Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F14630g3.483ON57357330110.0
Kwal_55.211873.483ON57357328290.0
SAKL0F02970g3.483ON57357126630.0
KLLA0B10868g3.483ON57457326170.0
Kpol_480.193.483ON57457126050.0
Suva_16.4743.483ON57257225690.0
YPR145W (ASN1)3.483ON57257225690.0
Smik_16.3963.483ON57257225640.0
TDEL0D055203.483ON57357125630.0
TPHA0D042003.483ON57457125630.0
CAGL0I10648g3.483ON57457225530.0
KNAG0A079203.483ON57857625500.0
Skud_16.4393.483ON57257225480.0
NCAS0F035103.483ON57557325430.0
NDAI0B058103.483ON57757625410.0
Smik_6.2203.483ON57257125200.0
KAFR0G036703.483ON57257125150.0
Skud_7.4353.483ON57257125110.0
Suva_7.4103.483ON57257225090.0
YGR124W (ASN2)3.483ON57257125050.0
AFR303W3.483ON57157124820.0
ZYRO0B04136g3.483ON57257324800.0
Ecym_12443.483ON57357324720.0
TBLA0C044303.483ON58057924470.0
TBLA0C063008.875ON5185041822e-13
KLLA0D10285g8.875ON5154781572e-10
NCAS0C001908.875ON5174791501e-09
KNAG0J002008.875ON5155211456e-09
ZYRO0A00528g8.875ON5121031412e-08
Kpol_455.78.875ON5181051322e-07
TPHA0C049508.875ON525991287e-07
Skud_13.468.875ON5191131242e-06
KAFR0L021108.875ON514951198e-06
ADL350C8.875ON508941162e-05
NDAI0K001808.875ON522941152e-05
YML096W8.875ON525951143e-05
Suva_13.528.875ON519991125e-05
TDEL0B004408.875ON516941126e-05
SAKL0D00352g8.875ON515771126e-05
Smik_13.398.875ON521961117e-05
Ecym_81558.875ON513831072e-04
Kwal_27.97058.875ON515791038e-04
CAGL0H06963g8.875ON5171671000.001
KLTH0E16412g8.875ON51595960.005
Skud_7.311singletonON8189800.037
Kpol_1071.97.58ON957111790.54
KNAG0B026607.339ON825124698.9
CAGL0L05588g1.228ON313526810.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F14630g
         (573 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...  1164   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...  1094   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...  1030   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...  1012   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1008   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...   994   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...   994   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...   992   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...   991   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   991   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...   988   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...   986   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   986   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...   984   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   983   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...   975   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...   973   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...   971   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...   971   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...   969   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   960   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   959   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   956   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   947   0.0  
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    75   2e-13
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    65   2e-10
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    62   1e-09
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    60   6e-09
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    59   2e-08
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    55   2e-07
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    54   7e-07
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    52   2e-06
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    50   8e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    49   2e-05
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    49   2e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    49   3e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    48   5e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    48   6e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    48   6e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    47   7e-05
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    46   2e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    44   8e-04
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    43   0.001
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    42   0.005
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    35   0.037
Kpol_1071.9 s1071 complement(17560..20433) [2874 bp, 957 aa] {ON...    35   0.54 
KNAG0B02660 Chr2 (514239..516716) [2478 bp, 825 aa] {ON} Anc_7.3...    31   8.9  
CAGL0L05588g Chr12 complement(608227..609168) [942 bp, 313 aa] {...    31   10.0 

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/573 (97%), Positives = 561/573 (97%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK 573
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK 573

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score = 1094 bits (2829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/573 (90%), Positives = 544/573 (94%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIFTCFRH+ V++FKPDAL+L KRIRHRGPDWSGN+I+NSTL+AHERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P VSE+ +YIL VNGE+YNHIQLREEFS YPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AWALYD KKDR++AARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDQITRY+ P+W+DE+RIPSEPLDLLKIR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IA+IAARETEKAN++M+PV+YDSEDKHLAGVDD+G L SAGWS LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS+HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFL LCMNLDPKEKMIN AEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AEA ISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK 573
           ASTVMRWIPKADWGCAEDPSGRYAKIH+QHI K
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHISK 573

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/571 (84%), Positives = 516/571 (90%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF C++H+SV+EFKP AL+L KRIRHRGPDWSGN++KN+T++AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  SED +Y L VNGE+YNHI+LREE +SYPFKTLSDCEPIIPLY+KY ID PKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAKKDRI+AARDPIGITTLYMGR S SP TV+FASELKCL D+CD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+ PDW+DE+RIP  PLD   IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IA+IAARETEKAN  +DPV YD EDKHLAGVDD GNL +AGWS LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI SIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDR+FL +CMN+DP EKMIN +EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAEAAISDEQF QPK EWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score = 1012 bits (2617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/573 (83%), Positives = 516/573 (90%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  FR+  V+ +KP AL+L KRIRHRGPDWSGNI+KNST++ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  SED +Y L VNGE+YNHI LREE +SYPFKTLSDCEPIIPLYEKY IDAPK+LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD+KKDRI+AARDPIGITTLYMGR S SPK+V+F+SELKCLTD+CD IIAFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD++TRYF PDW+DE RIP+ P+D   +R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IA+IAARETEK N+++DPV YDS+   LAG+D+ G+L +AGWS LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMN+DP +KMI  AEG+IEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAE+ ISDEQF QPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK 573
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQH+DK
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDK 573

