGPVI+++IP+CIVGSLIFLLGYELL EALV
Sbjct: 530  TNSVLFIRAGADSPFAGFLLIALTICIMIIGPVIISFIPICIVGSLIFLLGYELLVEALV 589

Query: 595  DTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVA 654
            DTW KLN FEY TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTKLQTINGE++G VA
Sbjct: 590  DTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVA 649

Query: 655  RSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKY 714
            RSTV RDY+QT+FL+ IGEQI+VLKLQNLLFFGTIISIEEKI++LL++S+KDA+K+RIKY
Sbjct: 650  RSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKY 709

Query: 715  LILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVE 774
            LILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISSIK  DRIY AFN VG L+ VE
Sbjct: 710  LILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVE 769

Query: 775  LFDDLNSALEWCENEFLRQFRDLRNK--------------------TKLKAVRKQERQLS 814
            LF DLNSALEWCENEFL Q++ LR K                    TK K +      L+
Sbjct: 770  LFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLN 829

Query: 815  KGA----------LPFNTPRNNHFVSVAQKLF-TDEQSMPHLKTHYKEKTPVLHLLLSAL 863
            +G+          LP NTPRN   +SVAQ +F  DEQ++ + K  YK+  PVL +LL AL
Sbjct: 830  RGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFAL 889

Query: 864  QRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYN 923
            ++YRP+I+S  + V+E E K W++L  +F +RRLA+QS L H +NIF +VE+GM+K TY 
Sbjct: 890  KQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYE 949

Query: 924  LRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDXXXXXXXXXXXXXX 983
            L QG LYEI S  TC+G+I AP ++      + I+ ETD  LW++D              
Sbjct: 950  LPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLAL 1009

Query: 984  XXXXXXXXXCMNQDRLKELLGHCLVSS 1010
                     C+   R KELLG+ LVS+
Sbjct: 1010 YVEVALMVMCIKDTRFKELLGYTLVSA 1036

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1048 bits (2711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/1076 (52%), Positives = 733/1076 (68%), Gaps = 96/1076 (8%)

Query: 1    MGFSRPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVA- 59
            + F +   + S+S +ISVSLGLQ +          PR + F +  + + + Y+GRSYV+ 
Sbjct: 7    IDFKKKNKQQSISGSISVSLGLQQEEE--------PRDDYFDD-ENVNNNNYMGRSYVSG 57

Query: 60   --NLSPPPL-AIKERFSGDPTSSSRPEQ--SQSIHQSLSLRRQTAALS------------ 102
              ++SP  + ++K+     P + +  ++  ++ IH S  L +QTAA+S            
Sbjct: 58   FLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFEDDEDDTRI 117

Query: 103  NEFDGTFEFED------------------QLEDLAENGNTAVPDESVMAGSA---ISPTS 141
             ++   F+ ED                  Q E+  E+    V + + +  S+   ISP S
Sbjct: 118  KDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVDESSRLLISPLS 177

Query: 142  SGPEPSVLDNTDVSNLLLPPNTQRDL-EYGSIDEFDHQYVSLQSQRAGSNSRAIDPNASM 200
            S   P++ D       LLP  T  D+  Y SI             R  + S + +     
Sbjct: 178  SNINPNIDD-------LLPTVTGEDVSSYQSI------------YRTATPSLSRNSETIW 218

Query: 201  RDKTLFTFRRLGNYVPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPSGLSMFYMSSV 260
            ++   F ++ + +Y+PA +           SYGMIIFPITEP+FSHLGP+GLSMFY+S++
Sbjct: 219  QNIADFPYQFI-HYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFYISTI 277

Query: 261  VSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMPGEKDRVLTTTIVCYAMSSIM 320
            +SQ +YS G+S+F + +GSEMIE+TPF+H+MA +I  ++PG  D ++TTTI CY +SS++
Sbjct: 278  ISQTIYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSML 337

Query: 321  TGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSL 380
            TGL F+ LG+L LGKIVGFFPRHILIGCIGGVGYFL++TG EVTTR +KFEYS  FL+SL
Sbjct: 338  TGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASL 397

Query: 381  LTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLR 440
             +D   L KW LP L+ V+L+V QR  KNSLVLP+FYI  L+LFHFIVA+IPSL+L+ LR
Sbjct: 398  FSDWATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLR 457

Query: 441  DSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMS 500
            DSGW+FP   +   W+D YKL++FK V W LV KQ+PTMLALTFFGILHVPINVPALAMS
Sbjct: 458  DSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMS 517

Query: 501  IGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFG 560
            + LDK DVDKELIAHG SNF+SG +GS+QNYLVYTNS+LFI+AGAD ++AG +L   T  
Sbjct: 518  LHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAI 577

Query: 561  IMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDF 620
            +M IGPVI+++IP+CIVGSLIFLLGYELL EAL D WGK++NFEY T+V IV TMG FDF
Sbjct: 578  VMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDF 637

Query: 621  VLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKL 680
            VLGIIVGILIACFSFL+DSTKLQTINGE+DG VA+STV RD IQT+FLN IGEQI+VLKL
Sbjct: 638  VLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKL 697

Query: 681  QNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKR 740
            QNLLFFGTIISIEEKID+LLE+  KD+S+ RIKYLILDFKNINADNIDYSAAEGFNRIKR
Sbjct: 698  QNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKR 757

Query: 741  FTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNK 800
            FT +K+I L+ISSIK  D IY+AF+ VG L GVELF+DLNSALEWCENEFL +++ LR+K
Sbjct: 758  FTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDK 817

Query: 801  TKLKAVRK-----------QERQLSKG--------------ALPFNTPRNNHFVSVAQKL 835
             K +  RK           Q+ Q + G              +LP NTPRN+  +SVAQ +
Sbjct: 818  AKSRLHRKQIIDINASIGSQKYQFTAGNDKKSNLDIPRNLMSLPINTPRNHQILSVAQNV 877

Query: 836  F-TDEQSMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFK 894
            F  +EQ++ +LKT  K++ P L LLL  L++YRP I+S +K VKE E K WS+L  +F K
Sbjct: 878  FQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVK 937

Query: 895  RRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISS 954
              LA+QS L H NNIF +VE+G++K T+NL QG +YE +S +TCYG+IT  + +E  + +
Sbjct: 938  LPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKITGQH-NESTLKT 996

Query: 955  VEIKMETDCALWILDXXXXXXXXXXXXXXXXXXXXXXXCMNQDRLKELLGHCLVSS 1010
            + I+ E D  LW++D                        +  +R KELLG+ LVS+
Sbjct: 997  LTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1044 bits (2700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1059 (53%), Positives = 715/1059 (67%), Gaps = 61/1059 (5%)

Query: 5    RPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNP---FSNGADGSPHYYLGRSYVANL 61
            +  N+HS+S+ ISVSLGLQ+Q   +   L  P G P     N +D S   YLGRSYV+  
Sbjct: 4    QKNNRHSISDTISVSLGLQNQ---DPQILQQPNGGPTVTLGNMSDTSN--YLGRSYVSGF 58

Query: 62   SPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFED-------- 113
                 AI    + +    +    ++SIH S +L RQTAA+S +F+    FED        
Sbjct: 59   LSASPAINHDNNNNTLPIANQHLNKSIHASQNLHRQTAAISEDFNNDPTFEDDINMKEYI 118

Query: 114  -QLEDLAENGN----TAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLE 168
              LED A   N    TA   ++      I    + P        + S LLL P     L 
Sbjct: 119  SNLEDDATGNNGKRYTAYYIDNEDRIDNILTEEAEPVTDFYPQDENSRLLLSPIPSDSLL 178

Query: 169  YG-----SIDEFDHQ---------YVSLQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNY 214
             G     SI E + +         Y S++ + + S   +  P      K + T   +  Y
Sbjct: 179  AGENLLPSISEQEQETAQRRRTSAYQSIRHRNSESTEYSSIPTWR---KYIATPSEIIQY 235

Query: 215  VPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFG 274
            +PA I           SYGMIIFPITEP+FSHLGP+G+SMFY+S+++SQ ++S G+S+F 
Sbjct: 236  LPASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMFYISTIISQSIFSGGWSSFP 295

Query: 275  NAVGSEMIEITPFYHSMAASIMASMP-GEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKL 333
              +GSEMIE+TPF+H+MA +I  ++P G  D ++TTT+ CY +SS++TGL F+ LG+L L
Sbjct: 296  CGIGSEMIEVTPFFHTMAFAIKDALPEGSNDDIITTTLFCYVISSMLTGLTFYSLGKLHL 355

Query: 334  GKIVGFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLP 393
            GKIVGFFPRHILIGCIGGVGYFL+ITG EV+TR +KF+Y+  F++ L TD   L +W LP
Sbjct: 356  GKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYTIPFITHLFTDVVTLWQWLLP 415

Query: 394  ALMAVLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTE 453
             L+ V+L++ Q+  +NSLVLP+FYI  L+LFHF+VA+IPSLSL+ LRDSGW+FP   T  
Sbjct: 416  TLLTVILIIAQKCAQNSLVLPSFYILTLILFHFMVAIIPSLSLNQLRDSGWIFPQAATDS 475

Query: 454  HWFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELI 513
             W+D YKL+N   V W L+LKQ+PTMLALTFFGILHVPINVPALAMS+ +D+ DVDKELI
Sbjct: 476  KWYDHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVPINVPALAMSLQMDRYDVDKELI 535

Query: 514  AHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIP 573
            AHG SNF+SGM GS+QNYLVYTNS+LFI+AGAD +LAG +L   T  IM+IGPVI+++IP
Sbjct: 536  AHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAGHILIVLTIIIMIIGPVIISFIP 595

Query: 574  VCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACF 633
            +CIVGSLIFLLGYELL EALVD  GK++ FEY T+V IVFTMG FDFVLG+IVGILIACF
Sbjct: 596  ICIVGSLIFLLGYELLVEALVDPLGKISKFEYITIVIIVFTMGIFDFVLGVIVGILIACF 655

Query: 634  SFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIE 693
            SFL+DSTKLQTINGEFDG VA+STV RD IQT+FLN IGEQI+VLKLQNLLFFGTIISIE
Sbjct: 656  SFLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIE 715

Query: 694  EKIDKLLELSDKDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISS 753
            EKIDKLLE+SD D+SK RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISS
Sbjct: 716  EKIDKLLEISDMDSSKHRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIRLIISS 775

Query: 754  IKTTDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNKTKLKAVRK----- 808
            I+  D IY AFN VG L+GVELF+DLNSALEWCENEFL +++ LR KT+ K   K     
Sbjct: 776  IRERDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFLFKYKTLREKTRQKRKNKIDINL 835

Query: 809  --------QERQL------SKGALPFNTPRNNHFVSVAQKLF-TDEQSMPHLKTHYKEKT 853
                    +ER +      +  +LP NTPRNN  +SVAQ +F  +EQ+   LK  +K + 
Sbjct: 836  AITNGNPTEERNMHLEIPRNIMSLPMNTPRNNQMLSVAQNVFRNEEQAAKALKQQFKNEP 895

Query: 854  PVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVV 913
             VL LLL  L++YRP I+S +K ++E E K WS+L  +  +R L AQS L H NN F +V
Sbjct: 896  SVLPLLLFVLKQYRPRIVSNDKSIEEKEIKFWSQLCPYLSERFLVAQSTLKHNNNFFFIV 955

