Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F12540g7.125ON59559527390.0
Kwal_55.208327.125ON57549022850.0
SAKL0F05390g7.125ON59549920120.0
KLLA0D14355g7.125ON58850319020.0
NCAS0E021307.125ON52649418700.0
TDEL0H028707.125ON58749418690.0
Smik_6.4677.125ON54850718360.0
YPL260W7.125ON55150718070.0
Skud_16.187.125ON55050818060.0
Suva_16.447.125ON54950717950.0
NDAI0E036707.125ON52249017900.0
CAGL0H09108g7.125ON53249117560.0
Ecym_83527.125ON57949017460.0
ZYRO0C05192g7.125ON58850317340.0
KNAG0L009407.125ON54951416430.0
KAFR0L004607.125ON51148716220.0
TBLA0A009307.125ON58649815930.0
Kpol_322.77.125ON53449115510.0
TPHA0C016107.125ON55149215410.0
ADL019W7.125ON52545114950.0
Kpol_1062.587.125ON4914134624e-50
YBL034C (STU1)3.321ON1513184800.46
Skud_2.693.321ON1513184790.72
Smik_2.80na 1ON1516220761.5
Smik_2.813.321ON1516220761.5
KLLA0D03036g4.290ON36886723.7
NCAS0I007607.149ON680160723.8
Suva_7.1796.182ON430130724.1
Kwal_33.146592.125ON167866715.6
KNAG0A019208.549ON24265696.2
Ecym_26437.82ON484129707.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F12540g
         (595 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...  1059   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   884   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   779   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   737   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   724   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   724   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   711   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   700   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   700   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   696   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   694   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   681   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   677   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   672   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   637   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   629   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   618   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   602   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   598   0.0  
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   580   0.0  
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   182   4e-50
YBL034C Chr2 complement(153848..158389) [4542 bp, 1513 aa] {ON} ...    35   0.46 
Skud_2.69 Chr2 complement(137636..142177) [4542 bp, 1513 aa] {ON...    35   0.72 
Smik_2.80 Chr2 complement(147598..152148) [4551 bp, 1516 aa] {ON...    34   1.5  
Smik_2.81 Chr2 complement(147598..152148) [4551 bp, 1516 aa] {ON...    34   1.5  
KLLA0D03036g Chr4 complement(255868..256974) [1107 bp, 368 aa] {...    32   3.7  
NCAS0I00760 Chr9 complement(135901..137943) [2043 bp, 680 aa] {O...    32   3.8  
Suva_7.179 Chr7 (336046..337338) [1293 bp, 430 aa] {ON} YGL090W ...    32   4.1  
Kwal_33.14659 s33 complement(760813..765849) [5037 bp, 1678 aa] ...    32   5.6  
KNAG0A01920 Chr1 complement(146963..147691) [729 bp, 242 aa] {ON...    31   6.2  
Ecym_2643 Chr2 complement(1239905..1241359) [1455 bp, 484 aa] {O...    32   7.2  

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score = 1059 bits (2739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/595 (89%), Positives = 531/595 (89%)

Query: 1   MPKHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIR 60
           MPKHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIR
Sbjct: 1   MPKHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIR 60

Query: 61  KSSHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 120
           KSSHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR
Sbjct: 61  KSSHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 120

Query: 121 LLEHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRIDFAKIQDEKDRNKI 180
           LLEHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRIDFAKIQDEKDRNKI
Sbjct: 121 LLEHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRIDFAKIQDEKDRNKI 180

Query: 181 EEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQ 240
           EEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQ
Sbjct: 181 EEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQ 240

Query: 241 GVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNGLLDD 300
           GVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNGLLDD
Sbjct: 241 GVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNGLLDD 300

Query: 301 CHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQKRLS 360
           CHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQKRLS
Sbjct: 301 CHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQKRLS 360

Query: 361 EIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTVR 420
           EIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTVR
Sbjct: 361 EIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTVR 420

Query: 421 RCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECFD 480
           RCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECFD
Sbjct: 421 RCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECFD 480