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/571 (84%), Positives = 508/571 (88%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  ++H++ E FKP AL+L KRIRHRGPDWSGN++KNST++ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S   +Y+L VNGE+YNHIQLRE    Y +KTLSDCEPIIPLY K+ IDAPKYLDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAKKDRI+AARDPIGITTLYMGR+SKSPKTV+FASELKCLTD+CDSI+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDQITRYF+PDWIDE RIP+EP+    IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IASIAARETEKA  +MD   YDSEDKHL G+DD GNL +AGWS LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMN+DP EKMINA+EGRIEKYILRKAFDTSDEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE F  PK  WG DIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRWIPKADWGCAEDPSGRYAKIHEQHI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/572 (81%), Positives = 504/572 (88%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  F+H+ V  +KP AL+L KRIRHRGPDWSGN +KNST+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S D +Y+L VNGE+YNHIQLREE   Y FKTLSDCEPIIP+Y K+ IDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF PDW+DE RIPS P+D L IRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IA+IAARET KA + ++P  YD++ +HLAGVDD GNL +AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMN+DP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AEA ISDE F  PKAEWG+DIPTTKEAYWYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HID
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/572 (82%), Positives = 504/572 (88%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  FRH+ V  +KP AL+L KRIRHRGPDWSGN IKNST+  HERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S D  Y+L VNGE+YNHIQLREE + Y F TLSDCEPIIP+Y K+ IDAPKYLDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF PDW+DE RIPS P+D + IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IASIAARET KA + ++P  YDS+ +HLAG+DD G L +AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMN+DP EKMI   EGRIEKYILRKAFDT+ EP AKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AEA ISDE F  PKAEWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HI+
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/572 (82%), Positives = 502/572 (87%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  F+H+ V  +KP AL+L KRIRHRGPDWSGN IKNST+  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S D +Y+L VNGE+YNHIQLREE   Y FKTLSDCEPIIP+Y K+ IDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF PDW+DE RIPS P+D L IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IASIAARET  A + +DP  YDS+ +HLAGVDD G L +AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMN+DP EKMI   EGRIEKYILRKAFDT+ EP AKPYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE F  PKAEWG DIP+TKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HID
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score =  991 bits (2563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/571 (81%), Positives = 510/571 (89%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF   +H+ V+ +K  AL+L KRIRHRGPDWSGN+++N+TL+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S   NY L VNGE+YNHI+LREEFS Y F TLSDCEPIIPLYEKY ID PKYLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAK+DRI+AARDP+GITTLYMGR+S SPKTV+FASELKCLTD+CD+I+AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF PDW+DE RIPS P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IASIAARETEKAN+++D  KYDSEDKHLAG+DD+GNL SAGWS LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGSIHHEHTFTLQEGLDAL DVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMN+DPK+KMIN  EGR+EKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISD+ F  PK+ WGDD+PTTKEA+WYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRW+PKADWGCAEDPSGR+A+IH+QH+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  991 bits (2563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/571 (82%), Positives = 505/571 (88%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIFT ++H++ E FKP AL+L KRIRHRGPDWSGN++KNST+MAHERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S+D ++IL VNGE+YNHIQ+RE+F  Y FKTLSDCEPIIPLY KYG +APK+LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGR SKSPKTVYFASELKCLTD+CDSI+AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRY+ PDWIDE+RI ++PLDL+KIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IASIAARETEKA          S    L G+DD GNLRS+GWS LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS+HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DP EKMIN  EGRIEKYILRKAFDT+DEP  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE F+ P+  WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score =  988 bits (2553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/572 (82%), Positives = 501/572 (87%), Gaps = 1/572 (0%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  ++HQ V  FKP AL+L KRIRHRGPDWSGN++KNST+M HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  SED +Y L VNGE+YNHIQLRE+F  Y FKTLSDCEPIIP Y ++ IDAPKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAK+DRIVAARDP+GITTLYMGR S SPKTV+FASELKCLTD+CD I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDQITRYF PDWIDE RIP+ P++   IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYD-SEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPD 299
             IASIAARETEKAN + D    D S  K LAG+D+ G+L +AGWS LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 300 LQAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQK 479
           RVPFLD+EFLQLCMN+DPK+KMI+ + GRIEKYILRKAFDTSDEP  KPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKD AE  ISD  F  PK EWG+DIPTTKEAYWYRLKFDALFPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 540 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           AASTVMRWIPKADWGCAEDPSGRYAKIHEQH+
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/576 (81%), Positives = 507/576 (88%), Gaps = 4/576 (0%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  FRH+ V+ FKP AL+L KRIRHRGPDWSGNIIKNST+MAHERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S   +YIL VNGE+YNHIQLREE   Y +K+LSDCEPIIP+Y KY +DAPK+LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAKKDRIVAARDPIGITTLYMGR S  PKTV+FASELKCLTD+CD+IIAFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRY+ P+W+DE +IPS P+DL +IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYD----SEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPN 296
             IA+IAARETEKAN ++DP KYD    +E  HLAG+DD GNL SA WS LHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 297 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL AARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILW 476
           LEARVPFLD+EFL LCMN+DPK+K+IN  EGRIEKYILRKAFDT DEP  KPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKD AE  ISDE F  PKA WG D+PTTKEA+WYRLKFDALFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572
           Q TAA TVMRWIPKADWGCAEDPSGR+AKIHEQH++
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  986 bits (2548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/572 (81%), Positives = 503/572 (87%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  ++H+ V  +K  AL+L KRIRHRGPDWSGN  KNST+  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S D +Y+L VNGE+YNHIQLREE   Y FKTLSDCEPIIP+Y K+ I+APKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF PDW+DE RIPS P+D + IRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IASIAARET  A + ++P  YDS+ +HLAGVDD GNL +AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMN+DPKEKMI A EGRIEKYILRKAFDT+ EP AKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AEA ISDE F  PKAEWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HI+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score =  984 bits (2543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/573 (81%), Positives = 507/573 (88%), Gaps = 1/573 (0%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  FRH+ V+ +KP AL+L KRIRHRGPDWSGN++KN+T++AHERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S   NY L VNGE+YNHIQ+REE + Y FKTLSDCEPIIPLY KY +DAPK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGR SK+P+TVYFASELKCLTD+CDSI+AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRYFNPDW+DEDRIPS P+DL  IR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSED-KHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPD 299
             IASIAARETEKA   +D    + E  KHL GVDD G+L + GWS LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 300 LQAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS+HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQK 479
           RVPFLD+EFLQLCMN+DPK+KMI+ A G+IEKYILRKAFDT+D+P  KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKD AE  ISD  F+ PK  WG+D+PTTKEAYWYRLKFDAL+PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 540 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572
           AA TVMRWIPKADWGCAEDPSGRYAKIHE+H+D
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/576 (81%), Positives = 505/576 (87%), Gaps = 4/576 (0%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  F+H+ V  FKP AL+L KRIRHRGPDWSGN+IKN+T++AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S   NY L VNGE+YNHIQ+RE+F  YPFKTLSDCEPIIPLY K+ ID PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD+K+DRI+AARDPIGITTLYMGR+SK+P+TV+FASELKCLTD+CDSIIAFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDQITRYF PDW+DE RIP   LDL  IR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDK----HLAGVDDAGNLRSAGWSHLHSFAIGLPN 296
             IASIAARETEKAN+Q      ++ D+    HL GVDD G+L + GWS LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 297 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILW 476
           LEARVPFLDR+FLQLCMN+DPKEKMIN AEGRIEKYILRKAFDTSD+P AKPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKD AE  ISD  F+ PK  WG DIPTTKEAYWYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572
           QKTAA TVMRWIPKADWGCAEDPSGRYAKIHE+H++
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/571 (80%), Positives = 503/571 (88%), Gaps = 1/571 (0%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  F+H  +  FKP AL+L KRIRHRGPDWSGN + NST+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S D  Y+LGVNGE+YNHIQLREE S Y F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           A+ +YDAKKDRIVAARDPIG+ TLYMGR SKSPKTVYFASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF PDW+DE RIPS P+D L IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IA+IAARETEKAN+ ++  +   ++K LAG+DD G+L ++GWS LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADVNE-ESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLD++FLQLCMN+DPK+KMI   EG+IEKYILRKAFDT++EP  KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+D AE  ISD  F  PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A+TVMRW+PKADWGCAEDPSGRYAKIHE+H+
Sbjct: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/571 (80%), Positives = 497/571 (87%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  FRH+ V  FK  AL+L KRIRHRGPDWSGN++KNST+M HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S   NY L VNGE+YNHIQLRE+F  Y FKTLSDCEPIIPLY +  IDAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD+KKDRI+AARDPIG+TTLYMGR S SPKTV+FASELKCL D+CDSI+AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF P+WIDE++IP+ P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IASIAARETE AN ++D  +Y  E  HLAG+DD G+LR++GWS LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGSIHHEHTFTLQEG+DAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DP +K+IN  EGRIEKYILRKAFDT D+P AKPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AE  ISDE F  PK+ WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/571 (80%), Positives = 500/571 (87%), Gaps = 1/571 (0%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  F+H+ +  FKP AL+L KRIRHRGPDWSGN + NST+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S D  Y+LGVNGE+YNHIQLRE+ S Y F+T SDCEPIIPLY ++ IDAPK+LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           A+ LYDAKKDR+VAARDPIG+ TLYMGR SKSPKTVYFASELKCLTD CDSII+FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF P+W+DE RIPS P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IA+IAARETEKAN+  D       +K LAG+DD G+L ++GWS LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADADG-DASVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMN+DPK+KMIN  EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 420 VPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+D AE  ISD  F  PKA+WG+DIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRW+PKADWGCAEDPSGRYAKIHE+H+
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/572 (79%), Positives = 503/572 (87%), Gaps = 1/572 (0%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  F+H+ +E+FKP AL+L KRIRHRGPDWSGN I NST+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S D +Y+LGVNGE+YNHIQLRE+ S Y F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           A+ LYD+KKDR++AARDPIG+ TLYMGR SKSPKTVYFASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF PDW+DE R+P+ P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IA+IAARETE AN + +  +  +E   LAG+DD G+L ++GWS LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETETANVEANE-EASAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLD++FLQLCMN+DPK+KMIN+ EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID L+D AE  ISD  F  PKA WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+H++
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/571 (80%), Positives = 500/571 (87%), Gaps = 1/571 (0%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  F+H+ +  FKP AL+L K+IRHRGPDWSGN + NST+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S D  Y+LGVNGE+YNHIQLRE  S Y F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           A+ LYD+KKDRIVAARDPIG+ TLYMGR S+SP+TVYFASELKCLTD CDSII+FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF PDW+DE RIPS P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IA+IAARETEKAN+  +    + ++K LAG+DD G+L ++GWS LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADANE-DNNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLD++FLQLCMN+DP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+D AE AISD  F  PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/571 (79%), Positives = 492/571 (86%), Gaps = 2/571 (0%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF C+R   +E FKP ALRL KR+RHRGPDWSGN+IKN T++ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S D NY+L VNGE+YNHI LREE S Y F +LSDCEPIIPLY KY ++ P++LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD ++DRIVAARDPIG+TTLYMG+ S SP+T YFASELKCL D CD I AFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD++TRYF PDWIDE RIPS+P+D   +R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IASIAARETE+AN +   V  D   KHLAG+DD G L + GWS LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETERANREAGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSIHHEHTFTLQEGLDAL DVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMN+DP EKMI   +GRIEKYILRKAFDTSDEPG  PYLPEEILWRQKE
Sbjct: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAE AISDEQF  P   WGDDIPTTKEA+WYRLKFDALFPQ TA
Sbjct: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A+TVMRW+PKADWGCAEDPSGRYAKIH+QHI
Sbjct: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/573 (79%), Positives = 494/573 (86%), Gaps = 1/573 (0%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  FRH  V+E++P AL+L KRIRHRGPDWSGN++KNST++ HERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S   NY L VNGE+YNHIQLREE S YPF++LSDCEPIIPLY KYG+DAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD+K+DRIVAARDPIGITTLYMG+ SKSPKT +FASELKCL D+CD I+AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS++DQITRYFNP W+DE  +PS PLD   +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IASIAARETE+AN ++DPV YDSE+KHLAG+D  GNL + GWS LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDR+FL LCM LDP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAE AISDE    P+ EWGDD PTTKEAYWYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK 573
           A+TVMRWIPKADWGC  DPSGR+AKIHEQHID 
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/573 (77%), Positives = 501/573 (87%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF C+R   +E FKP AL+L KRIRHRGPDWSGN++KN T+  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P VS+D NY+L VNGE+YNHI LR+  + YPF TLSDCEPIIPL++KYG++ P YLDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYDAK DRIVAARDPIG+TTLYMG+ SKSP+T YFASELKCL + CD II+FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDQITRYF P W+ +   P++P+D  K+R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300
             IA+IAARETEKAN +MD VKYDS+ ++L GVDD  +L ++GWS LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSIHHEHTFT+QEGLDAL DVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           +KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDR+FL+LCMN+DP+EKMI   EG+IEKYILRKAFDTSDEP  +PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKDAAE AISDEQF QPK EWGDDIP+TKEAYWYR+KFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK 573
           ASTVMRW+PKA+WGC+EDPSGR+AKIHE+HI K
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHISK 573