Query: 914  ESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPIS--SVEIKMETDCALWILDXX 971
            ESG++K T+ L  G LYE +S +TCYG+I   N+    ++   + IK ETDC LW++D  
Sbjct: 956  ESGILKATFTLPSGTLYETMSNRTCYGKILGSNNETTVLNEQDLTIKTETDCNLWVIDMD 1015

Query: 972  XXXXXXXXXXXXXXXXXXXXXCMNQDRLKELLGHCLVSS 1010
                                  +   R KELLG+ LVS+
Sbjct: 1016 ALTRMRAENLELYIELVLLIMSIRDTRFKELLGYTLVSA 1054

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/1064 (51%), Positives = 702/1064 (65%), Gaps = 98/1064 (9%)

Query: 2    GFSRP-RNKHSLSEAISVSLGLQSQPGSETD---------TLSVPRGN------------ 39
            G  RP RN+ S+S AISVSLGL  Q    +D           +  R N            
Sbjct: 4    GVDRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQNDSSSIEIVSP 63

Query: 40   PFSNGADGSPHYYLGRSYVANLSPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTA 99
            PF N  + +   YLG  +++  + P + +++R            +S+SIH S  + RQTA
Sbjct: 64   PFYNSNNYAGRSYLGGGFLS--ASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHRQTA 121

Query: 100  ALSNEF-DGTFEFEDQLEDLAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLL 158
             LSN F D T   E+       N   A+ DE                     N+ + + +
Sbjct: 122  ELSNNFSDDTTGMEE-----VRNRYDAMEDE---------------------NSSLHHYM 155

Query: 159  LPPNTQRDLEYGSIDEFDHQYVSLQSQRAGSNSRAIDPNASMRDKTLFTF-RRLGNYVPA 217
               + Q  L  G+ +++ +   S  ++ +GS              ++  F + + +Y P+
Sbjct: 156  THQDYQT-LPGGTDEDWTNNNNSQTARASGS--------------SIVQFGQDVLHYFPS 200

Query: 218  VIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAV 277
             +           SYGMIIFPITEP+FSHLG +GLSMFY+S+++SQ +YS G S+F + +
Sbjct: 201  AVLGLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGI 260

Query: 278  GSEMIEITPFYHSMAASIMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIV 337
            GSEMIE+TPF+H+MA +I  ++PG+ D ++TTTI CYA+SS++TG+ F+LLG+L+LGKIV
Sbjct: 261  GSEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIV 320

Query: 338  GFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMA 397
            GFFPRHILIGCIGGVGYFL+ITG  VTTR +K EY++EFL  L  D +IL KW LP ++ 
Sbjct: 321  GFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLT 380

Query: 398  VLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFD 457
            +LLV  Q+  +NSLVLP+FYI  L+LFHF+VA++PS+SL  LRD GW+FPA T+ + WFD
Sbjct: 381  ILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFD 440

Query: 458  FYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGY 517
             YKL+++  V W LVL Q+PTMLALTFFGILHVPINVPALA+S+ +DK DVDKELIAHGY
Sbjct: 441  HYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGY 500

Query: 518  SNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIV 577
            SNF+SGM+GS+QNYLVYTNS+LFI+AGAD   AG MLA  TF +MVIGPVIV++IP+CIV
Sbjct: 501  SNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIV 560

Query: 578  GSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLV 637
            GSLIFLLGYELL EAL+DT GK+ NFEY T+V IV TMG +DFVLG+IVGILIACFSFLV
Sbjct: 561  GSLIFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLV 620

Query: 638  DSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKID 697
            DSTKLQTINGEFDG+VARSTV RDY+Q+ FLN +GEQI+VLKLQN+LFFGTIISIEEKID
Sbjct: 621  DSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKID 680

Query: 698  KLLELSD-KDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKT 756
            KLLE++D K +SK+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISSIK 
Sbjct: 681  KLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKE 740

Query: 757  TDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNKTK-------------- 802
             D IY  F+ VG LD VELF+DLN ALEWCENEFL +++ LR++ +              
Sbjct: 741  RDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSYNVTSAIE 800

Query: 803  ---LKAVRKQERQLSK-----------GALPFNTPRNNHFVSVAQKLFTDEQSMPHLKTH 848
                K V     Q+SK            +LP NTPRN+  +SVAQ +F DE+ +  L+  
Sbjct: 801  AAAAKKVPTDNNQISKKNLSLLNFRNLSSLPMNTPRNHQMLSVAQNMFNDEEDVDALEDE 860

Query: 849  Y--KEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHK 906
                 + PVL LLL AL+ YR  I S +  ++E E ++WS+L  +F KRRL  QS+L H 
Sbjct: 861  SCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHN 920

Query: 907  NNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCALW 966
             + F VVESG++K+  +L QG +YE +S +TC G I   +        V I  ETD  LW
Sbjct: 921  QDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLW 980

Query: 967  ILDXXXXXXXXXXXXXXXXXXXXXXXCMNQDRLKELLGHCLVSS 1010
            ++D                        +   R ++LLG+ LVS+
Sbjct: 981  LIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1018 bits (2632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/1040 (50%), Positives = 703/1040 (67%), Gaps = 66/1040 (6%)

Query: 28   SETDTLSV-PRGNPFSNG-ADGSPHYYLGRSYVANLSPPPLAIKERFSGDPTSSSRPEQS 85
            +E+++L+V  R N  + G  +   + +LGRSYV+ +    L      +  P S+     S
Sbjct: 40   NESNSLNVNARPNTKNVGIPNNDTNTFLGRSYVSGILGSSLPQGGERNTLPVSNKF--GS 97

Query: 86   QSIHQSLSLRRQTAALSNEFD-GTF--------EFEDQLEDLAENG----NTAVPDESVM 132
            ++IH+   L RQTAA++ EFD GT         E+ + L++  E      N    D  ++
Sbjct: 98   RAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYLNLLDEAQEEELDLRNRRDLDNDLI 157

Query: 133  AGSAISPTS------SGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYVSLQS-- 184
              +  +P S      + PE   L+   V+  LL P++  +  YGS+   +  ++S  S  
Sbjct: 158  TDNK-TPVSINLKRATDPE---LEQQTVA--LLTPSSSNNDNYGSVSP-EENFLSATSNY 210

Query: 185  -QRAGSNSRAIDPNASMRD-------KTLFTFRRLGNYVPAVIXXXXXXXXXXXSYGMII 236
             Q +   S  + P+A  R        K   T +R+ NY+PA I           SYGMII
Sbjct: 211  EQESTYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPAAILGLLLNILDALSYGMII 270

Query: 237  FPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIM 296
            FPITEP+F+ LGP+G+SMFY+S+++SQ +YS G+S+F + +GSEMIEITPFYH+MA +I 
Sbjct: 271  FPITEPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAIS 330

Query: 297  ASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFL 356
             ++PG  D ++TTTI CY +SS++TGL F+LLG+L+LGKIVGFFPRHILIGCIGGVGYFL
Sbjct: 331  QALPGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFL 390

Query: 357  VITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTF 416
            +ITG EVTTR +KFEYS  FL+ L  D  +L KW LP ++ ++L+V Q+  KNSLVLP+F
Sbjct: 391  IITGLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSF 450

Query: 417  YIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQV 476
            YI  L+LFHF+VA+ P+LSLH LR +GW+FPA   +  W+D Y+ ++     W LV+KQ+
Sbjct: 451  YIITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQI 510

Query: 477  PTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTN 536
            PTMLALTFFGILHVPINVPALAMS+ +DK DVDKELIAHGYSNF SG+ GSVQNYLVYTN
Sbjct: 511  PTMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTN 570

Query: 537  SLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDT 596
            S+LFI+AGAD ++AG +L   T  +MVIGPVI+++IP+CIVGSLIFLLGYELL EA++D 
Sbjct: 571  SVLFIRAGADSAIAGYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDP 630

Query: 597  WGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARS 656
            +GK+  FEYAT+  IV TMG FDFVLGI+VGILIACFSFLVDSTKLQT+NGEFDG VA+S
Sbjct: 631  FGKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKS 690

Query: 657  TVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLI 716
            TV RD+ QT+FL++IGEQI+VLKLQN+LFFGTIISIEEKI++LLE+SD D SK RIK+LI
Sbjct: 691  TVYRDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLI 750

Query: 717  LDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELF 776
            LDFKNINADNIDYSAAEGFNRIKR+T +KRI LIIS+I+ +DRIY  FN+VG L  +ELF
Sbjct: 751  LDFKNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELF 810

Query: 777  DDLNSALEWCENEFLRQFRDLRNKTKLKAVRKQER-------------QLSKG------- 816
            +DLNSALEWCENEFL Q+++LR K + K  R+ +              Q +K        
Sbjct: 811  NDLNSALEWCENEFLYQYKELREKARNKLQRRSKNINAAIGNQLRRYDQTNKNQGPTSSL 870

Query: 817  -----ALPFNTPRNNHFVSVAQKLFTDEQSMP-HLKTHYKEKTPVLHLLLSALQRYRPEI 870
                 +L  NTPRN   VS AQ+ F++EQ +   + T  K   P+L +LL AL+ YRP I
Sbjct: 871  MQNLMSLSNNTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPLLKVLLFALKLYRPNI 930

Query: 871  MSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLY 930
            +S +   +  E + W +L  +F ++   A +   H NN F +V++G++KV YNL  G +Y
Sbjct: 931  VSMDTEKRTDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAGSVY 990

Query: 931  EILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDXXXXXXXXXXXXXXXXXXXXX 990
            E LS  TCYG+I +   +E    ++ +++ETD  LWI+D                     
Sbjct: 991  ETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLL 1050

Query: 991  XXCMNQDRLKELLGHCLVSS 1010
               +   R KELLG+ LVS+
Sbjct: 1051 ILAIRDTRFKELLGYTLVSA 1070

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/1049 (52%), Positives = 714/1049 (68%), Gaps = 65/1049 (6%)

Query: 2    GFSRPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADG--SP-HYYLGRSYV 58
            G  R R +HS+SEAISVSLGLQ+   +  D       NP+ +  D   SP + YLGRSYV
Sbjct: 8    GGPRNRGRHSISEAISVSLGLQNT-NTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYV 66

Query: 59   AN-LSPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQLED 117
            +  LS  P         D    +R  +++SIH + +L RQTA L  +F+     ++ ++D
Sbjct: 67   SGFLSCSPYG-SNSLESDRLPIAR-MRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNNIQD 124

Query: 118  LAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSI----D 173
                                   S+  EP  ++ +D   +    +  R+  + +     D
Sbjct: 125  YV---------------------SATEEPRPMEISDAERMYDQEDELRNPVHVNTEDRGD 163

Query: 174  EFDHQYVSLQSQRAGSNSRAI--DPNASMRDKTLFTFRR--------LGNYVPAVIXXXX 223
            + +  Y SL +   G   RAI   P   +R  +     R        L +Y+PA I    
Sbjct: 164  DIEDVYESLVTGAHGG-YRAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATILGLL 222

Query: 224  XXXXXXXSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIE 283
                   SYGMIIFPITEP+FSHLGPSGLSMFY+S+++SQ++YS GFS F   VGSEMIE
Sbjct: 223  LNVLDGLSYGMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIE 282

