Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F12562g7.126ON2932729021e-122
Kwal_55.208397.126ON3051665632e-70
NDAI0H013107.126ON2611585174e-64
KAFR0K012007.126ON2021984854e-60
ZYRO0C05214g7.126ON2701454812e-58
SAKL0F05368g7.126ON2311544763e-58
KNAG0G010207.126ON2071484725e-58
KLLA0D14333g7.126ON2052044682e-57
CAGL0C03850g7.126ON2092054594e-56
Kpol_1062.577.126ON2191494596e-56
TDEL0H028807.126ON3541484672e-55
TPHA0C043307.126ON2091484518e-55
Skud_9.1627.126ON2171494483e-54
YIL010W (DOT5)7.126ON2151504441e-53
Ecym_83517.126ON2241544423e-53
Suva_9.1947.126ON2151494388e-53
TBLA0A009407.126ON2881514449e-53
ADL018W7.126ON2441514401e-52
Smik_9.1847.126ON2141494352e-52
NCAS0F008107.126ON2311504338e-52
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F12562g
         (293 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   352   e-122
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   221   2e-70
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   203   4e-64
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   191   4e-60
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   189   2e-58
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   187   3e-58
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   186   5e-58
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   184   2e-57
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   181   4e-56
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   181   6e-56
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   184   2e-55
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   178   8e-55
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   177   3e-54
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   175   1e-53
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   174   3e-53
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   173   8e-53
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   175   9e-53
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   174   1e-52
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   172   2e-52
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   171   8e-52

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  352 bits (902), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/272 (69%), Positives = 190/272 (69%)

Query: 1   MVELRRSTRKKSSDAPKRXXXXXXXXXXXXXTKKAKTNGSKGELEEGDEVPDVVLKNQEG 60
           MVELRRSTRKKSSDAPKR             TKKAKTNGSKGELEEGDEVPDVVLKNQEG
Sbjct: 1   MVELRRSTRKKSSDAPKRAPEEEEVAPNAPETKKAKTNGSKGELEEGDEVPDVVLKNQEG 60

Query: 61  EEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEELKKNAAVFGLSTDTPNAQQ 120
           EE               FAYPKASTPGCTKQACGFRDNYEELKKNAAVFGLSTDTPNAQQ
Sbjct: 61  EEVSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRDNYEELKKNAAVFGLSTDTPNAQQ 120

Query: 121 KFKEKNSLPFDLLSDPQRKLIGPLGASKSPSGTKRSYWVFVQGKLRTKRISVSPEASVSE 180
           KFKEKNSLPFDLLSDPQRKLIGPLGASKSPSGTKRSYWVFVQGKLRTKRISVSPEASVSE
Sbjct: 121 KFKEKNSLPFDLLSDPQRKLIGPLGASKSPSGTKRSYWVFVQGKLRTKRISVSPEASVSE 180

Query: 181 AKKEAIEAAQTDDGENAKEEVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           AKKEAIEAAQTDDGENAKEEVK                                      
Sbjct: 181 AKKEAIEAAQTDDGENAKEEVKEEQDGEVSGEDEVDGNDEDDEDFNEQEGEDPELEEVGQ 240

Query: 241 XXXXXXXXXXXXXXXXSEADVEGGNDDSVDAK 272
                           SEADVEGGNDDSVDAK
Sbjct: 241 EEDEEYEEGDLKKDEDSEADVEGGNDDSVDAK 272

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  221 bits (563), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 129/166 (77%)

Query: 37  TNGSKGELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFR 96
           ++ S+GELE GDEVPDVVLKNQ+ EE               F+YPKASTPGCT QACGFR
Sbjct: 40  SDSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFR 99

Query: 97  DNYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSPSGTKRS 156
           DNYE+LK+  AVFGLS DTP AQ+KF++ +SLPFDLLSDP+R+LIG LGA KSPSGTKRS
Sbjct: 100 DNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSPSGTKRS 159