Query: 481 ILHELKIEAXXXXXXXXXXXXXXXXXXXXXXGSIHEGSSAKGEATTADSHXXXXXXXXXX 540
           ILHELKIEA                      GSIHEGSSAKGEATTADSH          
Sbjct: 481 ILHELKIEAEERETPEDPQDDEEADDDHDHAGSIHEGSSAKGEATTADSHAAAAAAAAPK 540

Query: 541 XXXXRYLDASRPYSHXXXXXXXXXXXXXXXYTTNXXXXXXXXXXXXXATTSHAED 595
               RYLDASRPYSH               YTTN             ATTSHAED
Sbjct: 541 KPKARYLDASRPYSHDDDDEGDGDGDGDDEYTTNYSEHSYEDDEDDYATTSHAED 595

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/490 (88%), Positives = 458/490 (93%), Gaps = 1/490 (0%)

Query: 1   MPKHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIR 60
           M KHPQEVP EEE+SL YFLEVRN+LSRLKQNRSQYLNSK+VMS YQQVLTKVRELD IR
Sbjct: 1   MHKHPQEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIR 60

Query: 61  KSSHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 120
           K SH  P NSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR
Sbjct: 61  KRSHSAPRNSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 120

Query: 121 LLEHLDESNVFTHHDLRPIKERLDEISEIVSQSSYL-DGTEISDGRIDFAKIQDEKDRNK 179
           LLEHLDESNVFTHHDLRPIKERLDEISEIV+QSS+  +G EI++G IDF KI DEKDRNK
Sbjct: 121 LLEHLDESNVFTHHDLRPIKERLDEISEIVTQSSFFKEGGEINNGSIDFTKISDEKDRNK 180

Query: 180 IEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSK 239
           IEEDLLLRAKL+HCLQEY HIESKLEEIDPRLQ TMEKLF+LRRGLLSLAASTKRNAM K
Sbjct: 181 IEEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAASTKRNAMLK 240

Query: 240 QGVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNGLLD 299
            G K P+S L QE +K++LH LEA+LT+IES R++SG FVS +TGEI  +GQ+VLNGLLD
Sbjct: 241 DGHKAPESPLSQESVKEKLHSLEAKLTQIESQRNASGYFVSADTGEIVERGQSVLNGLLD 300

Query: 300 DCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQKRL 359
           DCHDLINDLSHHANN V+LDSKLQPIYDNLI+IKTTLENLLVTRRWTLRETDLF+YQKRL
Sbjct: 301 DCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLENLLVTRRWTLRETDLFAYQKRL 360

Query: 360 SEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTV 419
           SEIDKLRVGGKFPTE+ DAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTV
Sbjct: 361 SEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTV 420

Query: 420 RRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECF 479
           RRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECF
Sbjct: 421 RRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECF 480

Query: 480 DILHELKIEA 489
           DILHELKIEA
Sbjct: 481 DILHELKIEA 490

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/499 (78%), Positives = 433/499 (86%), Gaps = 16/499 (3%)

Query: 4   HPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSS 63
           HPQEVP EEE  L YFL+VR+FLS+LKQNRSQ+LNSKDVM TYQQVLTKVRELD  RKSS
Sbjct: 5   HPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTRKSS 64

Query: 64  HHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 123
           H+ PA+SATTLIH+V+LHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE
Sbjct: 65  HNTPASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 124

Query: 124 HLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGR------------IDFAKI 171
           HL+ESNVFTHHDLRPIKERLDE+SEIV ++SY +  E + G+            I+  K 
Sbjct: 125 HLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQEDEQDIELKKA 184

Query: 172 QDEKDRNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAAS 231
             EKD+NK+EEDLLLRAKL+HCLQEY +IESKLEEIDP LQS MEKLFQ+RRGLLSLAAS
Sbjct: 185 DIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLLSLAAS 244

Query: 232 TKRNAMSKQGV---KTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAG 288
           TKRNA SK+ +   K   ++ P   +  +L+EL+ EL+E+ESHRD SGKF SLET ++  
Sbjct: 245 TKRNARSKESLEDKKRTHTVSPN-FVNSKLNELQVELSELESHRDPSGKFKSLETDKVEE 303