Query: 284  ITPFYHSMAASIMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRH 343
            +TPF+HSMA +I  ++PG  D +LTTTI CY +SS++TGL F++LG++KLGKIVGFFPRH
Sbjct: 283  VTPFFHSMALAIKDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRH 342

Query: 344  ILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVI 403
            ILIGCIGGVGYFLV+TG EVTTR +K EY++ F+S + TD   L KW LP L+ VLL+V 
Sbjct: 343  ILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSTLVKWVLPVLLTVLLIVT 402

Query: 404  QRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYN 463
            QR  +NSLVLPTFYIA L+ FHF+VA+IP++SL  LR+ GW+FP   + + W+D YKL+ 
Sbjct: 403  QRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQ 462

Query: 464  FKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSG 523
               V W L+ KQ PTMLAL+FFGILHVPINVPALA+S+ +DK DVDKELIAHGYSN LSG
Sbjct: 463  PHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSG 522

Query: 524  MIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFL 583
             +GS+QNYLVYTNSLLFI+AGAD ++AG +LA  TF +MVIGPVI++YIP+CIVGSLIFL
Sbjct: 523  ALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFL 582

Query: 584  LGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQ 643
            LGYELL EAL++T GK+ NFEY T+  IV TMG FDFVLG+IVGILIACFSFLVDSTKLQ
Sbjct: 583  LGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQ 642

Query: 644  TINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELS 703
            TINGE+DG++A+STV RDY+Q++FL+ IGEQI+VLKLQ+LLFFGTIISIEEKI+KLLE+S
Sbjct: 643  TINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEIS 702

Query: 704  -DKDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYR 762
             D+  SK+RIK LILD KNINADNIDYSAAEGFNRIKRFT SK I LIISSI  TD IY 
Sbjct: 703  DDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYT 762

Query: 763  AFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNKTK-------------------- 802
            AF+KV  LD VELF DLN ALEWCENE L ++++LR K +                    
Sbjct: 763  AFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARDRLQNKMQMANLAANNDTKA 822

Query: 803  LKAVRKQERQLSKGALPFNTPRNNHFVSVAQKLFTDEQ-SMPHLKTHYKEKTPVLHLLLS 861
            +  V K     +  +LPFNTPRN+  +SVAQ++F +EQ ++  LK +YKE  PVL LLL 
Sbjct: 823  IDGVPKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKELPPVLPLLLF 882

Query: 862  ALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVT 921
            AL+ YRP I+S +  VK +E ++WS+L  +F +RRLA+QS+L H ++IF V+E+G++K+ 
Sbjct: 883  ALKPYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIV 942

Query: 922  YNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDXXXXXXXXXXXX 981
            Y+L QG +YE LS +TCYG +  P +     S V IK ET+  LW++D            
Sbjct: 943  YDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENL 1002

Query: 982  XXXXXXXXXXXCMNQDRLKELLGHCLVSS 1010
                        + + R +++LG+ LVS+
Sbjct: 1003 SLYTELILLIATVKEQRYRQILGYTLVSA 1031

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score = 1014 bits (2621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/1032 (51%), Positives = 694/1032 (67%), Gaps = 79/1032 (7%)

Query: 52   YLGRSYVANLSPPPLAIKERFS-----------GDPTSSS-RPEQSQSIHQSLSLRRQTA 99
            YLGRSYV +   PP+  +   +           GDP  S    E S+ IH+S +L +QTA
Sbjct: 33   YLGRSYVGSFISPPMEYRSNSNTTSNNNNNSNVGDPFKSPFSSEGSKLIHESGNLHKQTA 92

Query: 100  ALSNEFDGT----------FEFEDQLEDLAENGNTAVPDESVMAGSA------------- 136
             LSN FD             +  D   +L +N    + +E  M  ++             
Sbjct: 93   FLSNTFDNDAGNDEGAGFPLDGNDDEFNLEQNDIDMIVEEDQMLQNSQRRRGRMSVDAAA 152

Query: 137  -----------------------ISPTS--SGPEPSVLDNTD-VSNL-LLPPNTQRDL-- 167
                                   I  TS     + S LD +D   NL LLP N+   +  
Sbjct: 153  DIEADAHLMDLEDMALKRADDVGIFSTSFPGKDDSSFLDVSDSTENLALLPTNSHNSMYV 212

Query: 168  EYGSIDEFDH---QYVSLQSQRAGS---NSRAIDPNASMRDKTLFTFRRLGNYVPAVIXX 221
            EYG+ DE +    QY+SL    A S    S+    + S  DK      R+  Y PAV   
Sbjct: 213  EYGTFDEENQPATQYISLLPDGASSGGFTSQGFRSSMSHYDKARDLMLRIFQYTPAVGLG 272

Query: 222  XXXXXXXXXSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEM 281
                     SYGMIIFPITEPLFSHLGP+GLSMFY+S+V+ QL +S G S+F +A+GSEM
Sbjct: 273  LLLNILDALSYGMIIFPITEPLFSHLGPTGLSMFYVSTVICQLCFSLGLSSFPSAIGSEM 332

Query: 282  IEITPFYHSMAASIMASMP-GEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFF 340
            IEITPF+H+MA SIM S+P G  ++V++TTIVCYA+SSI+TGL FFLLG+++LGKIVGFF
Sbjct: 333  IEITPFFHTMALSIMNSIPEGNDNKVISTTIVCYALSSIITGLTFFLLGKMRLGKIVGFF 392

Query: 341  PRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLL 400
            PRHILIGCIGGVGYFL+ITG EV TR  +F+YS++FLSSL TD +IL KW  P ++ ++L
Sbjct: 393  PRHILIGCIGGVGYFLIITGLEVCTRVPEFKYSWQFLSSLFTDFDILLKWLTPVILTLIL 452

Query: 401  VVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYK 460
            + +Q    NSLVLP+FYI  LLLFHF+VAL+PSLSL  LRD GW+F      E+W+DFYK
Sbjct: 453  ISVQSRIHNSLVLPSFYIITLLLFHFVVALVPSLSLDKLRDFGWIFAKVNAKENWYDFYK 512

Query: 461  LYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNF 520
            LY+FK V W L+ KQVPTMLALTFFGILHVPINVPALAMS+ +DK DVDKELIAHGYSN 
Sbjct: 513  LYDFKNVQWSLIPKQVPTMLALTFFGILHVPINVPALAMSLNVDKYDVDKELIAHGYSNL 572

Query: 521  LSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSL 580
            +SG +GS+QNYLVYTNS+LFI+AGAD  +AG+ML   TF +MVIGPVI+++IP+CIVGSL
Sbjct: 573  ISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMVIGPVIISFIPICIVGSL 632

Query: 581  IFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDST 640
            IFLLGYEL++EA++DTWGKL  FEY T+  IV TMG  DFV+GIIVGIL+ACFSFLV+ST
Sbjct: 633  IFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMGVVDFVIGIIVGILLACFSFLVNST 692

Query: 641  KLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLL 700
            +LQTINGE+DG+VA+STV RDYIQ++FL  IGEQI+VLKLQN+LFFGTIISIEEK++ LL
Sbjct: 693  QLQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIYVLKLQNILFFGTIISIEEKVNSLL 752

Query: 701  ELSDKDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRI 760
            E+ + D+SKKRIKYLILDFKNI A +IDYSAAEGFNRIKRF   +RIHLIISSI   D+I
Sbjct: 753  EICESDSSKKRIKYLILDFKNIRAKSIDYSAAEGFNRIKRFLEKERIHLIISSIDKEDQI 812

Query: 761  YRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNKT---KLKAVRKQERQLSKGA 817
            Y AF+KV   + VELF DLN ALEWCENEFL +++ +R KT   KL  ++K + ++SK  
Sbjct: 813  YLAFDKVRLFENVELFSDLNGALEWCENEFLMRYKRIRTKTRARKLAQLKKSQNRMSK-- 870

Query: 818  LPFNTPRNNHFVSVAQKLFTDEQSMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEKPV 877
            LP NTPRN+ FVS  + ++T+E  +  L    KE+   L + L +++++R  I SP +  
Sbjct: 871  LPVNTPRNHQFVSEVRNIYTEEMEIQKLSNELKERQQFLPIFLMSIRKFRNAIQSPNELK 930

Query: 878  KETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKT 937
            +  E  +W  L  +F +++    + + H+NN+F+VVESG++ +T++L QG+ YE +S KT
Sbjct: 931  RTNELDLWKRLISYFQQKKFPPNTEIRHRNNMFIVVESGVLNLTHHLIQGEFYETMSPKT 990

Query: 938  CYGRITAPNSSEVPISSVEIKMETDCALWILDXXXXXXXXXXXXXXXXXXXXXXXCMNQD 997
             YG I+  NS  + +S   I  +T+C L  +D                        +++D
Sbjct: 991  AYGVISNVNSDPLAVS---ITTDTECVLRYIDAESLADLKLTDPELFTELLILVMAIHRD 1047

Query: 998  RLKELLGHCLVS 1009
            R +ELLG+ L+S
Sbjct: 1048 RFRELLGYSLIS 1059

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/1061 (51%), Positives = 703/1061 (66%), Gaps = 70/1061 (6%)

Query: 4    SRPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYY-------LGRS 56
            S  R + S SEA+SVSLGL  Q      T S    N +S   D +           +GRS
Sbjct: 13   SNRRVRPSFSEALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNTTSSVSNREFGRIGRS 72

Query: 57   YVANLSP--PPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQ 114
            Y  ++S   P L +    + D     R   S+SI    +L RQTA +SN+F+ T   E +
Sbjct: 73   YAGSISSNSPSLYLNTSRT-DELLPIRKMPSKSILGPDALHRQTAEISNDFNDTSMDEAK 131

Query: 115  LEDLAENGN------------TAV---PDESVMAGSAISPTSSGPEPSVLDNTDVSNLLL 159
            ++   E  N            +AV   P   +   S +SP   G   S LD  +   LL 
Sbjct: 132  IKRYIELLNRKQIEAEEEGEESAVHLRPHTFIEGKSFLSPI--GSSASQLDGLEQRALLT 189

Query: 160  PPNT----QRDLEYGSIDEFDHQYVSL---QSQRAGSNSRAIDPNASMRDKTLFTFRRLG 212
            P ++    + DLE  + DE ++ Y S+   QS+   S+S A         K L     L 
Sbjct: 190  PSSSIVGNEFDLE-STYDEINNDYNSILRIQSRELTSSSFAT--------KGL----ELL 236

Query: 213  NYVPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSA 272
            NY+PA I           SYGMIIFPITEPLFS LGP+G+SMFY+S++V QLV S GFS+
Sbjct: 237  NYLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYISTIVCQLVLSGGFSS 296

Query: 273  FGNAVGSEMIEITPFYHSMAASIMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLK 332
            F   +GSEMIEITPFYH+MA +I  ++P + + V+TTTI CY +SS++TGLVFF+LG+LK
Sbjct: 297  FPCGIGSEMIEITPFYHTMAFAIKDALPNQDNEVITTTIFCYVISSVVTGLVFFMLGKLK 356

Query: 333  LGKIVGFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGL 392
            +GKIVGFFPRHILIGCIGGVGYFL+ITG EV+TR  KFEY++EFL SLLT+ + LGKW L
Sbjct: 357  MGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEFLLSLLTNLDTLGKWLL 416

Query: 393  PALMAVLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTT 452
            P L+ + L++IQR  +NSLVLP+FYI  ++LFHFIVA++P+LSL  LR++GW+FP T + 
Sbjct: 417  PTLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSLDHLRENGWIFPVTDSK 476

Query: 453  EHWFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKEL 512
              W+D YK +N   + W LVLKQ+PTMLALTFFGILHVPINVPALAMS+ +DK DVD+EL
Sbjct: 477  NSWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPALAMSLHMDKYDVDREL 536

Query: 513  IAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYI 572
            IAHGYSN +SG++GSVQNYLVYTNS+LFI+AGAD S AG +L A T  +MV G VIV++I
Sbjct: 537  IAHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVALTVVVMVAGSVIVSFI 596

Query: 573  PVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIAC 632
            PVCIVGSLIFLLGYEL+ EALVDT G + +FEY T++ IVF MG +DFVLGIIVGILIAC
Sbjct: 597  PVCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMGIYDFVLGIIVGILIAC 656

Query: 633  FSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISI 692
             SF+VD TKL+TINGE+DGQVA+STV RDYIQT+FLN I +QI++LKLQN+LFFGTIISI
Sbjct: 657  LSFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLKLQNVLFFGTIISI 716

Query: 693  EEKIDKLLELSDKDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIIS 752
            EEKIDKLLE+SDKD SK+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT  KRI LIIS
Sbjct: 717  EEKIDKLLEISDKDPSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQGKRIQLIIS 776

Query: 753  SIKTTDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNKTKLKAVRKQERQ 812
            SIK  D+IY  FN V  L+ VELFDDLNSALEWCENEFL Q+  L  K K +  ++    
Sbjct: 777  SIKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYMQLHEKAKDRIHKRISIS 836

Query: 813  LSKG----------------------ALPFNTPRNNHFVSVAQKLFTDE-QSMPHLKTHY 849
               G                      +LP NTPRNN  +SVA+K+F +E Q+    KTH 
Sbjct: 837  KDSGSTYFSRNRSDSGLSAADQQMLMSLPINTPRNNQVLSVARKVFKNEAQTASKFKTHN 896

Query: 850  KEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNI 909
            +   PVL LLL +++ +RP++ S +  ++E E   W +L  +F +      S L + +N 
Sbjct: 897  ETDKPVLSLLLYSIRLFRPDVFSEDVSIREKEINFWGQLSPYFRRSLFPTGSTLVNSSNF 956

Query: 910  FLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILD 969
            F VVESG+V+VT++L QG + E +S +TCYG++     +   +  +  K ET+  +W++D
Sbjct: 957  FFVVESGVVRVTHDLPQGIVSETMSNRTCYGKVVGHRGTVTNLPKIIFKTETESIIWMID 1016

Query: 970  XXXXXXXXXXXXXXXXXXXXXXXCMNQDRLKELLGHCLVSS 1010
                                    + + R K L+G+ LVS+
Sbjct: 1017 DDTMSRIKKENLNLYTELLLLVMTIREYRYKGLIGYTLVSA 1057

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score =  983 bits (2542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/1102 (49%), Positives = 700/1102 (63%), Gaps = 106/1102 (9%)

Query: 1    MGFSRPRN-----KHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYYLGR 55
            MG S+        + S+SE+ISVSLGLQ+    ++D       NP       S   YLGR
Sbjct: 1    MGMSKAHRIKRPARQSISESISVSLGLQNNDARQSD-----NENPLQVLPGESS--YLGR 53

Query: 56   SYVANL-SPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEF-DGTFEFED 113
            SYV+ L SP     K  +   PTS+ +   S+ IH+S  L RQT A+   F D   +   
Sbjct: 54   SYVSGLWSPTQRNNKSGYDLLPTSNEQA-YSKPIHKSQMLHRQTQAIGENFSDSNGDEGS 112

Query: 114  QLEDLAENGNTAVPDESVMAG----SAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEY 169
            + +DL E  +    +E   A       I   ++GP+ +V  N        P  +    EY
Sbjct: 113  ENKDLNEYIDLVEHNERKTANIDNVDQIGGLATGPQTTVPGNKT-----HPVTSPLSDEY 167

Query: 170  GSIDEFDHQYVSLQSQ------------------RAGSNSRAIDPNASMRDKTLFTFRRL 211
            G  DE     ++  S                   RA S    I+     +  TL ++   
Sbjct: 168  GIPDENSRLLLTPVSSLSVAISDASSLTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSA 227

Query: 212  G----------------------NYVPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGP 249
            G                      +Y+PA I           SYGMIIFPITEP+FS LGP
Sbjct: 228  GMKIGPPITSKWDYISALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGP 287

Query: 250  SGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMPGE-KDRVLT 308
            SGLSMFY+S+V+SQ  YS G+S+F   +GSEMIE+TPF+H+MA +IM ++  E K+ ++T
Sbjct: 288  SGLSMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIIT 347

Query: 309  TTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVTTRAS 368
            TTI CY +SS+ TGL FF LG+LKLGK+VGFFPRHILIGCIGGVGYFL+ITG EV TR +
Sbjct: 348  TTIFCYVISSMFTGLTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIA 407

Query: 369  KFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAALLLFHFIV 428
            KFEYS  FL +L TD + L +W LP ++ ++L+  Q   +NSLVLP+FYI  L+LFHFIV
Sbjct: 408  KFEYSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIV 467

Query: 429  ALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGIL 488
            A++P+LSL  LR+SGW+FP   +   W+D YK +NF  V W LV+KQ+PTM+ALTFFGIL
Sbjct: 468  AIVPNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGIL 527

Query: 489  HVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDS 548
            HVPINVPALAMS+ +DK DVD+ELIAHGYSNF SG+ GS++NYLVYTNS+LFI+AGAD +
Sbjct: 528  HVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSA 587

Query: 549  LAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATV 608
            LAG +L   T  +M+IGPVI+++IP+CIVGSLIFLLGYELL EALVDTWGKLN FEY TV
Sbjct: 588  LAGYILIVLTIIVMLIGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTV 647

Query: 609  VAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFL 668
              I+ TMG FDFVLGIIVGILIACF FL+DST LQT+NGEF G+VA+STV RD IQT FL
Sbjct: 648  GIIILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFL 707

Query: 669  NKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFKNINADNID 728
            + +GEQI+VLKLQNLLFFGTIISIEEKIDKLLE+S+ D+SK+RIKYLILDFKNIN DNID
Sbjct: 708  DGVGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNID 767

Query: 729  YSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSALEWCEN 788
            YSAAEGFNRI+RFT +K I LIISSI+  D IYRAFN VG L+ VELF DLNS+LEWCEN
Sbjct: 768  YSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCEN 827

Query: 789  EFLRQFRDLRNKTKLKAVRK---------------QERQLSKGA---------------- 817
            E L  + +LR K K + +RK                 +Q+   A                
Sbjct: 828  ELLHWYNELRTKAKAR-LRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLM 886

Query: 818  -LPFNTPRNNHFVSVAQKLF-TDEQSMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEK 875
             LP NTPRN+  ++VAQ +F  DEQ++  L+   K K P+L LLL  L++YRP+I S +K
Sbjct: 887  SLPTNTPRNHQMLTVAQDVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQYRPDIGSNDK 946

Query: 876  PVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSG 935
              ++ E  +WS L  +F K+ + AQ+ L H N IF +V++G++K  + L QG +YE ++ 
Sbjct: 947  LARDKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMAN 1006

Query: 936  KTCYGRIT-------APNSSEVPISSVEIKMETDCALWILDXXXXXXXXXXXXXXXXXXX 988
            +TCYG+I          ++S    S + I  ETD  LW++D                   
Sbjct: 1007 RTCYGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLA 1066

Query: 989  XXXXCMNQDRLKELLGHCLVSS 1010
                 +   R K+LLGH L+S+
Sbjct: 1067 LLVMLIKDKRFKDLLGHALISA 1088

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/907 (53%), Positives = 634/907 (69%), Gaps = 35/907 (3%)

Query: 128  DESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYVSLQSQRA 187
            DE ++     S     P PS+ D+    N L   ++     Y S D  ++ Y+S     +
Sbjct: 255  DEDIIDNDEYSRLLPTPSPSIYDD---ENALFFSSSNN---YDSTDLENNNYIS----SS 304

Query: 188  GSNSRAIDPNASMRDKTLFTFRRLG--NYVPAVIXXXXXXXXXXXSYGMIIFPITEPLFS 245
               +  +  + S+  K + T   L   + +PA I           SYGMI+FPIT+ +F 
Sbjct: 305  IPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFPITDSVFG 364

Query: 246  HLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMPG-EKD 304
            HLGP+GLSMFY+S+++SQLVYS GFSAF + +G EMIEI PF+H+MA ++  S+P  +++
Sbjct: 365  HLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQN 424

Query: 305  RVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVT 364
             ++TTTI CY +S I TG+VFF LG+ KLGK+VGFFPRHILIGCIGGVGYFL++TG EVT
Sbjct: 425  EIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVT 484

Query: 365  TRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAALLLF 424
            TR  K EYS EFL S++T+   L K  LP  ++VLL ++Q+   +SL+LP+FYI   + F
Sbjct: 485  TRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAF 544

Query: 425  HFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTF 484
            HFIVAL+P+LSL SLR +GW+FP   +++ W+  YK +NF    W LV KQ+PTM ALTF
Sbjct: 545  HFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTF 604

Query: 485  FGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAG 544
            FGILHVPINVPALAMS+ +DK DVDKELIAHGYSN +SG+ GSVQNYLVYTNS+LFI+AG
Sbjct: 605  FGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAG 664

Query: 545  ADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFE 604
             + + AGL+LA  T  I+ IGPVI+++IPVCIVGSLIFLLG+EL+ EAL+DTWGK+  FE
Sbjct: 665  GNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFE 724

Query: 605  YATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQ 664
            Y T++ IVFTMG +DFVLGI+VGILIACFSFLVDSTKLQT+NGEF+G VA+STV RDY+Q
Sbjct: 725  YITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQ 784

Query: 665  TQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFKNINA 724
            +QFL+ I EQI+VLKLQN+LFFGTIISIEEKID LLE+SD D+SK+RIKYLILD KN+N+
Sbjct: 785  SQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNS 844

Query: 725  DNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSALE 784
            DNIDYSAAEGFNRIKRFT SKRI LIISSIK TD+IY+ FN V  L+ VELF DLN ALE
Sbjct: 845  DNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDLNGALE 904

Query: 785  WCENEFLRQFRDLRN---------KTKLKAVRK-----------QERQLSKGALPFNTPR 824
            WCENEFL Q+R ++N          T    VR             +R+ S G LP NTPR
Sbjct: 905  WCENEFLYQYRQVKNKARARAKRKATSRDVVRTGYLSTSVSNTLNDRK-SSGNLPINTPR 963

Query: 825  NNHFVSVAQKLFTD-EQSMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEK 883
            N+  VSVA+ +F + EQ +    T+  +  PVL LL+ AL++YR +I S +  V++ E +
Sbjct: 964  NHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDKEVE 1023