Query: 157 YWVFVQGKLRTKRISVSPEASVSEAKKEAIEAAQTDDGENAKEEVK 202
           +WVF  GKL  KRI+VSPE S+ +AK EA EAA+ DD +N K++VK
Sbjct: 160 HWVFANGKLINKRIAVSPEVSIRDAKTEAHEAAKGDDEDNEKKDVK 205

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  203 bits (517), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 96/158 (60%), Positives = 118/158 (74%), Gaps = 1/158 (0%)

Query: 34  KAKTNGSKGELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQAC 93
           K+  N S  ELE GD++PD+ L NQ G+E               FA+P+ASTPGCT+QAC
Sbjct: 99  KSANNDSIIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQAC 158

Query: 94  GFRDNYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SG 152
           GFRDNY+ELKKNA VFGLS D  ++Q+KF+EK  LP+DLLSDP+R+LIG LGA K+P SG
Sbjct: 159 GFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSG 218

Query: 153 TKRSYWVFVQGKLRTKRISVSPEASVSEAKKEAIEAAQ 190
           T RSYW+FV+GKL  KRI VSPE SV+E+KKE IE A+
Sbjct: 219 TVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAK 256

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  191 bits (485), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 97/198 (48%), Positives = 130/198 (65%), Gaps = 9/198 (4%)

Query: 2   VELRRSTRKKS--------SDAPKRXXXXXXXXXXXXXTKKAKTNGSKGELEEGDEVPDV 53
           ++LR STR K+         D  +R             T ++  N S  EL+ GD +PD+
Sbjct: 1   MQLRNSTRIKAKVLFEDIEDDKERRPEKKRRVTISKEETVESSGNVSSSELQIGDIMPDI 60

Query: 54  VLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEELKKNAAVFGLST 113
            L NQ+ ++               FAYPKASTPGCT+QACGFRDNY+E+KK+AAVFGLS 
Sbjct: 61  TLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEIKKHAAVFGLSA 120

Query: 114 DTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFVQGKLRTKRISV 172
           D+  +Q++F+EK +LPF+LLSDP+R+LIG LGA K+P SG  RS+WVF+ GKLR + I V
Sbjct: 121 DSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFLDGKLRFRNIKV 180

Query: 173 SPEASVSEAKKEAIEAAQ 190
           SPE S+SE+KKE +E A+
Sbjct: 181 SPERSISESKKEVMELAE 198

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  189 bits (481), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 107/145 (73%), Gaps = 1/145 (0%)

Query: 47  GDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEELKKNA 106
           GD +PD++LKNQ+G+E               F YPKASTPGCT+QACGFRDNYE++K++A
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 107 AVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFVQGKL 165
           AVFGLS DT NAQ+KF+EK  LPFDLLSDP+R L+G LGA KSP SG  RS+WVF  G L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 166 RTKRISVSPEASVSEAKKEAIEAAQ 190
           + KR+ +SPE S+ E KKE +E  +
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELVK 239

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  187 bits (476), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 114/154 (74%), Gaps = 1/154 (0%)

Query: 38  NGSKGELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRD 97
           N +  ELE GD++PD++LKNQ+ ++               FAYPKASTPGCT+Q CG+RD
Sbjct: 68  NPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGYRD 127

Query: 98  NYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRS 156
           NYE+LK++AAVFGLS DT  AQ+ F+ K SLP+DLLSDP+R+ IG LGA K+P SG  RS
Sbjct: 128 NYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVIRS 187

Query: 157 YWVFVQGKLRTKRISVSPEASVSEAKKEAIEAAQ 190
           +WVF +GKLR KR+ +SPE SV++ KKE +E A+
Sbjct: 188 HWVFSEGKLRFKRVKISPETSVADGKKEVLELAK 221

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  186 bits (472), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 87/148 (58%), Positives = 108/148 (72%), Gaps = 1/148 (0%)