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/579 (77%), Positives = 492/579 (84%), Gaps = 7/579 (1%)

Query: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60
           MCGIF  ++H  V  FKP AL+L KRIRHRGPDWSGN++KN+TL AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P  S   NY+L VNGE+YNHIQLREE + Y +KTL DCEPIIP+Y KY +DAP +LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           A+ LYD++KDR++AARDP+GITTLYMGR+SK+PKTVYFASELKCL D+CDSIIAFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+I RYF P+WIDE  IP+ P+DL ++R +LE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANSQMDPVKYDSED-------KHLAGVDDAGNLRSAGWSHLHSFAIG 293
             IASIAARETEK   + + + Y+ +        K L G+DD+GNL++  WS LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 294 LPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLS 353
           LP APDL+AARKVA FIGSIHHEH FT+QEGLDAL DVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 414 AWGLEARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEE 473
           AWGLEARVPFLDR+FL LCMN+DP +KMI   EG+IEKY+LRKAFDTSDEP  KPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 474 ILWRQKEQFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDA 533
           ILWRQKEQFSDGVGYSWID LKD AE  ISDE F  PK  WG DIPTTKEAYWYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 534 LFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572
           LFPQKTAA TVMRWIPKADWGCAEDPSGRYAKIHEQHID
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHID 579

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 122/504 (24%), Positives = 198/504 (39%), Gaps = 75/504 (14%)

Query: 1   MCGIFTC--------FRHQSVEEFK---PDAL----------RLVKRIRHRGPDWSGNII 39
           MCGI           F     +EFK   PDAL           L+K I  RGP+++    
Sbjct: 1   MCGILLNISPNDNLKFFQNEYKEFKENCPDALLNSNNDYTFSNLMKLISARGPNFASL-- 58

Query: 40  KNSTLMAHERLAIVGLDSGAQPFVSE----DNNYILGVNGEVYNHIQLREEFSSYPFKTL 95
              TL  H       + S  +PF  +    ++ Y+L  NGE+YN  ++    + +  K L
Sbjct: 59  --RTLKDHRISLFSSVLSLREPFCKQSVLVEDRYVLQFNGELYND-EIIHNDTQFIVKLL 115