Query: 884  MWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRIT 943
             WS+L  +F K+ LA ++ L H NN+F +VESG++K+ +NL QG +YE +S +TCYGRI 
Sbjct: 1024 FWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYGRIL 1083

Query: 944  APNSSEVPISSVEIKMETDCALWILDXXXXXXXXXXXXXXXXXXXXXXXCMNQDRLKELL 1003
                 +   S + IK ETDC +W+++                        +  DR   LL
Sbjct: 1084 GKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLLVMSVKDDRFNNLL 1143

Query: 1004 GHCLVSS 1010
            G+ L+S+
Sbjct: 1144 GYALISA 1150

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 70/171 (40%), Gaps = 45/171 (26%)

Query: 4   SRPRNKHSLSEAISVSLGLQSQPGSET-----------DTLSVPRG--------NPFSNG 44
           +R RNK  LSEAIS+SLGLQ Q G++             TL+  R         +P  + 
Sbjct: 13  NRERNK--LSEAISISLGLQEQQGNDNDKYNNDNSNIHGTLNNSRQRRKPSISLDPTLSR 70

Query: 45  ADGSPHY----YLGRSYVANLSPPPLAIKERF---------------SGDPTSSSRPEQS 85
             G+  +    +L RS   NL    +     F               + D      P   
Sbjct: 71  NIGARSFNCGAFLSRSIDNNLPTTDMFNSSTFRSSNSNNYFTHGLNSNNDHLPVINPFPK 130

Query: 86  QSIHQSLSLRRQTAALSNEFDGTFEFEDQLEDLAENGNTAVPDESVMAGSA 136
            SIH S +L ++TA +SNEF+ +       ED  +N NT  P+    A S+
Sbjct: 131 SSIHGSDNLHKRTAEISNEFNNS---PTDTED--DNANTETPNIPSTAQSS 176

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1067 (48%), Positives = 688/1067 (64%), Gaps = 89/1067 (8%)

Query: 7    RNKHSLSEAISVSLGLQSQPG-SETDTLSVPRGNPF------SNGADGSPHYYLGRSYVA 59
            R   S SEA+SVSLGLQ Q     T+  +V R   F      S  +   P     ++   
Sbjct: 9    RVSSSFSEALSVSLGLQEQGNLRSTERANVKRNAIFDEFPLESTNSLTLPDSMSMKNNTV 68

Query: 60   NLSP---PPLAIKERFSGDPTSSSRPEQSQSIHQSLS----LRRQTAALSNEF-DGTFEF 111
            N++    P  +    F  D   S  P ++++  +S++    L RQTA LS  F D  F  
Sbjct: 69   NINDKLVPDNSKNRTFYND---SIYPPENKTSMKSITVADILHRQTAELSKTFYDSNFTD 125

Query: 112  EDQLE--DLAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNL------------ 157
            +D  +  D+ +N          +A S  S ++S PEP + D  D   L            
Sbjct: 126  KDVKDYIDIIDND---------VATSNESDSNSTPEPYLGDEYDQHRLAIRTQKSPNIAD 176

Query: 158  -----LLPPNT-----QRDLEYGSIDEFDHQYVSLQSQRAGSNSRAIDPNASMRDKTLFT 207
                 LL P++     + DLE    DEF+   +   S    + S+ ID            
Sbjct: 177  DEQSRLLTPSSSIIGAELDLE-AHYDEFEPVRMDASSINRQNESKLID------------ 223

Query: 208  FRRLGNYVPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYS 267
            F ++ +Y PA +           SYGMIIFPITEP+F+++G +G+SMFY+SS++ Q + S
Sbjct: 224  FSQILHYFPAAVLGLLLNILDALSYGMIIFPITEPIFANMGTAGISMFYISSIICQYILS 283

Query: 268  CGFSAFGNAVGSEMIEITPFYHSMAASIMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFL 327
             GFS+F   +GSEMIEITPFYH+MA +I  S+  +++ +++TTI CY +SS++TGLVF+ 
Sbjct: 284  GGFSSFPTGIGSEMIEITPFYHTMALAIKNSLDVQEE-IISTTIFCYVISSLVTGLVFYS 342

Query: 328  LGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEIL 387
            LG+LKLGKIV FFPRHILIGCIGGVGYFLV+TG EVTTR +K EYS+EFLS LL+D  I+
Sbjct: 343  LGKLKLGKIVAFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKVEYSWEFLSYLLSDFNII 402

Query: 388  GKWGLPALMAVLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFP 447
            GKW  P L+  +L+  Q   +NSLVLP+FYI  ++LFHFIVAL+P LSL+ LRDSGW+FP
Sbjct: 403  GKWLTPILLTTILIFTQHHFQNSLVLPSFYIITIILFHFIVALVPMLSLNKLRDSGWIFP 462

Query: 448  ATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLD 507
             T + + WFD YK +N   VSW L+LKQ+PTMLALTFFGILHVPINVPALAMS+ +DK D
Sbjct: 463  LTNSNDKWFDHYKYFNVYNVSWVLILKQMPTMLALTFFGILHVPINVPALAMSLNIDKFD 522

Query: 508  VDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPV 567
            VD+E IAHGYSNFLSG+ GSVQNYLVYTNS+LFI+AGAD  +AG +L   T  +M+IGPV
Sbjct: 523  VDREFIAHGYSNFLSGLFGSVQNYLVYTNSVLFIRAGADSPIAGYLLIVLTAIVMLIGPV 582

Query: 568  IVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVG 627
            I+++IP+CIVGSLIFLLGYELL EAL+DT GK+  FEY T++ IVFTMG +DFVLGIIVG
Sbjct: 583  IISFIPICIVGSLIFLLGYELLIEALLDTVGKVTFFEYTTIIIIVFTMGIYDFVLGIIVG 642

Query: 628  ILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFG 687
            IL+AC  F+VD TKLQTIN E+DG +A+STV RD+IQ++FL+ IGEQI+++KLQN+LFFG
Sbjct: 643  ILLACIKFMVDGTKLQTINTEYDGTIAKSTVYRDFIQSKFLDGIGEQIYLIKLQNVLFFG 702

Query: 688  TIISIEEKIDKLLELSDKDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRI 747
            TIISIEEKID LL+LSD D+SK RI+YLILDFKNIN DNIDYSAAEGFNRIKRFT  + I
Sbjct: 703  TIISIEEKIDTLLQLSDSDSSKHRIRYLILDFKNINDDNIDYSAAEGFNRIKRFTHGRHI 762

Query: 748  HLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNKTK----- 802
             LIISSI  TD+IY+AFNK+G L  +ELF DLN+ LEWCEN++L ++R+L  K K     
Sbjct: 763  KLIISSITHTDKIYKAFNKIGLLQDIELFSDLNNGLEWCENKYLEKYRELHEKAKKRLHS 822

Query: 803  ----LKAVRKQERQLSKG--------------ALPFNTPRNNHFVSVAQKLFTDE-QSMP 843
                L+      RQ++                +LP NTPRN+  +SVA+ +F +E Q++ 
Sbjct: 823  RMSILQDKNISSRQINSTSSDGNEYQSSQRLMSLPLNTPRNHQLLSVARNVFKNETQAVS 882

Query: 844  HLKTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLL 903
              K     +     LLL +++R+RP++ S  K ++  E K W++L  +F K  +   S  
Sbjct: 883  RFKNLDNGEDAFTQLLLQSIRRFRPDVFSESKDIRAQEIKFWTQLAPYFNKIFVETNSTF 942

Query: 904  PHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDC 963
             ++NN F +++SG++KVT++L  G+L E +  +T YG +++ N+       V    ET  
Sbjct: 943  LNENNFFFLLDSGVIKVTHDLAPGKLSETMLSRTSYGILSSKNNRTYKTHKVTFIPETKS 1002

Query: 964  ALWILDXXXXXXXXXXXXXXXXXXXXXXXCMNQDRLKELLGHCLVSS 1010
             +W++D                        ++  R K LLG+ LV++
Sbjct: 1003 VIWLIDSEGLKKMEKENLKLYSELTLLIMSISDYRFKALLGYTLVNA 1049

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1035 (50%), Positives = 675/1035 (65%), Gaps = 55/1035 (5%)

Query: 3    FSRPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADG--SPHYYLGRSYVAN 60
            FS   ++ S+SEA+++ L +   P    +      G P S        P  YLGRSYV +
Sbjct: 7    FSAWSHRPSISEALNIQLNIPDSPSGGANA-----GGPVSERIPTLMRPEAYLGRSYVGS 61

Query: 61   LS-PPPLAIKERFSGDPTSSSRP----EQSQSIHQSLSLRRQTAALSNE---FDGTFEFE 112
             S    L  +E  +  P S   P    + S  +H    L RQTAAL ++   +DG  E E
Sbjct: 62   FSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEE 121

Query: 113  DQLEDLAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLP-----PNTQRDL 167
               E L   GN       ++   A      GP      ++++S +LL       ++  D 
Sbjct: 122  ---EALVFEGNM------ILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQ 172

Query: 168  EYGS-------IDEFDHQYVSLQSQRAGSN--SRAIDPNASMRDKTLFTFRRLGNYVPAV 218
            E G+         ++ H Y ++  +++ S   SRA    + +R     T R    Y+PAV
Sbjct: 173  EAGTRLFLSPITTDYIHSYGAINEEQSASETASRAETGPSPLRLWGTRTVR----YIPAV 228

Query: 219  IXXXXXXXXXXXSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVG 278
            I           SYGMIIFPI EP+FSHLGP GLSMFY+S+++SQLVYS GFS+FG   G
Sbjct: 229  ILGLLLNILDALSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVYSGGFSSFGYGTG 288

Query: 279  SEMIEITPFYHSMAASIMASMPGEK-DRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIV 337
            SEMIE+TPF+H+MA SI  S+  EK D ++TTTIVCYA+S+I+TG VF  LG+L+LGK+V
Sbjct: 289  SEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLV 348

Query: 338  GFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMA 397
             FFP HILIGCIGGV YFL+ITG EV+TR +KFEYS  FL +L  DP+IL KW +PAL+A
Sbjct: 349  SFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLA 408

Query: 398  VLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFD 457
            V ++++QR   NS++LP FY++A  LFHFIVALIPSLSL +LRD GW+FP T +   W+D
Sbjct: 409  VSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYD 468

Query: 458  FYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGY 517
            + +LYN + + W LVL ++PTMLALTFFGILHVPINVPALA+S G+DK+DVDKELIAHGY
Sbjct: 469  YLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGY 528

Query: 518  SNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIV 577
            SN  SG  GS+QNYLVYTNS+LFI+AGAD   AG +LA ATF  M  GP I++ IPVCIV
Sbjct: 529  SNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWIISIIPVCIV 588

Query: 578  GSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLV 637
             SLIFLLGYELLKE L D++ +L+NFEY TVV I+ TMG FDFVLGIIVG+L+ACFSFLV
Sbjct: 589  SSLIFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLV 648

Query: 638  DSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKID 697
            +ST+ +TI+ EFDG+VA+S   RDY+Q+ FL K+ EQI+VLKLQN LFFGTIISIEEKI 
Sbjct: 649  ESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIG 708

Query: 698  KLLELSDKDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTT 757
             LLE  +    KK IKYLILDFK+IN DNIDYSAAEGFNRIKR    KRI LI+SSI   
Sbjct: 709  NLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISEC 767