Query: 44  LEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEELK 103
           LE GDE+PD+ L +QEGE                FAYP+ASTPGCT+QACGFRDNY ELK
Sbjct: 58  LEIGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQACGFRDNYAELK 117

Query: 104 KNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASK-SPSGTKRSYWVFVQ 162
           K+AAV+GLS DT  +Q+KF+ K +LP++LLSDP+R+ IG LGA K S SG  RSYW+F  
Sbjct: 118 KHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQSGIIRSYWIFFN 177

Query: 163 GKLRTKRISVSPEASVSEAKKEAIEAAQ 190
           GKLR K+I VSPEASV+E+K E +E  +
Sbjct: 178 GKLRIKKIKVSPEASVAESKAEVLELVK 205

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  184 bits (468), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 97/204 (47%), Positives = 122/204 (59%), Gaps = 13/204 (6%)

Query: 1   MVELRRSTRKKSSDAP-KRXXXXXXXXXXXXXTKKAKTNGSK-----------GELEEGD 48
           MVELRRS R  +   P                +K  K NG K            EL+ GD
Sbjct: 1   MVELRRSNRISAKKEPLDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLAELQIGD 60

Query: 49  EVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEELKKNAAV 108
           ++PD+ L NQ+ E                FAYPKASTPGCT+QACG+RDNY ELK++AAV
Sbjct: 61  DIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHAAV 120

Query: 109 FGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFVQGKLRT 167
           FGLS D P +Q+ F+ K +LPFDLLSDP+R+ IG LGA K+  SG  RS+W+F  GKL  
Sbjct: 121 FGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKLEV 180

Query: 168 KRISVSPEASVSEAKKEAIEAAQT 191
           KR+ VSPE S+ E KKE +E A++
Sbjct: 181 KRVQVSPEVSIEEGKKEVLELAKS 204

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  181 bits (459), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 94/205 (45%), Positives = 127/205 (61%), Gaps = 16/205 (7%)

Query: 2   VELRRSTR---------------KKSSDAPKRXXXXXXXXXXXXXTKKAKTNGSKGELEE 46
           +ELRRSTR               KK + +  +             TK+ K +  +  LE 
Sbjct: 1   MELRRSTRLSAKHGNEVKDEGPIKKKAKSVLKEKVNTKEPVKKPNTKEEKVSSDEAILEV 60

Query: 47  GDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEELKKNA 106
           GD++PD+ L+NQ+G++               F YPKASTPGCT+QACGFRDN+++LK++ 
Sbjct: 61  GDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEHG 120

Query: 107 AVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFVQGKL 165
            V GLS DTP AQ KFKEK SLP+DLL DP R+ IG LGA K+P SG+ RS++VF  GKL
Sbjct: 121 LVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADGKL 180

Query: 166 RTKRISVSPEASVSEAKKEAIEAAQ 190
           + KR+ +SPE SV++ KKE +E A+
Sbjct: 181 KFKRLKISPEISVADGKKEVLELAK 205

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  181 bits (459), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 112/149 (75%), Gaps = 1/149 (0%)

Query: 43  ELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEEL 102
           E+E GDE+PD+ L+NQ+G +               FAYP+A TPGCT+QACGFRD Y++L
Sbjct: 67  EVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL 126

Query: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFV 161
           KK+AAVFGLS D+ ++Q+KF++K SLP+DLLSDP+R+ IG LGA K+P SG  RS+++FV
Sbjct: 127 KKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFV 186

Query: 162 QGKLRTKRISVSPEASVSEAKKEAIEAAQ 190
            GKLR KRI +SPE SV++ KKE +E  +
Sbjct: 187 DGKLRFKRIKISPEISVNDGKKEVLEIVE 215

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  184 bits (467), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 109/148 (73%), Gaps = 1/148 (0%)

Query: 43  ELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEEL 102
           EL+ GDE+PDV L+NQ+G++               FAYPKASTPGCT+QACG+RDNY+EL
Sbjct: 201 ELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDEL 260