Query: 96  SDCEPIIPLYEKYGIDAPKYLDGMFAWALYDAKKDRIVAARDPIGITTL-YMGRDSKSPK 154
            + E       K  I   K LDG FA+++YD K  R+   RDPIG  +L Y   D+    
Sbjct: 116 LNTEQ----NSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDPIGKRSLCYYLTDANELY 171

Query: 155 TVYFASELKCLTDNCDSIIAFPPGHVYDSETDQITRYFNPDWIDEDRIPSEPLDLLK--- 211
               +  +K    NCD+ + +       +    I      D+   D+   E   L K   
Sbjct: 172 VSSVSGSIKGFK-NCDAGVIYEYDATNKNSPLTIFNNIFEDFTINDKSDLEFKSLQKHIE 230

Query: 212 -IRHSLEKAVRKRLMA-----------EVPYXXXXXXXXXXXXIASIAARETEKANSQMD 259
            +   L  AVRKR+++            V +            I  +   E +KA  ++ 
Sbjct: 231 ELYKVLYNAVRKRVLSIHPTHIENSPIAVLFSGGLDCSVIVALICEVIRNEKKKAIIELL 290

Query: 260 PVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAP------DLQAARKVAKFIGSI 313
            V +++    L   D     R    S  +      PN P      D+     + K    I
Sbjct: 291 NVGFENPRTGLMPKDTPD--RKLAISSSYILQKLYPNVPIKLIEVDVPYDEYLEK--RPI 346

Query: 314 HHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQGVKMVL-SGEGSDE 372
             +  +  +  +D    + ++  +     I+  +      ++I+ +   +VL SG G+DE
Sbjct: 347 VIDLMYPKETEMDLSIAIAFYFASRGKGYIQTGS-----DKRIEYRRKGIVLFSGLGADE 401

Query: 373 IFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVPFLDREFLQLC 432
           ++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R PFLD   ++  
Sbjct: 402 LYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYPFLDEHVIKYS 460

Query: 433 MNLDPKEKMINAAEGRIEKYILRK 456
            +  P    IN    +I K ILRK
Sbjct: 461 THDIP----INY---KINKLILRK 477

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 114/478 (23%), Positives = 197/478 (41%), Gaps = 68/478 (14%)

Query: 23  LVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQPFVSED----NNYILGVNGEVY 78
           L+  I  RGP+++ ++   S + A    +++ L +   PF  +     + Y+L  NGE+Y
Sbjct: 44  LIPYIVRRGPNYA-SLRSLSEINAMLFSSVLSLRT---PFTKQSVMVQDRYLLQYNGELY 99

Query: 79  NHIQLREEFSSYPFKTLSDCEPIIPLYEKYGID-APKYLDGMFAWALYDAKKDRIVAARD 137
           N   +            SD E I  L EK+ ++   +   G FA+A+ D ++ ++   RD
Sbjct: 100 NDDTVEN-------CEHSDTEYISSLLEKHSVEEVVRKCYGEFAYAITDLQERKVYFGRD 152

Query: 138 PIGITTL-YMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPG--HVYDSETDQITR---- 190
            IG  +L Y+  D +    +Y  S    ++  CD       G  +++D  T Q+T     
Sbjct: 153 SIGKRSLSYILLDDE----LYITS----VSGRCDGFQNCLAGVIYIFDINTKQLTGSVKI 204

Query: 191 ----YFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXXXXXIASI 246
               Y   D ID D    E   + K+   L ++V +R++   P                 
Sbjct: 205 HDEPYIVSDQIDNDFQLLEEYKI-KLYECLRRSVYQRIVTIHPMHLENGNISILFSGGLD 263

Query: 247 AARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDLQAARKV 306
            +  T     Q+  +  +SE            L + G+ +  +  +   ++PD   A K 
Sbjct: 264 CSVITALLCEQLIKINRNSET--------IIELLNVGFENPRTGKMP-SDSPDRILAIKS 314

Query: 307 AKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPM--------FLLSR---K 355
           A+ +  ++ +    L E     +D + H +T        +T M        +  SR   K
Sbjct: 315 AQLLSELYPQVNIKLIEVDVPYTDYLSHKDTVIDLMYPKNTEMDLSIAIAFYFASRGRGK 374

Query: 356 IKAQGVK--------MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLR 407
           +   G          ++ SG G+DE++GGY  F+   S  E   E  K++  +H  +  R
Sbjct: 375 VTENGESKPYNRSGIVMFSGLGADELYGGYHKFSNK-SNEELVIELQKQIAQIHDRNLNR 433

Query: 408 ANKSTMAWGLEARVPFLDREFLQLCMNLDPKEKMINAAEGRI-EKYILRKAFDTSDEP 464
            +K     G+E R PFLD   +Q  ++L P    +N    R+  K ILR  F  S+EP
Sbjct: 434 DDKVISNHGIEVRYPFLDERVVQFSVDL-PLNYKVNKHILRVMAKDILRLDF-ISEEP 489

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 106/479 (22%), Positives = 191/479 (39%), Gaps = 92/479 (19%)

Query: 23  LVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQPFVSE----DNNYILGVNGEVY 78
           ++  I  RGP++S   +      A     +    S  QPF  +    +  Y+L  NGE+Y
Sbjct: 44  IIPYISARGPNYSSLRVSKKYKTAWYSSVL----SLRQPFTCQSIEIEERYVLQFNGELY 99

Query: 79  NHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALYDAKKDRIVAARDP 138
           NH ++    + Y    L +  P IP          K L+G FA+++YD +       RD 
Sbjct: 100 NH-EIVHNDTQYIVGLLKESAPSIPA-------IIKKLNGEFAYSIYDIQNGTFYFGRDT 151

Query: 139 IGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHVYDSETDQITRYFNPDW-- 196
           +G  +L    D  + +  Y AS    +T +  + I    G +Y   T   ++  N D   
Sbjct: 152 VGKRSLSYFLDENTGE-FYLAS----VTGSQPNFIDCTAGIIYQYSTR--SKKLNSDLSI 204

Query: 197 --------IDEDRIPSEPLDLLKIRHSLEKAVRKRLMA-------EVPYXXXXXXXXXXX 241
                     + ++   P  +  +   L KAV +R+++         P            
Sbjct: 205 SSPYEIATTMDQQLTKLPNCIDGLFEHLNKAVHRRIVSIHPAHIENSPISILFSGGLDCS 264

Query: 242 XIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLP-NAPDL 300
            IA++  ++      +  P+                 L + G+ +  +    LP + PD 
Sbjct: 265 VIAALICKQLSNIKKEKKPIL---------------ELLNVGFENPRTGM--LPKDVPDR 307

Query: 301 QAARKVAKFIGSIHHEHTFTL-------QEGLD---ALSDVIYHLETYDVTTIRASTPMF 350
           + A   ++ + +++ + T  L       +E L+    + D+++  +T    +I  S   F
Sbjct: 308 KLALSSSEILKNLYPDVTIKLVNIDVSYEEYLEYRPKVIDLMFPKQTEMDLSIAIS---F 364