Query: 758  DRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNKTKLKAVRKQERQL-SKG 816
            D+IY  F+K+G L  VELF DLNSALEWCENE L ++R L ++     VR++ + +  K 
Sbjct: 768  DKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSKDIVPKA 827

Query: 817  ALPF-NTPRNNHFVSVAQKLFTDEQSMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEK 875
             +P  NTPRN   ++ AQ +++ EQ +    + YK   P L LLL AL+ YR        
Sbjct: 828  QIPLENTPRNAQIMTAAQAVYSGEQQLNKTLSKYKASHPALALLLVALKTYR-----SGH 882

Query: 876  PVKETEE-KMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILS 934
              KET+E ++W  L  +F ++  + Q+ +  + ++F VVESG++K+TY L QG L E ++
Sbjct: 883  AYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIA 942

Query: 935  GKTCYGRITAPNSSEVPISSVEIKMETDCALWILDXXXXXXXXXXXXXXXXXXXXXXXCM 994
             KTCYG I+ P S  +  SSV ++ ET+C LW++D                        +
Sbjct: 943  SKTCYGNISGPGS--LSYSSV-VRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISV 999

Query: 995  NQDRLKELLGHCLVS 1009
             Q R KELLGH L++
Sbjct: 1000 IQHRFKELLGHSLIN 1014

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 125/286 (43%), Gaps = 23/286 (8%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL+A G+ N +  + G++ ++  Y  S +   +GA   ++G+ +   T   M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGI 628
           V YIP C++  +  ++G  LL+E   D    L    Y+ +     T G    +  I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGV-TILCSIEAGI 516

Query: 629 LIACFSFLVDSTKLQTING-EFDGQVARS---TVRRDYIQTQFLNKIG--------EQIH 676
            I C   +++  K    +  +   +VA +   T   DY++T   N +G        E   
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQILARVAGTSNFTNLDDYLRTMKKNPLGGENRLEEVEGCM 576

Query: 677 VLKLQNLLFFGTIISIEEKIDKLLELSDKDA--------SKKRIKYLILDFKNINADNID 728
           ++++   L F     +++++D++                SK  IKY+I D   + +  ID
Sbjct: 577 IVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--ID 634

Query: 729 YSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVE 774
            SAA+  + I      + + + ++++   D+I     K G +  +E
Sbjct: 635 SSAAQVLDEIITSYKRRNVFIYVANVSINDKIRTRLLKAGVIPNLE 680

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/287 (20%), Positives = 124/287 (43%), Gaps = 26/287 (9%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL+A G+ N +  + G++ ++  Y  S +   +GA   ++G+ +   T   M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQF 457

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGA---FDFVLGII 625
           V YIP C++  +  ++G  LL+E   D    L    Y+ +     T G    +    GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGIC 517

Query: 626 VGILIACFSFLVDSTKLQTINGEFDGQVARS---TVRRDYIQTQFLNKIG-------EQI 675
           +G + +  + +  S K +    +   +VA +   T   DY+     N +        E  
Sbjct: 518 IGCVYSILNIIKHSAKSRI---QILARVAGTSNFTNLDDYLMNMKRNPLSIENTEEIEGC 574

Query: 676 HVLKLQNLLFFGTIISIEEKIDKLLELSDKDA--------SKKRIKYLILDFKNINADNI 727
            ++++   L F     +++++D++                SK  IKY+I D   + +  +
Sbjct: 575 MIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--L 632

Query: 728 DYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVE 774
           D SAA+  + I      + + + ++++   D+I    +K G +  VE
Sbjct: 633 DSSAAQVLDEIITSYKRRNVFIYLANVSINDKIRTRLSKAGVIPNVE 679

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 120/287 (41%), Gaps = 26/287 (9%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL+A G+ N +  + G++  +  Y  S +   +GA   ++G+ +   T   M +    
Sbjct: 408 NRELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQF 467

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDTWGKL--NNFEYATVVAIVFTMGAF-DFVLGII 625
           V YIP C++  +  ++G  LL+E   D    L    F    V A+ F    F     GI 
Sbjct: 468 VHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGIC 527

Query: 626 VGILIACFSFLVDSTKLQTINGEFDGQVARS---TVRRDYIQTQFLNKIG-------EQI 675
           +G + +  + +  S K +    +   +VA +   T   DY+     N +        E  
Sbjct: 528 IGCVYSIINIIKHSAKSRI---QILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGC 584

Query: 676 HVLKLQNLLFFGTIISIEEKIDKLLELSDKDA--------SKKRIKYLILDFKNINADNI 727
            ++++   L F     +++++D++                SK  IKY+I D   + +  I
Sbjct: 585 MIVRIPEPLTFTNSEDLKQRLDRIERYGSSKIHPGRKSLRSKDSIKYVIFDLGGMTS--I 642

Query: 728 DYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVE 774
           D SAA+    I      + + + + ++   D++ R   K G    VE
Sbjct: 643 DSSAAQVLEEIITSYKRRNVFIYLVNVSINDKVRRRLFKAGVAASVE 689

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 117/285 (41%), Gaps = 21/285 (7%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL+A G  N    + G++ ++  Y  S +   +GA   ++G+ +   T   M +    
Sbjct: 398 NRELVALGCINMFISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMKLLLQF 457

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGA---FDFVLGII 625
           V YIP C++  +  ++G  LL+E   D    L    Y+ +     T G    +    GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQCGGYSELFVFAVTFGVTIFYSIESGIC 517

Query: 626 VGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIG--------EQIHV 677
           +G + +  + +  S K +          +  T   DY++T   N           E   +
Sbjct: 518 IGCVYSILNIIKHSAKSRIQILARIAGTSNFTNLDDYLRTTKKNPPAVEGRIEEIEGCMI 577

Query: 678 LKLQNLLFFGTIISIEEKIDKLLELSDKDA--------SKKRIKYLILDFKNINADNIDY 729
           +++   L F     +++++D++                SK  IKY+I D   + +  ID 
Sbjct: 578 VRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--IDS 635

Query: 730 SAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVE 774
           SAA+  + I      + + + ++++   D+I     K G    VE
Sbjct: 636 SAAQVLDEIISCYKRRNVFIYLANVSINDKIRTRLLKAGVTPNVE 680

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 119/273 (43%), Gaps = 27/273 (9%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAAT-FGIMVIGPV 567
           ++ELIA G  N +  M   +  +  Y  S +   +GA  +++G  +   T F I  + P+
Sbjct: 377 NRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPI 436

Query: 568 IVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVG 627
           I  YIPVCI+  +  ++G  LL+EA  D         Y+ +     T+ A  F   +  G
Sbjct: 437 I-RYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTLLATLF-YSLEAG 494

Query: 628 ILIACFSFLVDSTKLQT-----INGEFDGQVARSTVRRDYIQTQ----FLNKIGEQIH-- 676
           I I C   +++  K        I G   G    + +  D  Q      F+N   E+I   
Sbjct: 495 IYIGCACSIINVIKHSAKSRIQILGRVPG--TETFINADDYQANAAGYFINPQIEEIEGF 552

Query: 677 -VLKLQNLLFFGTIISIEEKIDKLLE--------LSDKDASKKRIKYLILDFKNINADNI 727
            ++K+   L F     ++ ++ +L +         + +   K+  + +I D K +   +I
Sbjct: 553 LIVKIAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENVIFDMKGMT--HI 610

Query: 728 DYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRI 760
           D SAA+    I      + +H+ ++++  T+++
Sbjct: 611 DSSAAQTLEEILSAYNRRDVHVFLTNVPLTEKV 643

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 62/287 (21%), Positives = 125/287 (43%), Gaps = 27/287 (9%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL+A G  N  + ++G++  +  Y  S +   +GA   ++G+ +       +      
Sbjct: 385 NRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQ 444

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAI---VFTMGAFDFVLGII 625
           + YIPVCI+  +  ++G  LL+EA  D     N+  Y  ++     V T   +   +G+ 
Sbjct: 445 IRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVC 504

Query: 626 VGILIACFSFLVDSTK--LQTI-----NGEF---DGQVARSTVRRDYIQTQFLNKIGEQI 675
           +G   +  S +  S K  +Q +      G+F   D  ++ +T   D    + L    E  
Sbjct: 505 IGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPNIEEL----EGC 560

Query: 676 HVLKLQNLLFFGTIISIEEKIDKLLELSD------KDASKKR--IKYLILDFKNINADNI 727
            V+K+   L F  +  ++E++ +L              S++R  IKYL+ D   +    +
Sbjct: 561 LVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMTF--M 618

Query: 728 DYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVE 774
           D SAA+    I +    +R+ + ++ +   +++         L+ VE
Sbjct: 619 DSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 62/301 (20%), Positives = 130/301 (43%), Gaps = 37/301 (12%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL+A G  N +  + G++ ++  Y  S +   +GA   ++G  +   T   +      
Sbjct: 400 NRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKF 459

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGI 628
           + YIPVC++  +  ++G  LL+EA  D    +    Y  +++ + T+    F   +  GI
Sbjct: 460 IRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNELISFIITVLT-TFFYSVEAGI 518

Query: 629 LIACFSFLVDSTKLQT----------------ING-EFDGQVARSTVRRDYIQTQFLNKI 671
            + C   ++   K  T                +N  E++G+ + S  R   +  Q L +I
Sbjct: 519 TVGCGYSIIRVIKHSTKSRIQILGKLAGTNKFVNADEYEGKNSTSERR---VNPQ-LEEI 574

Query: 672 GEQIHVLKLQNLLFFGTIISIEEKIDKLLEL---------SDKDASKKRIKYLILDFKNI 722
            E   ++++   L F     ++ ++++ LEL         + +   ++  KY+I D   +
Sbjct: 575 -EGCLIVRIPEPLTFTNTDDLKTRLNR-LELYGSTKTHPAAPRSRDQEMTKYVIFDLHGM 632

Query: 723 NADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSA 782
               ID SA +    I      + +H+ +  + +  ++   F   G L+ VE   D++ +
Sbjct: 633 T--TIDSSAIQILQEIISSYKRRHVHVFLVRVPSARKVRNRFVNSGILEMVE--SDIHRS 688

Query: 783 L 783
           L
Sbjct: 689 L 689

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 110/281 (39%), Gaps = 54/281 (19%)

Query: 504 DKLDVD----KELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATF 559
           +K D+D    +EL++ G  N +S +  ++  +  Y  S L I   A   +AG++++ A  
Sbjct: 341 EKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAI 400

Query: 560 GIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDT---WGKLNNFEYATVVAIVFTMG 616
             M        Y+P+C++  +I  + Y LL+E   D    W      E  T VA+V T  
Sbjct: 401 FCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTL 460

Query: 617 AFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQ-- 674
            +    G+ +G+ +     L  +T           Q     + RD +  +F N   EQ  
Sbjct: 461 VWSPQFGVSIGVGLTMIRLLKHTT-----------QSRVQILGRDPVTKKFQNIYAEQSE 509

Query: 675 ---------IHVLKLQNLLFFGTIISIEEKIDKL------------------LELSDKDA 707
                      V+K+   L F  +  +++++ +L                  +  S    
Sbjct: 510 QIPLEEIEKTMVIKIPEPLIFSNVSDLKKRLSRLEKYGSLKVHPSYPTPLRPVSASAGSQ 569