Query: 289 KGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLR 348
           +GQ+VLNGLLDDCHDLINDLSH  +  +SLD KLQPIYDNLIDIKTTLENLLVTRRWTLR
Sbjct: 304 RGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYDNLIDIKTTLENLLVTRRWTLR 363

Query: 349 ETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEA 408
           ETDLF+YQKRL EID LRV GKFPTE+ D+KGQ+ILLYLLRRCYAIIYKLLE SEPVSEA
Sbjct: 364 ETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYLLRRCYAIIYKLLESSEPVSEA 423

Query: 409 LQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQ 468
           LQ+IHNQLSTVRRCLLELKRMGGV NDRELYPYQMKLASLDN+RVDGKFYD DGNIPEGQ
Sbjct: 424 LQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDNMRVDGKFYDADGNIPEGQ 483

Query: 469 GTLNALLAECFDILHELKI 487
           GTLNALLAECFDILHELKI
Sbjct: 484 GTLNALLAECFDILHELKI 502

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/503 (72%), Positives = 425/503 (84%), Gaps = 20/503 (3%)

Query: 4   HPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSS 63
           HP  VP EEE  L YFL+VR+FLS++KQNRSQ+LNSKDVM TYQ+VLTKVRELD +RK+S
Sbjct: 6   HPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNS 65

Query: 64  HHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 123
           H  P+NSATTLIH+ ELHNRVDSV+DDVFQLLSLSFLTVGLKNSAPATYASLSTVQ LLE
Sbjct: 66  HATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLE 125

Query: 124 HLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEI------SDGRIDFAKIQDEK-D 176
           HL+ESNV+THHDLRPIKERL+E+S IV Q+ Y+  ++       +D   +FA  +DE+ +
Sbjct: 126 HLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDEELN 185

Query: 177 RNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNA 236
           +NKIEEDLLLRAKL+HC+ EY  IESKLEEI P LQSTME LFQ+RRGLLSLA+STKR  
Sbjct: 186 KNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKR-P 244

Query: 237 MSKQGVKTP------------DSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETG 284
             KQ V  P             ++LP + I ++L +L+ +L ++ESHRD +GKF SLET 
Sbjct: 245 HQKQLVPDPAVLSVESEASEKKNVLPDQVIDEKLKQLQEQLEKLESHRDINGKFKSLETD 304

Query: 285 EIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRR 344
           ++  KGQNVLNGLLDDCHDL+NDLSH  +  +SLD+KLQPIYD L+DIKTTLENLLVTRR
Sbjct: 305 KVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLVTRR 364

Query: 345 WTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEP 404
           WTLRETDLF+YQK+L EID LRV GKFPT++ D+KGQ+ILLYLLRRCYAIIYKLLE SEP
Sbjct: 365 WTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKLLESSEP 424

Query: 405 VSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNI 464
           VSE+LQ++HNQLSTVRRCLLELKRMGGV+NDRELYPYQMKLASLDN+RVDGKFYD DGNI
Sbjct: 425 VSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDTDGNI 484

Query: 465 PEGQGTLNALLAECFDILHELKI 487
           PEGQGTLNALLAECFDI+HELKI
Sbjct: 485 PEGQGTLNALLAECFDIIHELKI 507

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/494 (73%), Positives = 415/494 (84%), Gaps = 10/494 (2%)

Query: 4   HPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSS 63
           HPQEVP EEE  L Y L+VR+FLS+LKQNR+QYLNSKDV  TYQ VLTKVRELD IRK+S
Sbjct: 10  HPQEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVRELDEIRKNS 69

Query: 64  HHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 123
           H  P+ SATTLIH+ ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTVQ LLE
Sbjct: 70  HDTPSKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLE 129

Query: 124 HLDESNVFTHHDLRPIKERLDEISEIVSQS-SYLDGTEISDGR-IDFAKIQDEKDRNKIE 181
           HL ESN+FTHHDL PIK+RL+EIS+IV +S   L   +++D    +   I  E+++NKIE
Sbjct: 130 HLSESNIFTHHDLSPIKDRLNEISKIVEKSCGKLPDEQLNDDEEQNLKDIDTERNKNKIE 189