Query: 351 LLSRK-----IKAQGVK--------MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV 397
             + K     I   G+K        ++ SG G+DE++GGY  FA   S  +   E  +++
Sbjct: 365 FFAAKGSGYTISKDGIKEKYQRKGIVLFSGLGADELYGGYHKFANK-SPDDLAIELTRQI 423

Query: 398 KNLHLADCLRANKSTMAWGLEARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRK 456
            N++  +  R +K     G+E R PFLD E ++      P    IN    ++ K ILRK
Sbjct: 424 NNIYDRNLNRDDKVIANNGVEVRYPFLDEEVIKFSTMEIP----INY---KVNKMILRK 475

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 127/521 (24%), Positives = 200/521 (38%), Gaps = 114/521 (21%)

Query: 1   MCGIFTC------FRHQSVEEFK------PDALRLVKR--------IRHRGPD---WSGN 37
           MCGI  C      F  + VE  +      P  L    R        I  RGP+   W G+
Sbjct: 1   MCGILLCRDPGRQFNDEHVEFAEAQPIEIPGGLDAQARWIASTLPCIAARGPNFASWRGS 60

Query: 38  IIKNSTLMAHERLAIVGLDSGAQPFVSE----DNNYILGVNGEVYN-HIQLREEFSSYPF 92
             + ST      L++       QPF  +    D  Y+L  NGE+YN  I+  +  + Y  
Sbjct: 61  A-EYSTAWFSSVLSL------RQPFTKQSLVVDGRYVLQFNGELYNDEIEFND--TQYIA 111

Query: 93  KTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALYDAKKDRIVAARDPIGITTL-YMGRDSK 151
             L+  E  IP       D    LDG FA+ +YD +  +    RD IG  +L Y    SK
Sbjct: 112 DMLARGEASIP-------DIIARLDGEFAYTIYDTEDQKYYFGRDAIGKRSLSYYVNTSK 164

Query: 152 SPKTVYFASELKCLTD----NCDSIIAFPPGHVYDS------ETDQITRYFNPDWIDEDR 201
               +Y +S    + D    +C + I +    +YD+      +++ I+  +    + ++ 
Sbjct: 165 D--QLYVSSVTGRVEDIEFRDCIAGIIY----IYDAKNQHLDDSNHISDPYTVSPLVDEN 218

Query: 202 IPSEPLDLLKIRHSLEKAVRKRLMAEVPYXXXXXXXXX--------XXXIASIAARETEK 253
                  + K+   L  AV KR+ +  P                     +A I  + + K
Sbjct: 219 FTERGEHIEKLHFQLNLAVEKRINSIHPNHIENSPISVLFSGGLDCSVIVALICNQLSGK 278

Query: 254 A------------NSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHS------FAIGLP 295
           A            N +   V  DS D+ LA ++    L+     HL+         I +P
Sbjct: 279 ARKTVELLNVGFENPRTGLVPSDSPDRKLA-IESYKTLQ-----HLYPDIDIRLIEIDVP 332

Query: 296 NAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRK 355
               L+A  KV   +        F  Q  +D    + ++  +    +I   +       K
Sbjct: 333 YEEYLRAKPKVIDLM--------FPKQTEMDLSIAIAFYFASKGEGSITDKST----KGK 380

Query: 356 IKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMA 414
           I  Q   +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  +  R +K   +
Sbjct: 381 IAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIAS 439

Query: 415 WGLEARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILR 455
            G+E R PFLD   ++      P    IN       K ILR
Sbjct: 440 NGVEIRYPFLDSSVVKFSTEDLPINYKIN-------KLILR 473

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 414 AWGLEARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRK 456
           A G+E R PFLDR  ++  M   P    IN    +I K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIP----IN---WKINKLILRK 471

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 83/180 (46%), Gaps = 27/180 (15%)

Query: 60  QPFVSED----NNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKY 115
           +PF+ +     + YIL  NGE+YN  ++ +  +S+    L + +  +        +   +
Sbjct: 75  EPFIRQSVEVGDRYILQFNGELYNE-EILDNDTSFVASLLENDKMSV-------FEVISF 126

Query: 116 LDGMFAWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFAS---ELKCLTDNCDSI 172
           L+G FA+ +YD  + ++   RD IG  +L    D ++   +Y AS   + +  TD    I
Sbjct: 127 LEGEFAYTIYDMHEHKLYFGRDDIGKRSLSYRLD-QAIGDIYVASVTGQQEGFTDCLAGI 185

Query: 173 IAFPPGHVYDSETDQITRYFNPDWIDEDRIPSEPL----DLLKIRHSLEKAVRKRLMAEV 228
           +     ++YD E   + +   P  I    + SE +    +  +I H+L + ++  ++  V
Sbjct: 186 V-----YIYDVEDKSLNQQMLP--ILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRV 238

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 7/105 (6%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 423 FLDREFLQLCMNLDPKEKMINAAEGR---IEKYILRKAFDTSDEP 464
           FLD E +Q  ++  P    +N    R   +EK  LR   D + EP
Sbjct: 450 FLDEEVIQYSVSQIPISYKVNKGILRKLALEKLQLR---DIAQEP 491

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 97/226 (42%), Gaps = 44/226 (19%)

Query: 23  LVKRIRHRGPDWSGNIIKNSTLMAHERLAIV---GLDSGAQPFVSE----DNNYILGVNG 75
           ++  I  RGP++S       +L  +    I     + S  QPF  +    D  Y+L  NG
Sbjct: 46  IIPYIVSRGPNYS-------SLRVNREHGISWFSSILSLRQPFTRQSIVVDERYVLQFNG 98

Query: 76  EVYNHIQLREEFSSYPFKTLSDCE-PIIPLYEKYGIDAPKYLDGMFAWALYDAKKDRIVA 134
           E+YN  ++    + Y    L  C+  ++ L  K        LDG FA+ +YD K+  I  
Sbjct: 99  ELYNS-EISGNDTQYIVSLLKSCDGDVVSLVRK--------LDGGFAYTIYDLKEGNIYF 149

Query: 135 ARDPIGITTLYMGRDSKSPKTVYFASELK----CLTDNCDSIIAFPPGHVYDSETDQI-- 188
            RD IG  +L    D  S +   F S +        D    +I     + YD++T  +  
Sbjct: 150 GRDTIGKRSLCYSIDENSGEL--FISSVTGTRGTFVDCLGGVI-----YTYDTKTHTLDD 202

Query: 189 -----TRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVP 229
                 +Y   D  DE    S+ ++LL    +L ++V+KR+++  P
Sbjct: 203 TKVIRDKYVVTDMTDELENESQYMELL--YGTLYESVKKRVLSIHP 246

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (54%), Gaps = 9/99 (9%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  K++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 417 LEARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILR 455
           +E R PFLD    +  +N   KE  IN    +I K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKEIPINY---KINKKILR 477

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 99/221 (44%), Gaps = 30/221 (13%)

Query: 23  LVKRIRHRGPDWSG-NIIKNSTLMAHERLAIVGLDSGAQPFVSE----DNNYILGVNGEV 77
           +V  I  RGP++    + K+  +  +  +      S  +PF  +    ++ YIL  NGE+
Sbjct: 43  IVPYIARRGPNYQMFRVFKSEQISWYSSIL-----SLRKPFTKQSIEVNDRYILQFNGEL 97

