Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14652gna 1ON1431436209e-84
Kwal_55.21194na 1ON1541611241e-08
AER177W3.310ON79163628.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14652g
         (143 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14652g Chr6 complement(1200124..1200555) [432 bp, 143 aa] ...   243   9e-84
Kwal_55.21194 s55 complement(725370..725834) [465 bp, 154 aa] {O...    52   1e-08
AER177W Chr5 (964615..966990) [2376 bp, 791 aa] {ON} Syntenic ho...    28   8.1  

>KLTH0F14652g Chr6 complement(1200124..1200555) [432 bp, 143 aa]
           {ON} no similarity
          Length = 143

 Score =  243 bits (620), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 123/143 (86%)

Query: 1   MGLELGTYMAFLARDAVGKARHCMDGAFRVVRDSGKCIGLGRQEQAVPHHVGIVNSRRTV 60
           MGLELGTYMAFLARDAVGKARHCMDGAFRVVRDSGKCIGLGRQEQAVPHHVGIVNSRRTV
Sbjct: 1   MGLELGTYMAFLARDAVGKARHCMDGAFRVVRDSGKCIGLGRQEQAVPHHVGIVNSRRTV 60

Query: 61  VTRRGDSLQRSHSTYSPRSSPGAAVRPNFGDSEGGPRAAAHVRFXXXXXXXXXXXXXXXX 120
           VTRRGDSLQRSHSTYSPRSSPGAAVRPNFGDSEGGPRAAAHVRF                
Sbjct: 61  VTRRGDSLQRSHSTYSPRSSPGAAVRPNFGDSEGGPRAAAHVRFPSSISVSASTPASAAA 120

Query: 121 XXXXCNAMVDPADPFVLTVRVTT 143
               CNAMVDPADPFVLTVRVTT
Sbjct: 121 ASIPCNAMVDPADPFVLTVRVTT 143

>Kwal_55.21194 s55 complement(725370..725834) [465 bp, 154 aa] {ON}
           [contig 295] FULL
          Length = 154

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 68/161 (42%), Gaps = 36/161 (22%)

Query: 7   TYMAFLARDAVGKARHCMDGAFRVVRDSGKCIGLGRQEQAVPHHVGIVNSRRTVVTRRGD 66
           +Y+ +L R  V K R  +DG   +V++  + +G  RQ     +  G  +S+R V+TRRG 
Sbjct: 3   SYVGYLTRKTVRKIRDYVDGTLDIVKEPARLVGFRRQ--MANNEDGQTSSKRAVLTRRGT 60

Query: 67  SLQ---RSHSTY------------SPRSSPG---------AAVRPNFGDSEGGPRAAAHV 102
            +Q   ++ ++Y            SP  S G         A+ R  +   +  PR   +V
Sbjct: 61  EVQDTRKARNSYVTHRATDCDSMSSPLDSDGENENENEEDASYRVTYVARDSRPRRLRNV 120

Query: 103 RFXXXXXXXXXXXXXXXXXXXXCNAMVDPADPFVLTVRVTT 143
           RF                        VDPADPFVL +R+ +
Sbjct: 121 RFSVAPDDESTASYRE----------VDPADPFVLNIRIAS 151

>AER177W Chr5 (964615..966990) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR083W (TEC1)
          Length = 791

 Score = 28.5 bits (62), Expect = 8.1,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 3/63 (4%)

Query: 39  GLGRQEQAVPHHVGIVNSRRTVVTRRGDSLQRSHSTYSPRSSPGAAVRPNFGDSEGGPRA 98
           G     + +P + G+ + +R   T      Q S ST+ PR SP +   P+   S   P+ 
Sbjct: 411 GYPSNNKPMPRYYGVSSQQRYAYTMLQ---QMSFSTWVPRMSPTSHGHPSQQQSPLAPQV 467

Query: 99  AAH 101
           A H
Sbjct: 468 ALH 470

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,992,802
Number of extensions: 335063
Number of successful extensions: 610
Number of sequences better than 10.0: 4
Number of HSP's gapped: 608
Number of HSP's successfully gapped: 4
Length of query: 143
Length of database: 53,481,399
Length adjustment: 99
Effective length of query: 44
Effective length of database: 42,129,465
Effective search space: 1853696460
Effective search space used: 1853696460
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 60 (27.7 bits)