Query: 182 EDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQG 241
           +DLLLRAKLQHCL EY+ IESKLEEIDP L STMEKLFQ+RRGLLSLAASTK+N    QG
Sbjct: 190 QDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLAASTKKNM--NQG 247

Query: 242 VKTPDS------LLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLN 295
             T +       L+ QE + ++LH LEAE+  +E++RD SGKF SLET E+A  GQNVLN
Sbjct: 248 SLTSEKELENKHLVSQEYVNKKLHALEAEVQALEANRDESGKFKSLETNEVAENGQNVLN 307

Query: 296 GLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSY 355
           GLLDDC DLINDLSH  N  ++LD  LQPIY+ LIDIKTTLENL++TRRWTLRETDLF+Y
Sbjct: 308 GLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTTLENLMITRRWTLRETDLFTY 367

Query: 356 QKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQ 415
           QK+L EID +RV G+FPT++ D+KGQ ILLYLLRRCYAIIYKLLE SEPVSE+LQ IHNQ
Sbjct: 368 QKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAIIYKLLESSEPVSESLQPIHNQ 427

Query: 416 LSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALL 475
           LSTVRRCL+ELKRMGGV+NDRELYPYQMKLASLDN+RVDGKFYD +GNIPEGQGTLNALL
Sbjct: 428 LSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFYDSEGNIPEGQGTLNALL 487

Query: 476 AECFDILHELKIEA 489
           A CFDI+HELK+EA
Sbjct: 488 AACFDIMHELKVEA 501

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/494 (74%), Positives = 419/494 (84%), Gaps = 12/494 (2%)

Query: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62
           +HPQ+VP EEES L Y L VRN L +LKQNR QYLNSK+V + YQQVLTKVRELD IRKS
Sbjct: 13  QHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQIRKS 72

Query: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122
           +H  P+NSATTLIH+ ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTVQRLL
Sbjct: 73  NHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQRLL 132

Query: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQSSYL-----DGTEISDGRIDFA--KIQDEK 175
           EHL+ESNVFT HDLRPI+ERL EIS+IV  SSY      D  E  D ++  A  K  +E+
Sbjct: 133 EHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPEADRKFYEER 192

Query: 176 DRNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRN 235
           ++NKIEEDLLLRAKLQHCL EY   ESK+EEIDP L + MEKLF++RRGLLSLAAS+KR+
Sbjct: 193 NKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAASSKRS 252

Query: 236 AMSKQGVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLN 295
             S +  K+P   L QE + +++ +LE++LTE+ESHRD +GKF SLET ++  KGQNVLN
Sbjct: 253 NPSLE--KSP---LSQEHVHEQVEKLESQLTELESHRDENGKFKSLETDKVEDKGQNVLN 307

Query: 296 GLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSY 355
           GLLDDCHDLI+DLSH  N  + LD+KLQPIY+ LIDIKT+LENLLVTRRWTLRETDLF++
Sbjct: 308 GLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLRETDLFTF 367

Query: 356 QKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQ 415
           QK+LSEID LRV GKFPT++  +KGQ+ILLYLLRRC+AIIYKLLE SEPVSE+LQ IHNQ
Sbjct: 368 QKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKLLESSEPVSESLQPIHNQ 427

Query: 416 LSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALL 475
           LSTVRRCLLELKRMGGV NDRELYPYQMKLASLD++R DGKFYD DGNIPEGQGTLNALL
Sbjct: 428 LSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQGTLNALL 487

Query: 476 AECFDILHELKIEA 489
           AECFDI+HELKIEA
Sbjct: 488 AECFDIVHELKIEA 501

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/507 (71%), Positives = 409/507 (80%), Gaps = 22/507 (4%)

Query: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62
           +HPQ VP EEES L Y LEVR+ L++LKQNR+QYLNSKDV +TYQ VLTKVRELD IRK+
Sbjct: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67

Query: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122
           SH  PA SA TLIHN ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LL
Sbjct: 68  SHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127