Query: 78  YNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALYDAKKDRIVAARD 137
           YN+       ++Y    L        L EK  I+  + L+G FA+ ++D+KK  +   RD
Sbjct: 98  YNNEIHGISDTTYFVNCLKTA-----LDEKDIINILRTLEGEFAYTIFDSKKKLVYFGRD 152

Query: 138 PIGITTLYMGRDSKSPKTVYFASELKCLT--DNCDSIIAFPPGHVYDSETDQITR----- 190
            IG  +L    D ++ + +Y +S    +    NC   I +    +Y+ E  Q+       
Sbjct: 153 TIGKRSLGYKLDYETNE-LYISSATGDVEGFKNCVGGIVY----IYNIEKKQLDEENMIR 207

Query: 191 --YFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVP 229
             Y     +DE    +  L + K+  SL ++V KR+++  P
Sbjct: 208 EPYTVSAEVDEGESRANEL-IAKLYDSLYESVEKRVLSIHP 247

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 59/113 (52%), Gaps = 12/113 (10%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKA---FDTSDEPGAKP 468
            R PFLD    +  +NL   E  IN    ++ K ILRK    F   DE   +P
Sbjct: 448 VRYPFLD----EYVINLSTLEIPINY---KVNKLILRKVASLFLKLDEIAEEP 493

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (45%), Gaps = 22/148 (14%)

Query: 3   GIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSG-NIIKNSTLMAHERLAIVGLDSGAQP 61
           G  TC    S+        R++  I  RGP++S   +IK     AH+      + S  +P
Sbjct: 29  GKTTCVNESSIFN------RIIPYIAARGPNYSSLRVIK-----AHQTRWFSSVLSLRRP 77

Query: 62  F----VSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYE-KYGIDAPKYL 116
           F    ++ D+ Y L  NGE+YN     +E S +   +L     +  L + +  +D  + L
Sbjct: 78  FTKQSINVDDRYHLQFNGELYN-----KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSL 132

Query: 117 DGMFAWALYDAKKDRIVAARDPIGITTL 144
           +G +A+ +YD K       RDPIG  +L
Sbjct: 133 EGEYAYTVYDVKSSIFYFGRDPIGKRSL 160

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 423 FLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKA 457
           FLD   +Q       +E  IN    ++ K ILRK 
Sbjct: 447 FLDHNVVQ----FSTQEIPINY---KVNKLILRKV 474

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 95/217 (43%), Gaps = 24/217 (11%)

Query: 23  LVKRIRHRGPDWSGNIIKNSTLMA-HERLAIVGLDSGAQPFVSEDNNYILGVNGEVYN-H 80
           ++  I +RGP++S   +      A    +  + L    Q    ED  Y+L  NGE+YN  
Sbjct: 42  IIPHIANRGPNYSSLRLSEKYHTAWFSSVLALRLPFTKQSLCVEDR-YVLQFNGELYNKE 100

Query: 81  IQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALYDAKKDRIVAARDPIG 140
           I+  +  + +    LS    +I    +        LDG FA+ +YD ++ +I   RD IG
Sbjct: 101 IKQDQNDTQFIASLLSSSTDVIHTLTQ--------LDGEFAYTIYDLRETKIYFGRDSIG 152

Query: 141 ITTLYMGRDSKSPKTVYFASELKCLT--DNC--DSIIAFPPGHVYDSETDQIT--RYFNP 194
             +L    D+ +   +Y AS    +   +NC    I  F       SE  +I   +Y   
Sbjct: 153 KRSLCFKMDTTNG--LYVASCTGNIEGFENCLGGVIYIFDLNERTISEHSKIIQRQYEVV 210

Query: 195 DWIDEDRIPSEPLDLL--KIRHSLEKAVRKRLMAEVP 229
           D IDE+    E LD +  K+   L ++V KR+ +  P
Sbjct: 211 DLIDENM---ETLDSMKEKLYTVLNESVSKRVTSIHP 244

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 9/94 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 423 FLDREFLQLCMNLDPKEKMINAAEGRIEKYILRK 456
           FLD + ++  + L    K         +K ILRK
Sbjct: 441 FLDEKVIKASVALPISYKN--------DKMILRK 466

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 79/194 (40%), Gaps = 33/194 (17%)

Query: 21  LRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQPFVSED----NNYILGVNGE 76
           LRLV  I  RGPD++   ++    +A        + S  QP   +     + YIL  NGE
Sbjct: 42  LRLVPYIMARGPDYASYRLEAGMGLAW----FSSVLSLRQPLTPQSMAVGDRYILQFNGE 97

Query: 77  VYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAP-KYLDGMFAWALYDAKKDRIVAA 135
           ++N     E+         +D + I  L   + + A  + + G FA+ ++D +   +   
Sbjct: 98  LFN-----EDIQH------NDTQYIADLLASWPVTAVIRQMYGEFAYTIFDRQDGLLYFG 146

Query: 136 RDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHVYDSETDQITRYFNPD 195
           RD +G  +L    D +       + + +    NCD+      G +Y  +  Q T      
Sbjct: 147 RDNVGKRSLCYRLDGRELHVASVSGKSQGFL-NCDA------GVIYTFDVHQKTLRM--- 196

Query: 196 WIDEDRIPSEPLDL 209
              E+RI + P  +
Sbjct: 197 ---EERICASPFTV 207

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  K++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 423 FLDREFLQLCMNLDPKEKMINAAEGRIEKYILRK 456
           FLD + ++       +E  IN    +I K ILRK
Sbjct: 455 FLDIDVIK----FSTEELPINY---KINKLILRK 481

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 102/233 (43%), Gaps = 33/233 (14%)

Query: 11  QSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIV---GLDSGAQPFVSE-- 65
           +S     P    ++  I  RGP++S       +    ++ +I     + S  +PF  +  
Sbjct: 33  KSCSNIDPIFNSMISDIAARGPNYS-------SFKVSKQYSITWFSSVLSLREPFTKQCV 85

Query: 66  --DNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWA 123
              + Y++  NGE+YN  +++   + Y  + L + + II        D  + LDG FA+ 
Sbjct: 86  EIKDRYVVQFNGELYND-EIQYNDTQYTIQLLKEGKEII--------DVIRKLDGEFAYT 136

Query: 124 LYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHVYDS 183
           +YD +       RDPIG   L    D+++ + +Y +S   C T   D I      + YD 
Sbjct: 137 IYDIQNRMFYFGRDPIGRRCLSFSIDNETGE-LYISSVTGCKTGFQDCIAG--TIYKYDC 193

Query: 184 ETDQITR-------YFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVP 229
           +  ++         ++  + +D++ +     ++ K+   L  +V KR+++  P
Sbjct: 194 QLKELNTDSKISKPFYVSEELDDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 423 FLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKA 457
           FLD    +  + L   E  IN    ++ K ILRK 
Sbjct: 452 FLD----EYVIKLSTAEIPINF---KVNKLILRKV 479