Query: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFV 161
           K++AAVFGLS D  +AQ+KF+ K SLPFDLL DP R LIG LGA K+  SGT RS+WVF 
Sbjct: 261 KEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFF 320

Query: 162 QGKLRTKRISVSPEASVSEAKKEAIEAA 189
            GKL+ KR+ VSPE S+ + KKE +E A
Sbjct: 321 DGKLKYKRVKVSPEVSIQDGKKEVLELA 348

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  178 bits (451), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 105/148 (70%)

Query: 43  ELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEEL 102
           E++ GDE+PD+ L+NQEGEE               F YP+ASTPGCT+QACGFRDN+++L
Sbjct: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119

Query: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSPSGTKRSYWVFVQ 162
           KK + + GLS D+  AQ+ FK K +LP+DLL D ++KLI  LG  K PSG  RSY++FV 
Sbjct: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKPSGIIRSYFIFVD 179

Query: 163 GKLRTKRISVSPEASVSEAKKEAIEAAQ 190
           GKL+ KR+ VSPE S++E+KKE ++  +
Sbjct: 180 GKLKLKRVKVSPEVSITESKKEILDLVK 207

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  177 bits (448), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 109/149 (73%), Gaps = 1/149 (0%)

Query: 43  ELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEEL 102
           ELE GD +PD+ L +++ +                F YPKASTPGCT+QACGFRDNYE+L
Sbjct: 62  ELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121

Query: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFV 161
           KK+AAVFGLS D   +Q+KF+ K +LP+ L+SDP+R+ IG LGA K+P SG+ RS++VFV
Sbjct: 122 KKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVFV 181

Query: 162 QGKLRTKRISVSPEASVSEAKKEAIEAAQ 190
            GKLR KRI +SPE SVS+AKKE +E A+
Sbjct: 182 NGKLRFKRIKISPEVSVSDAKKEVLEIAE 210

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  175 bits (444), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (72%), Gaps = 1/150 (0%)

Query: 42  GELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEE 101
            ELE GD +PD+ L N++ +                F YP+ASTPGCT+QACGFRDNY+E
Sbjct: 61  NELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQE 120

Query: 102 LKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVF 160
           LKK AAVFGLS D+  +Q+KF+ K +LP+ LLSDP+R+ IG LGA K+P SG+ RS+++F
Sbjct: 121 LKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIF 180

Query: 161 VQGKLRTKRISVSPEASVSEAKKEAIEAAQ 190
           V GKL+ KR+ +SPE SV++AKKE +E A+
Sbjct: 181 VDGKLKFKRVKISPEVSVNDAKKEVLEVAE 210

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  174 bits (442), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 81/154 (52%), Positives = 108/154 (70%), Gaps = 1/154 (0%)

Query: 34  KAKTNGSKGELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQAC 93
           K++  G   ELE GD VP++ LKNQ+ +E               FAYPKA+TPGCT+QAC
Sbjct: 61  KSEKVGGPKELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANTPGCTRQAC 120

Query: 94  GFRDNYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SG 152
           GFRDNYEEL+K+A +FG+S+D+  +Q+ F+ K  LPFDLLSDP R+LIG LGA K+  +G
Sbjct: 121 GFRDNYEELQKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLGAKKTAQAG 180

Query: 153 TKRSYWVFVQGKLRTKRISVSPEASVSEAKKEAI 186
             RS+W+F  GKL+ KR+ VSPE S+SE  +E +
Sbjct: 181 VIRSHWIFCNGKLKYKRVKVSPETSISEGLEEVL 214

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  173 bits (438), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 109/149 (73%), Gaps = 1/149 (0%)

Query: 43  ELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEEL 102
           EL+ GD++PD+ L N++ +                F YPKASTPGCT+QACGFRDNYE+L
Sbjct: 62  ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121