Query: 708 SKKRIKYLILDFKNINADNIDYSAAEGFNRI-----KRFTF 743
           S+  I Y+I D   +    ID SA +    +     KR TF
Sbjct: 570 SESYISYVIFDL--LGMTYIDMSALQALTEMVVNYHKRGTF 608

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 101/507 (19%), Positives = 193/507 (38%), Gaps = 57/507 (11%)

Query: 309 TTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVT---- 364
           +T+    M + ++G+V F LG ++LG +     + +L G I  VG  ++I    +     
Sbjct: 168 STVTITMMITFISGVVLFFLGSVRLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLN 227

Query: 365 -----------TRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVL 413
                      T   K  + F + S     P       + +L+  L+++  R  K  L+ 
Sbjct: 228 HKLADVAGHYHTPVGKIMFLFRYASEYYHKPT-----AILSLICFLVLISTRIAKKKLMN 282

Query: 414 PTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVL 473
              ++  +     +V++   LSL    D    +  +T  E   D      F  +  PL  
Sbjct: 283 RYRFLIFVPEILLVVSVTILLSLK--YDFKHSYGISTIGEFNAD-----GFGSIGNPLSN 335

Query: 474 KQVPTM-------LALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIG 526
           +            LA+   G         +L     L     ++ELIA G+ N +  + G
Sbjct: 336 ENRALYSSLWNEGLAVAMLGFFESTTASKSLGSDYNL-TYSSNRELIALGFMNIVGSLFG 394

Query: 527 SVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGY 586
           ++ ++  Y  S + + +G    ++G M+   T     +   ++ Y P C++  +  ++G 
Sbjct: 395 ALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGI 454

Query: 587 ELLKEALVDTWGKLNNFEYATVVAIVFTMGAF---DFVLGIIVG-----ILIACFSFLVD 638
            LL+E   D    ++   Y+ +     T  A       LG+ VG     ILI   S L  
Sbjct: 455 SLLEEVPSDIKFHIHCSGYSELTVFTLTFIATLSQSVELGVTVGCIYSLILIVKHSALSR 514

Query: 639 STKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQI---HVLKLQNLLFFGTIISIEEK 695
              L  + G  D  V      ++Y    F N   EQ    +++K+   L F     +  +
Sbjct: 515 IQILAKLEGS-DEFVNVDDYIKNYNGRDFENITLEQFEHCYIVKIPEPLTFTNGEDLRSR 573

Query: 696 IDKLLELSDKD--------ASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRI 747
           + +L      +         S+  ++Y+I D + + +  +D  +A+    I R    + +
Sbjct: 574 LSRLERFGSTNVHPGSTSIVSQDDMEYIIFDLEGMTS--MDSGSAQILLEIIRSYVHRDV 631

Query: 748 HLIISSIKTTDRIYRAFNKVGTLDGVE 774
            + ++ +     I       G LD VE
Sbjct: 632 RVYLTRVSLDREIRIRLKSAGILDLVE 658

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/290 (20%), Positives = 122/290 (42%), Gaps = 31/290 (10%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPV- 567
           ++EL+A G  N  S ++GS+  +  Y  S +   +GA   ++G     A  G++V+  + 
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSG-----AFMGLLVLLTIK 447

Query: 568 ----IVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAI---VFTMGAFDF 620
               ++ YIP+C++  +  ++G  LL+EA  D       F Y  ++     V T   +  
Sbjct: 448 FLLPMIHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSV 507

Query: 621 VLGIIVGILIACFSFLVDSTK-----LQTINGE---FDGQVARSTVRRDYIQTQFLNKIG 672
            +GI +G   +  S +  S K     L  + G     +         R++       +  
Sbjct: 508 EVGICIGCGYSVISIIKHSAKSRIQILARVQGTSRFVNSDDYLKQTNREHANENLELEEL 567

Query: 673 EQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDA--------SKKRIKYLILDFKNINA 724
           E   ++K+   L F     ++E++++L +              S+   +Y+I+D   +  
Sbjct: 568 EGCLIVKIPEPLTFTNTEDLKERLNRLEKFGSTRVHPGARGRRSRSSTRYVIIDLHGMT- 626

Query: 725 DNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVE 774
            ++D SAA+    I      + + + ++ +    R+     K G +D VE
Sbjct: 627 -HMDSSAAQILLEIVSSYRKRDVRVFLARVTIDARVRERLEKSGVVDLVE 675

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/307 (21%), Positives = 118/307 (38%), Gaps = 43/307 (14%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAAT-FGIMVIGPV 567
           ++EL+A G SN +   +G++ ++  Y  S +   +G    L+G+ +   T   I+ + PV
Sbjct: 413 NRELVALGLSNIVISTLGALPSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPV 472

Query: 568 IVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFT------------- 614
           I  YIPVCI+  +  ++G+ LL+E   +         Y  +  IV T             
Sbjct: 473 I-HYIPVCILSVITTVIGFTLLEEIPKEVSFHWRCRGYNELFLIVLTFMTSIFYSVETSM 531

Query: 615 -MGAFDFVLGIIVGILIACFSFLVDSTKLQTING--------EFDGQVARSTVRRDYIQT 665
            +G    +L II     +      D+  + +I+                +ST   DY   
Sbjct: 532 YIGCVYSILNIIKHSAKSRIQIYTDAPLITSISNPPSIDNSNINSNNNIKSTRSSDYRPE 591

Query: 666 QFLNK---------IGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRI---- 712
              N            EQ  ++K+   L F     ++EK+++   L    A   +I    
Sbjct: 592 SRRNSADECFRCSLTNEQTLIVKIPEPLTFTNCEDLKEKLNRFERLGTHTAHPGKILKDT 651

Query: 713 ----KYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVG 768
               KY+I D + +    +D SA E    I         H+   ++   + I       G
Sbjct: 652 LFQPKYIIFDLQGMTL--MDSSATEILKEIVLSYRRSGSHIFFVNVSFRENIRNRIQASG 709

Query: 769 TLDGVEL 775
            +D +EL
Sbjct: 710 IIDLIEL 716

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 120/269 (44%), Gaps = 45/269 (16%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAAT-FGIMVIGPV 567
           ++EL+A G  N +  + G++ ++  Y  S +   +GA   ++G  +   T F I  + PV
Sbjct: 384 NRELVALGSMNLVGSLFGALPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPV 443

Query: 568 IVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGII-- 625
           I  Y P+CI+  +  ++G  LL+EA  D    +    Y  +  I+FT+    FV  II  
Sbjct: 444 I-HYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCHGYNEL--IIFTL---IFVTTIIHS 497

Query: 626 --VGILIAC------------------FSFLVDSTKLQTINGEFDGQVARSTVRRDYIQT 665
              GI + C                   + ++ + +   ++G + G     T+  D  ++
Sbjct: 498 VEAGISVGCIYSIGSIIKHSAQSRIQILTRVIGTNQFVPVDGYYPGL---KTI--DLRES 552

Query: 666 QFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDA--------SKKRIKYLIL 717
             L ++ +   ++K+   L F     ++E++++L                +++ IKY+I 
Sbjct: 553 SALEELDDSTLIVKIPEPLTFTNTEDLKERLNRLERFRSVRIHPGRRPLHNRENIKYVIF 612

Query: 718 DFKNINADNIDYSAAEGFNRIKRFTFSKR 746
           +   + +  +D SAA+    I + T+ KR
Sbjct: 613 ELGGMTS--MDSSAAQILKEIIK-TYKKR 638

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 61/134 (45%), Gaps = 3/134 (2%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAAT-FGIMVIGPV 567
           ++EL+A G  N +    G +  +  Y  S +   +GA   +AG+ + + T F I  + PV
Sbjct: 375 NRELVALGLMNTIGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPV 434

Query: 568 IVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVG 627
           I  YIP C++  +   +G  LL+EA  D    +    Y  ++  V T     F   I  G
Sbjct: 435 I-HYIPTCVLSVITTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCF-YSIEFG 492

Query: 628 ILIACFSFLVDSTK 641
           IL  C   L+   K
Sbjct: 493 ILAGCTYSLISIVK 506

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 92/196 (46%), Gaps = 7/196 (3%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL++ G  N +  +  S+  +  Y  S L I  GA   +AG+ ++ +    M     +
Sbjct: 350 NRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFCMRFLMGV 409

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDT---WGKLNNFEYATVVAIVFTMGAFDFVLGII 625
             Y+P+CI+  +I  + Y LL+E   D    W      E  T  A+V +   +    G++
Sbjct: 410 FHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLIWSPQFGLV 469

Query: 626 VGILIACFSFLVDST--KLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNL 683
           +G+ +     L  +T  ++Q +  +   +  R+ +  ++ +   L +I E+  V+K+   
Sbjct: 470 MGLGLTMIRLLKHTTQSRIQILGKDPITKKFRN-IYSEHNEEIPLEEI-EKTMVIKVPEP 527

Query: 684 LFFGTIISIEEKIDKL 699
           L F  +  + +K+ +L
Sbjct: 528 LVFWNVPDLMKKVKRL 543

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/281 (20%), Positives = 112/281 (39%), Gaps = 25/281 (8%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL++ G  N +S +  ++  +  Y  S + I  GA    +G+ ++      M      
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDT---WGKLNNFEYATVVAIVFTMGAFDFVLGII 625
             ++P+CI+  +I  + + LL+EA  D    W      E    + IV T   +    G+ 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVT 391

Query: 626 VGILIACFSFLVDSTKLQT-INGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLL 684
           +G+ +     L  ST+ +  I G          +  D      L +I E++ V+K+   L
Sbjct: 392 MGMCLTMIRLLKHSTRSRVQILGRDPITYTFKNIDDDENSDIPLEEI-EKVMVVKIPEPL 450

Query: 685 FFGTIISIEEKIDKLLE-----------------LSDKDASKKRIKYLILDFKNINADNI 727
            F  +  +   + ++ +                 LS   + +  +KYL++D   +    I
Sbjct: 451 IFSNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSGQVSLKYLVIDLFGMT--YI 508

Query: 728 DYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVG 768
           D SA +    I      + I ++ +  K  D +   F K G
Sbjct: 509 DISALQALREIVDAYSRRNICVMFTRPKIPD-LRHKFRKSG 548

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/280 (20%), Positives = 119/280 (42%), Gaps = 22/280 (7%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL+A G  N ++ + G++ ++  Y  S +   +G+   ++G+ + + T   +     +
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGA---FDFVLGII 625
           + YIP+CI+  +  ++G  LL+EA  +         Y  +     T+ A   +   +GI 
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMGIC 511

Query: 626 VGILIACFSFLVDSTKLQT-INGEFDGQVARSTVRR--------DYIQTQFLNKIGEQIH 676
           +G   +  S +  S K +  I G   G    + +          D    +F+ +  E   
Sbjct: 512 IGCGYSIISIVKHSAKSRIQILGRVQGTREFANIDEYLDSDPIGDIETNKFVLEEIEGCL 571

Query: 677 VLKLQNLLFFGTIISIEEKIDKLLELSDKDA--------SKKRIKYLILDFKNINADNID 728
           ++K+   L F     ++E++++L       A        SK   K +I D   + +  ID
Sbjct: 572 IVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHGMTS--ID 629