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 60/128 (46%), Gaps = 14/128 (10%)

Query: 22  RLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQPF----VSEDNNYILGVNGEV 77
           +++  I  RGP++S        + A+       + S  QPF    ++ D+ Y L  NGE+
Sbjct: 42  KIIPYIAARGPNYSSL----RAVKAYRISWFSSVLSLRQPFTKQSINVDDRYFLQFNGEL 97

Query: 78  YNHIQLREEFSSYPFKTLSDCEPIIPLYEKYG-IDAPKYLDGMFAWALYDAKKDRIVAAR 136
           YN     +E S     +L     +  L E  G ID  K L+G +A+ +YD    ++   R
Sbjct: 98  YN-----KEISQGDNDSLYIASMLQNLKEGMGVIDVIKSLEGEYAYTIYDVNSSKLYFGR 152

Query: 137 DPIGITTL 144
           DPIG  +L
Sbjct: 153 DPIGRRSL 160

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKA 457
            R PFLD   ++      P    IN    +I K ILR  
Sbjct: 448 VRYPFLDEHVIKFSAVDIP----INF---KINKLILRNV 479

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 59/128 (46%), Gaps = 14/128 (10%)

Query: 22  RLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQPF----VSEDNNYILGVNGEV 77
           R++  I  RGP++S   +      A++      + S  QPF    +S D+ Y L  NGE+
Sbjct: 42  RIIPYIAARGPNYSSLRVSK----AYQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGEL 97

Query: 78  YN-HIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALYDAKKDRIVAAR 136
           YN  I   +  S Y    L +        +   ID  + L+G +A+ +YD K  +    R
Sbjct: 98  YNKEISDDDNDSQYIASLLQNLTG-----DGDVIDVIRMLEGEYAYTVYDVKASKFYFGR 152

Query: 137 DPIGITTL 144
           DPIG  +L
Sbjct: 153 DPIGRRSL 160

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 423 FLDREFLQLCMNLDPKEKMINAAEGRIEKYILRK 456
           FLD + ++      P    IN    ++ K ILR+
Sbjct: 449 FLDHDVIKFSTEEIP----INY---KVNKMILRR 475

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 113/263 (42%), Gaps = 51/263 (19%)

Query: 1   MCGIFT----------CFRHQSVEEF--------KPDAL--RLVKRIRHRGPDWSGNIIK 40
           MCGI            CF  + VE+         K  A    +V  I+ RGPD+S   + 
Sbjct: 1   MCGILLHYAPLKSDNHCFVDEYVEDIADGHSQRSKTTAFFDSMVPYIKSRGPDYSSLRVS 60

Query: 41  NSTLMAHERLAIVGLDSGAQPFVSED----NNYILGVNGEVYNHIQLREEFSSYPFKTLS 96
           +     H       + S  +PF S+     N +IL  NGE+YN     +E +++     +
Sbjct: 61  SE----HSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYN-----QEITAHD----N 107

Query: 97  DCEPIIP-LYEKYG--IDAPKYLDGMFAWALYDAKKDRIVAARDPIGITTLYMGRDSKSP 153
           D + I+  L E Y       + L G FA+ LYD ++ +    RD +G  +L     + + 
Sbjct: 108 DTQFIVSKLQEGYHDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNVGKRSLSYHLSAITG 167

Query: 154 KTVYFASELKCLTDNCDSIIAFPPGHVYDSETDQI-------TRYFNPDWIDEDRIPSEP 206
           + +Y +S    +    D I      +VYD+E+  +       ++YF    +DE+ +    
Sbjct: 168 E-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQYFITKKLDEE-LTCLD 223

Query: 207 LDLLKIRHSLEKAVRKRLMAEVP 229
             + ++   L  AVRKR+++  P
Sbjct: 224 STVEQLYGMLSLAVRKRVLSIHP 246

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLE 418
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 419 ARVPFLDREFLQLCMNL 435
            R PFLD + +Q    L
Sbjct: 445 VRYPFLDEKVVQFSTEL 461

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 86/176 (48%), Gaps = 29/176 (16%)

Query: 22  RLVKRIRHRGPDWSGNIIKNSTLMAHERLA-IVGL-DSGAQPFVSEDNNYILGVNGEVYN 79
           RL+  I +RGP+++   I+NS+       + I+ L D   +  V  ++ ++L  NGE+YN
Sbjct: 44  RLIPYIINRGPNYAS--IRNSSKYGISWFSSILSLRDPLTRQSVKINDRFVLQYNGELYN 101

Query: 80  H-IQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKY---LDGMFAWALYDAKKDRIVAA 135
             IQ             +D   I  L E+Y  D PK    ++G FA+ ++D + +++   
Sbjct: 102 SSIQH------------NDTLFIASLIERYQDDIPKAIREMEGEFAYTIFDKQCEKLYFG 149

Query: 136 RDPIGITTLYMGRDSKSPKTVYFASELKCLT---DNCDSIIAFPPGHVYDSETDQI 188
           RD IG  +L    DS++ K   F S +   +   ++C+    +    +YDS+T  +
Sbjct: 150 RDTIGKRSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IYDSKTGNL 199

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 363 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARV 421
           ++LSG G+DE++GGY  FA +AP   E   E  K++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 422 PFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKA 457
           PFLD    +  +     E  IN    ++ K ILRK 
Sbjct: 451 PFLD----EYVIKFSTVEIPINY---KVNKLILRKV 479

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 64/147 (43%), Gaps = 20/147 (13%)

Query: 3   GIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQPF 62
           G  TC    S+        +++  I  RGP++S       T+ A+       + S  +PF
Sbjct: 29  GPTTCVNESSIFN------KIIPYIAARGPNYSSL----RTVRAYRTSWFSSVLSLREPF 78

Query: 63  ----VSEDNNYILGVNGEVYN-HIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLD 117
               ++ D+ Y L  NGE+YN  +      S Y    L D E      +   ID  K L+
Sbjct: 79  TKQSINVDDRYYLQFNGELYNKEVSHWGNDSLYIASLLKDLED-----DGSVIDVIKSLE 133

Query: 118 GMFAWALYDAKKDRIVAARDPIGITTL 144
           G +A+ +YD K  +    RDPIG  +L
Sbjct: 134 GEYAYTVYDVKSAKFYFGRDPIGRRSL 160

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 354 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKST 412
           + I  Q   +VL SG G+DE++GGY  F    S      E  K++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 413 MAWGLEARVPFLDREFLQLCMNL 435
              G+E R PFLD E + L  +L
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSL 457

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 65/136 (47%), Gaps = 20/136 (14%)

Query: 22  RLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQPFVSED----NNYILGVNGEV 77
           +++  I  RGP+++   ++ S   AH       + S  +P   +     + YIL  NGE+
Sbjct: 44  KMIPYIVDRGPNFAS--VRTSK--AHGITWFSSVLSLRRPLCKQSIKVHDRYILQYNGEL 99