Query: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFV 161
           K++AAVFGLS D+  +Q+KF+ K  LP+ LLSDP+R+ IG LGA K+P SG+ RS++VFV
Sbjct: 122 KEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181

Query: 162 QGKLRTKRISVSPEASVSEAKKEAIEAAQ 190
            GKLR KR+ +SPE SV +AKKE +E A+
Sbjct: 182 DGKLRFKRVKISPEVSVGDAKKEVMELAE 210

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  175 bits (444), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 106/151 (70%), Gaps = 1/151 (0%)

Query: 43  ELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEEL 102
           ELE GDEVPD  LKNQ  E                FAYPKA+TPGCT+QACG RDNY +L
Sbjct: 126 ELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYNDL 185

Query: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFV 161
           KK A VFG+S D+ +AQ+ F+EK +LP+DLLSD  R+LIG LG  K+P SG  RS+++ V
Sbjct: 186 KKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFIIV 245

Query: 162 QGKLRTKRISVSPEASVSEAKKEAIEAAQTD 192
            GKL+ KR+ +SPE SVS+ KKE +E ++++
Sbjct: 246 NGKLKFKRVKISPEVSVSDCKKEVLEISKSE 276

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  174 bits (440), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 107/151 (70%), Gaps = 1/151 (0%)

Query: 37  TNGSKGELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFR 96
           + G  GEL+ GD +P++ LKNQ+  +               FAYPKASTPGCT+QACGFR
Sbjct: 80  STGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFR 139

Query: 97  DNYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKR 155
           DNY+EL+K+A VFG+S D+  +Q+ F++K  LPFDLLSDP+R+LIG LGA K+  +G  R
Sbjct: 140 DNYQELQKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPKRELIGALGARKTAQTGVIR 199

Query: 156 SYWVFVQGKLRTKRISVSPEASVSEAKKEAI 186
           S+WVFV GKL +KRI +SPE S+++   E +
Sbjct: 200 SHWVFVDGKLGSKRIKISPEMSIADGLSEVL 230

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  172 bits (435), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 111/149 (74%), Gaps = 1/149 (0%)

Query: 43  ELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFRDNYEEL 102
           EL+ GD +PD+ L +++ +                F YPKASTPGCT+QACGFRDNY++L
Sbjct: 62  ELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDL 121

Query: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFV 161
           KK++AVFGLS+D+  +Q++F+ K +LP+ LLSDP+R+ IG LGA K+P SG+ RS++VFV
Sbjct: 122 KKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181

Query: 162 QGKLRTKRISVSPEASVSEAKKEAIEAAQ 190
            GKLR KR+ +SPE SV++AKKE +E A+
Sbjct: 182 DGKLRFKRVKISPEVSVNDAKKEILELAE 210

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  171 bits (433), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 79/150 (52%), Positives = 106/150 (70%), Gaps = 1/150 (0%)

Query: 37  TNGSKGELEEGDEVPDVVLKNQEGEEXXXXXXXXXXXXXXXFAYPKASTPGCTKQACGFR 96
           T+    EL+ GD++PD++L ++EG                 FA+PKA+TPGCT+QACGFR
Sbjct: 76  TDSIYKELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFPKANTPGCTRQACGFR 135

Query: 97  DNYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKR 155
           DNY+ELK++AAV+G+S D   AQ+KFK K +LP+ LLSD +R  IG LGA K+P SG  R
Sbjct: 136 DNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIR 195

Query: 156 SYWVFVQGKLRTKRISVSPEASVSEAKKEA 185
           SY++FV GKL+ KR+ +SPE SV EA+KE 
Sbjct: 196 SYFIFVDGKLKVKRVKISPELSVEEARKEV 225

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.124    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,454,504
Number of extensions: 694565
Number of successful extensions: 1219
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1213
Number of HSP's successfully gapped: 25
Length of query: 293
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 184
Effective length of database: 40,982,805
Effective search space: 7540836120
Effective search space used: 7540836120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 65 (29.6 bits)