Query: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRID-FAKIQDEKDRNKIE 181
           EHL+ESNVFTHHDL PIKERLDEIS+IV Q +    T   DG  D   +I +E+ +NKIE
Sbjct: 128 EHLNESNVFTHHDLSPIKERLDEISKIVEQKNS-SSTYNEDGNDDRLREIDNERKKNKIE 186

Query: 182 EDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSK-- 239
           EDLLLRAKL+HC  EY+ +ESKLEEIDP L S MEKLF++RRGLLSL AS K+  MSK  
Sbjct: 187 EDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASAKK-TMSKSS 245

Query: 240 -----------------QGVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLE 282
                             G+     L+ QE + ++L  L+ EL E+ES+RD SGKF SLE
Sbjct: 246 ANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGKFKSLE 305

Query: 283 TGEIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVT 342
           T ++A  GQ+VLNGLLDDCHDLINDLSH  N  +SLD  LQPIY+ LIDIKTTLENL++T
Sbjct: 306 THQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLENLMIT 365

Query: 343 RRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECS 402
           RRWTLRETDLFSYQK+L+EID  R+ GKFPT++ D+KGQ+ILLYLLRRCYAIIYKLLE S
Sbjct: 366 RRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESS 425

Query: 403 EPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDG 462
           EPVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R DG FYD DG
Sbjct: 426 EPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDG 485

Query: 463 NIPEGQGTLNALLAECFDILHELKIEA 489
           NIPEGQG LNALLAECFDILHELK+EA
Sbjct: 486 NIPEGQGILNALLAECFDILHELKVEA 512

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/507 (70%), Positives = 410/507 (80%), Gaps = 22/507 (4%)

Query: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62
           +HPQ VP EEES L Y LEVR+ L++LKQNR+QYLNSKDV +TYQ VLTKVRELD IRK+
Sbjct: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67

Query: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122
           SH  PA SA TLIH+ ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LL
Sbjct: 68  SHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127

Query: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRID-FAKIQDEKDRNKIE 181
           EHL+ESNVFTHHDL PIKERL+EIS+IV Q +     +  DG  D   +I +E+ +NKIE
Sbjct: 128 EHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYD-EDGNDDRLREIDNERKKNKIE 186

Query: 182 EDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQG 241
           EDLLLRAKL+HC  EY+ +E KLEEIDP L + MEKLF++RRGLLSL AS K+  MSK  
Sbjct: 187 EDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKK-TMSKSD 245

Query: 242 VKTPD-------------------SLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLE 282
           + T                      L+ QE + ++L  L+ EL+E+ES+RD SGKF SLE
Sbjct: 246 INTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLE 305

Query: 283 TGEIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVT 342
           + ++A KGQ+VLNGLLDDCHDL+NDLSH  N  ++LD  LQPIY+ LIDIKTTLENL++T
Sbjct: 306 SHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLENLMIT 365

Query: 343 RRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECS 402
           RRWTLRETDLFSYQK+L+EID  R+ GKFPT++ D+KGQ+ILLYLLRRCYAIIYKLLE S
Sbjct: 366 RRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESS 425

Query: 403 EPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDG 462
           EPVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R +G FYD DG
Sbjct: 426 EPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYDSDG 485

Query: 463 NIPEGQGTLNALLAECFDILHELKIEA 489
           NIPEGQG LNALLAECFDILHELK+EA
Sbjct: 486 NIPEGQGILNALLAECFDILHELKVEA 512

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/508 (70%), Positives = 414/508 (81%), Gaps = 24/508 (4%)

Query: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62
           +HPQ VP EEES L Y LEVR+ L++LKQNR+QYLNSKDV +TYQ VLTKVRELD IRK+
Sbjct: 7   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 66

Query: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122
           SH  PA SA TLIH+ ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LL
Sbjct: 67  SHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 126

Query: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQ--SSYLDGTEISDGRIDFAKIQDEKDRNKI 180
           EHL+ESNVFTHHDL PIKERLDEIS+IV Q  SS +   + +D RI   +I +E+ +NKI
Sbjct: 127 EHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARI--REIDNERKQNKI 184