Query: 78  YNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAP-KYLDGMFAWALYDAKKDRIVAAR 136
           YN     ++ S       +D + I  L EK  +D   + L G FA+++Y+ K   I   R
Sbjct: 100 YN-----DDISH------NDSQYIAGLLEKLPVDVVLRRLYGEFAYSIYNTKTKCIYFGR 148

Query: 137 DPIGITTLYMGRDSKS 152
           D +G  +L   +D+++
Sbjct: 149 DSVGKRSLSYHQDNET 164

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 417 LEARVPFLDREFLQLCMNL 435
           +E R PFLD   ++    L
Sbjct: 442 VEVRYPFLDDRVIEFSTQL 460

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 68/167 (40%), Gaps = 33/167 (19%)

Query: 1   MCGIF------TCFRHQSVEEFKPDAL----------------RLVKRIRHRGPDWSGNI 38
           MCGI       +C    S  EF  + L                 L+  I  RGP+++ ++
Sbjct: 1   MCGILLSHYGESCPLEDSFHEFGEEELARGDLLPHTRQLGFLQTLIPHIVDRGPNYA-SL 59

Query: 39  IKNSTLMAHERLAIVGL-DSGAQPFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSD 97
             ++T  A    +I+ L +   +  +  ++ ++L  NGE+YN   +    + Y    LS 
Sbjct: 60  KSSATDAAVWFTSILSLREPLTKQCIDINDRFVLQYNGEIYNS-SIAHNDTQYIATELSI 118

Query: 98  CEPIIPLYEKYGIDAPKYLDGMFAWALYDAKKDRIVAARDPIGITTL 144
            + +  +  K        L G FA+ +YD     I   RD +G  +L
Sbjct: 119 VQNVPTVIRK--------LSGEFAYTVYDRATGEIFFGRDGVGKRSL 157

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 72/167 (43%), Gaps = 34/167 (20%)

Query: 1   MCGIFTCF------RHQSVEEFKPDAL----------RLVKRIRHRGPDW-SGNIIKNST 43
           MCGI  C+       +  + EF  D +           +VK +R RGP++ S   IK+  
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 44  LMAHERLAIVGLDSGAQPFVSED----NNYILGVNGEVYNHIQLREEFSSYPFKT--LSD 97
                 + I  + S  QPF  +     N Y+L  NGE+YN  ++ E  +   F +  L  
Sbjct: 61  -----SIWISSVLSLRQPFTKQSIVIGNKYVLQFNGELYND-EIIESGNDTQFLSGLLKK 114

Query: 98  CEPIIPLYEKYGIDAPKYLDGMFAWALYDAKKDRIVAARDPIGITTL 144
           C     + E    +    LDG FA+ + D + + I   RD IG  +L
Sbjct: 115 C-----ISEDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSL 156

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 6/93 (6%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 414 AWGLEARVPFLDREFLQLCMNLDP----KEKMI 442
           + G+E R PFL  E ++      P    ++KMI
Sbjct: 442 SNGVEVRYPFLAEEVVEFSTASIPLNYKRDKMI 474

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 423 FLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKA 457
           FLD + +     L    K        + K ILRK 
Sbjct: 448 FLDDQVVAFSTQLPINYK--------VNKMILRKV 474

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 13/99 (13%)

Query: 60  QPFVSE----DNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKY 115
           +PF  +    ++ ++L  NGE+YN   +    + Y  + L + + I  +         + 
Sbjct: 78  EPFTKQCIEVEDRFVLQYNGEIYNS-SISHNDTQYIAEMLLNAKDIPSVI--------RT 128

Query: 116 LDGMFAWALYDAKKDRIVAARDPIGITTLYMGRDSKSPK 154
           L G FA+ +YD     +   RDPIG  +L    D+   K
Sbjct: 129 LSGEFAYTIYDKLTGEVFFGRDPIGRRSLSFKLDTGDSK 167

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 35.4 bits (80), Expect = 0.037,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 14/89 (15%)

Query: 102 IPLYEKYGIDAPKYLDGMFAWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASE 161
           +P Y +  IDAPK+L+ MFA++    +K              ++ G      +T +  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCCC--------CKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LTDNCDSIIAFPPGHVYDSE 184
             L C    LT  CD+  +F PG V+DSE
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>Kpol_1071.9 s1071 complement(17560..20433) [2874 bp, 957 aa] {ON}
           complement(17560..20433) [2874 nt, 958 aa]
          Length = 957

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 19/111 (17%)

Query: 23  LVKRIRHRGPDWSGNIIKNSTLMAHERL--AIVGLDSGAQPFVSEDNNYILGVNGEVYNH 80
           +++RI  RG  ++   +  S      +L   ++  +    P VS+D NYI  +       
Sbjct: 329 VIRRILRRGARYARKYMNYSIGDFFSKLIPQVIEENKSIFPEVSKDFNYIKEI------- 381

Query: 81  IQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKY----LDGMFAWALYDA 127
             L EE +S+  KTL   E    L+EKY  DA K     LDG+  W LYD 
Sbjct: 382 --LDEEEASFA-KTLDRGEK---LFEKYASDASKLDSKTLDGLQVWRLYDT 426

>KNAG0B02660 Chr2 (514239..516716) [2478 bp, 825 aa] {ON} Anc_7.339
           YLR207W
          Length = 825

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 46/124 (37%), Gaps = 12/124 (9%)

Query: 101 IIPLYEKYGIDAPKYLDGMFAWALYDAKKD--RIVAARDPIGITTLYMGRDSKSPKTVYF 158
           I P  E + I  P + DG+    L   K    RI +AR  I  + L   R          
Sbjct: 227 IFPYTESFNIRLPDFDDGLLGPQLSSTKLSTIRIKSARPDITSSVLTKMR---------- 276

Query: 159 ASELKCLTDNCDSIIAFPPGHVYDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEK 218
             ++    +N D   +F  G   +   DQI   F   W +     +   D LK R  LE 
Sbjct: 277 GGDIMLRFNNVDESSSFALGSDLEDNDDQIVDLFYIAWDEYKGTYTRARDCLKARKLLEF 336

Query: 219 AVRK 222
           +V +
Sbjct: 337 SVEE 340

>CAGL0L05588g Chr12 complement(608227..609168) [942 bp, 313 aa] {ON}
           similar to uniprot|P47016 Saccharomyces cerevisiae
           YJL126w NIT2 nitrilase
          Length = 313

 Score = 30.8 bits (68), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 256 SQMDPVKYDSEDKH-LAGVDDAGNLRSAGWSHLHSFAIGLPNAPDLQAARKV 306
           S+ D +K D   K+ L  +D +G +RS+ ++ LH F + +PN P L+ ++ V
Sbjct: 97  SEQDILKGDDRVKNVLLYIDSSGVIRSS-YTKLHLFDVDVPNGPILKESQSV 147

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,040,672
Number of extensions: 2620223
Number of successful extensions: 6007
Number of sequences better than 10.0: 51
Number of HSP's gapped: 6074
Number of HSP's successfully gapped: 71
Length of query: 573
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 458
Effective length of database: 40,294,809
Effective search space: 18455022522
Effective search space used: 18455022522
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)