Query: 729 YSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVG 768
            SA + F  I      +++ + ++ +  + +I     K G
Sbjct: 630 SSATQIFFDIVATYKKRKVKVFLARVLQSKQIRERLEKSG 669

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/305 (20%), Positives = 126/305 (41%), Gaps = 33/305 (10%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL+A G  N +  + G++ ++  Y  S +   +GA   ++G+ +   T    +     
Sbjct: 373 NRELVALGSLNLVGSIFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNA 432

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGI 628
           + +IPVC++  +  ++G  L +EA  D         Y  ++    T+    F   +  GI
Sbjct: 433 IHHIPVCVLSVITTMVGITLFEEAPADLRYHFRCRGYNELLIFALTVLT-TFFYSVEAGI 491

Query: 629 LIAC----FSFLVDSTK-----LQTING--------EFDGQVARSTV---RRDYIQTQFL 668
            + C       + +STK     L+ ++G        +F+       V   R D I+   +
Sbjct: 492 TLGCGYSVIRVIKNSTKSKIQILRRVSGTDQFVNADDFNSSTNTCVVIPPRLDDIEGSLI 551

Query: 669 NKIGEQIHVLKLQNLLFFGTIISIEEKID--KLLELSDKDASKKRIKYLILDFKNINADN 726
            KI E++  +  ++L    T +   EK    K    S K  ++ + K++I D   +    
Sbjct: 552 VKIPERLTFMNTEDL---KTRLYRLEKYGSVKTHPASPKPRNRNQTKHMIFDMNGMT--E 606

Query: 727 IDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSAL--- 783
           ID SA++    I      + + + ++ +     +       G ++ VE  D   +A+   
Sbjct: 607 IDSSASQILQEIVLSLRKRGVRVYLARVPLIAGVRERLVASGVVEMVEKCDASVTAVDSA 666

Query: 784 --EWC 786
             +WC
Sbjct: 667 FDDWC 671

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 55/303 (18%), Positives = 123/303 (40%), Gaps = 28/303 (9%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL+A G  N +  + G++ ++  Y  S +   +GA   ++G+ +   T          
Sbjct: 388 NRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITLITSKFLLNA 447

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGI 628
           + +IP+C++  +  ++G  L +EA  D         Y  ++    T+    F   +  GI
Sbjct: 448 IRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYNELLTFAITV-LTTFFYSVEAGI 506

Query: 629 LIACFSFLVDSTKLQTING-EFDGQVARST--VRRD--YIQTQFLNKIGEQIH------V 677
            + C   ++ + K  T +G +  G+++ +   V  D  Y  +   ++ G ++       V
Sbjct: 507 TLGCGYSIIRAIKNSTQSGIQILGRISGTNRFVNADEFYSASSLDSEFGPRLDHMEGCLV 566

Query: 678 LKLQNLLFFGTIISIEEKIDKLLE--------LSDKDASKKRIKYLILDFKNINADNIDY 729
            ++   L F     ++ ++++L           S +   K   + +I D + +    ID 
Sbjct: 567 ARIAEPLTFTNTEDLKSRLNRLENHGSVKTHPASPRSRDKDLTRNMIFDLEGMT--QIDS 624

Query: 730 SAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSAL------ 783
           SA++    I +    +++ + ++ +     +       G    VE    LN+A       
Sbjct: 625 SASQILCEIVKSLTKRKVRVYLARVPRALHVRERLVASGVAGMVENNIPLNTASMGQPGD 684

Query: 784 EWC 786
            WC
Sbjct: 685 SWC 687

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 58/124 (46%), Gaps = 1/124 (0%)

Query: 509 DKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVI 568
           ++EL+A G  N  + ++G + ++  Y  S +   +GA   ++G+++   T   +      
Sbjct: 428 NRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNY 487

Query: 569 VAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGI 628
           + +IP C++  +  ++G  L++EA  +         Y  ++ I F          + VGI
Sbjct: 488 IHFIPTCVLSVITTIVGLSLIEEAPGEVKFHWRCKGYNELI-IFFMTACGTIFFSVEVGI 546

Query: 629 LIAC 632
           +I C
Sbjct: 547 IIGC 550

>KAFR0K00920 Chr11 (195921..196538) [618 bp, 205 aa] {ON} Anc_5.168
           YGR167W
          Length = 205

 Score = 35.8 bits (81), Expect = 0.27,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 14/132 (10%)

Query: 68  IKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFE-----DQLEDLAENG 122
           + E+F   P    +   S+SI ++  L+R+  AL +EF    + +     D+ +  +E  
Sbjct: 1   MSEKFP--PLEDEQVAVSESIEETDFLKREAEALGDEFKTEHDTDLLNNSDEEQFSSEQQ 58

Query: 123 NTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYVSL 182
           N    DE +    A SP      P    N+D + ++      RD +    DE      +L
Sbjct: 59  NQEDQDE-LAELQAASPALPSQAPQETTNSDAAEIINKWRESRDKQVHERDE------TL 111

Query: 183 QSQRAGSNSRAI 194
           +SQ++G   +AI
Sbjct: 112 KSQKSGLQEQAI 123

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 35.8 bits (81), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 83/219 (37%), Gaps = 30/219 (13%)

Query: 472 VLKQVPTMLALTFFGILHVPI--------NVPALAMSIGLDKLDV--------------D 509
           +L  VP+   L   G+ HVP         N+PA  + + L+ + +              D
Sbjct: 384 ILGSVPS--GLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPD 441

Query: 510 KELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIV 569
           +ELIA G SN L     +      ++ S L  K      L+GL   +     +       
Sbjct: 442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAF 501

Query: 570 AYIPVCIVGSLIFLLGYELLKEALVDTWG--KLNNFEYATVVAIVFTMGAFDFVLGIIVG 627
            YIP   + ++I     +LL  +   TW   K+N  ++   +  V          GI   
Sbjct: 502 FYIPKATLSAVIIHAVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFA 560

Query: 628 ILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQ 666
           +  +C   L+   K+    G+F G+V  + V   YI+  
Sbjct: 561 MCWSCAMLLL---KMAFPAGKFLGRVEIAEVTDAYIKAN 596

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 84/219 (38%), Gaps = 30/219 (13%)

Query: 472 VLKQVPTMLALTFFGILHVPI--------NVPALAMSIGLDKLDV--------------D 509
           +L  VP+   L   G+ HVP         N+PA  + + L+ + +              D
Sbjct: 384 ILGSVPS--GLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRVNDYKVVPD 441

Query: 510 KELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIV 569
           +ELIA G SN L     +      ++ S L  K      L+GL   +     +       
Sbjct: 442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAF 501

Query: 570 AYIPVCIVGSLIFLLGYELLKEALVDTWG--KLNNFEYATVVAIVFTMGAFDFVLGIIVG 627
            YIP   + ++I     +LL  +   TW   K+N  ++   +  V          GI   
Sbjct: 502 FYIPKATLSAVIIHAVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFSSIENGIYFA 560

Query: 628 ILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQ 666
           +  +C  F++   K+    G+F G+V  + V   Y++  
Sbjct: 561 MCWSCAIFIL---KVAFPAGKFLGRVEIAEVTDAYVRAD 596

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 89/219 (40%), Gaps = 34/219 (15%)

Query: 472 VLKQVPTMLALTFFGILHVPI--------NVPALAMSIGLDKLDV--------------D 509
           +L  VP+   L   G+ HVP         N+PA  + + L+ + +              D
Sbjct: 384 ILGSVPS--GLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPD 441

Query: 510 KELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIV 569
           +ELIA G SN L     +      ++ S L  K      L+GL   +     +       
Sbjct: 442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAF 501

Query: 570 AYIPVCIVGSLIFLLGYELLKEALVDTWG--KLNNFEYAT-VVAIVFTMGAFDFVLGIIV 626
            YIP   + ++I     +LL  +   TW   K+N  ++   +V ++ T+ A      I  
Sbjct: 502 FYIPKATLSAVIIHAVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFA-----SIED 555

Query: 627 GILIA-CFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQ 664
           GI  A C+S  +   K+    G+F G+V  + V   Y++
Sbjct: 556 GIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVR 594

>Suva_2.221 Chr2 (376792..378477) [1686 bp, 561 aa] {ON} YDR062W
           (REAL)
          Length = 561

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 159 LPPNTQRDLEYGSIDEFDHQY 179
           LPP+ QR+ EYG++D  DH Y
Sbjct: 18  LPPDIQRENEYGTLDSTDHLY 38

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 32.7 bits (73), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 88/423 (20%), Positives = 160/423 (37%), Gaps = 81/423 (19%)

Query: 293 ASIMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGV 352
           A + A  P + D  +T  ++   ++ ++ G++   +G L+LG +V     + + G + G 
Sbjct: 206 AEVQAKYP-DGDTTITGPVIATTLA-LLCGIISAAVGFLRLGFLVELISLNAVAGFMTGS 263

Query: 353 GYFLV------ITGFE--VTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQ 404
            + ++      + G+   V TRA+ ++   E L  L  D ++   +GL  L   LL V +
Sbjct: 264 AFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHL-PDTKLDAVFGLIPLF--LLYVWK 320

Query: 405 RAC-------------KNS----LVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFP 447
             C             KN+    +V  T++ A       I+ +   +        GW   
Sbjct: 321 WWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCI--------GWAIT 372

Query: 448 ATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINV-----PALAMSIG 502
              ++            + +S   +L  VP+   L   G+ HVP  +     P+L  SI 
Sbjct: 373 RGKSSSE----------RPIS---ILGSVPS--GLKEVGVFHVPSGLMSKLGPSLPSSII 417

Query: 503 L-----------------DKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGA 545
           +                  K+  D+ELIA G SN L     +      ++ S L  K   
Sbjct: 418 VLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNV 477

Query: 546 DDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWG--KLNNF 603
              L+GL   +     +        YIP   + ++I     +LL  +   TW   K+N  
Sbjct: 478 RTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLA-SYQTTWNFWKMNPL 536

Query: 604 EYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYI 663
           ++   +  V          GI   +  +C   L+   K+    G+F G+V  + V   Y+
Sbjct: 537 DFICFIVTVLITVFASIEDGIYFAMCWSCAMLLL---KVAFPAGKFLGRVEIAEVTDAYV 593

Query: 664 QTQ 666
           +  
Sbjct: 594 KAD 596

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 54/130 (41%), Gaps = 3/130 (2%)

Query: 505 KLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVI 564
           K++ ++E+IA G SN L     +      ++ S L  K      L+G+  AA     +  
Sbjct: 407 KINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYC 466

Query: 565 GPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWG--KLNNFEYATVVAIVFTMGAFDFVL 622
                 YIP   + ++I    ++L+  +   TW   K+N F++   +  VF         
Sbjct: 467 LTGAFFYIPKATLSAVIIHAVFDLIA-SYHTTWSLWKMNVFDFIGFITTVFITVFSSIEN 525

Query: 623 GIIVGILIAC 632
           GI   +  +C
Sbjct: 526 GIYFAVCWSC 535

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,247,024
Number of extensions: 4388071
Number of successful extensions: 13972
Number of sequences better than 10.0: 76
Number of HSP's gapped: 14366
Number of HSP's successfully gapped: 82
Length of query: 1010
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 890
Effective length of database: 39,721,479
Effective search space: 35352116310
Effective search space used: 35352116310
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)