Query: 181 EEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQ 240
           EEDLLLRAKL+HC  EY+ +ESKLEEIDP L + MEKLF++RRGLLSL AS K+  MSK 
Sbjct: 185 EEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKK-TMSKS 243

Query: 241 G------------VKTPDS-------LLPQEGIKQRLHELEAELTEIESHRDSSGKFVSL 281
                        ++  D+       L+ QE + ++L  L+ EL+E+ES+RD SGKF SL
Sbjct: 244 SANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSL 303

Query: 282 ETGEIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLV 341
           ET E+  KGQ+VLNGLLDDCHDLI+DLSH  N  ++LD  LQP Y+ LIDIKTTLENL++
Sbjct: 304 ETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLENLMI 363

Query: 342 TRRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLEC 401
           TRRWTLRETDLFSYQK+L+EID  R+ GKFPT++ D+KGQ+ILLYLLRRCYAIIYKLLE 
Sbjct: 364 TRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLES 423

Query: 402 SEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDED 461
           SEPVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R +G FYD D
Sbjct: 424 SEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFYDSD 483

Query: 462 GNIPEGQGTLNALLAECFDILHELKIEA 489
           GNIPEGQG LNALLAECFDI+HELK+EA
Sbjct: 484 GNIPEGQGILNALLAECFDIMHELKVEA 511

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/507 (69%), Positives = 409/507 (80%), Gaps = 23/507 (4%)

Query: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62
           +HPQ VP EEES L Y LEVR+ L++LKQNR+QYLNSKDV +TYQ VLTKVRELD IRK+
Sbjct: 8   QHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67

Query: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122
           SH  PA SA TLIH+ ELHNRVDSVLDDVFQL+SL FLTVGLKNSAPATYASLSTV+ LL
Sbjct: 68  SHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLL 127

Query: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRID-FAKIQDEKDRNKIE 181
           EHL+ESNVFTHHDL PIKERL+EI +IV +++  +  E  DG  D   +I +E+++N+IE
Sbjct: 128 EHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDE--DGNDDQLREIDNERNKNRIE 185

Query: 182 EDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQG 241
           EDLLLRAKL+HC  EY+ +ESKLEEIDP L + MEKLF++RRGLLSL AS K+  MS+  
Sbjct: 186 EDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKK-TMSQSN 244

Query: 242 VKTPD-------------------SLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLE 282
           V                        L+ QE + ++L  L+ EL E+ES+RD SGKF SLE
Sbjct: 245 VNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKFKSLE 304

Query: 283 TGEIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVT 342
           + ++A  GQ+VLNGLLDDCHDL+NDLSH  N  ++LD  LQPIY+ LIDIKTTLENL++T
Sbjct: 305 SHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMIT 364

Query: 343 RRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECS 402
           RRWTLRETDLFSYQK+L+EID  RV GKFPT+  D+KGQ+ILLYLLRRCYAIIYKLLE S
Sbjct: 365 RRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKLLESS 424

Query: 403 EPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDG 462
           EPVSEALQ +HNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R DG FYD DG
Sbjct: 425 EPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDG 484

Query: 463 NIPEGQGTLNALLAECFDILHELKIEA 489
           NIPEGQG LNALLAECFDI+HELK+EA
Sbjct: 485 NIPEGQGILNALLAECFDIMHELKVEA 511

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/490 (70%), Positives = 404/490 (82%), Gaps = 4/490 (0%)

Query: 4   HPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSS 63
           HPQ VP EEE  L Y L+VRN+L  LK+NR+QYLNS+ V  TYQ+VLTKVRELD IRK++
Sbjct: 14  HPQLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVLTKVRELDEIRKNN 73

Query: 64  HHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 123
           H  P+NSATTLIH++ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTVQ LLE
Sbjct: 74  HATPSNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLE 133

Query: 124 HLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRIDFAKIQDE----KDRNK 179
           HL+ESN+FTHHDL PIKERLD+IS+IV +S   +    ++G   F +  DE    +++NK
Sbjct: 134 HLNESNIFTHHDLGPIKERLDQISKIVEESCSQEIKLDNEGDDQFNQYLDETELEQNQNK 193

Query: 180 IEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSK 239
           IE+DLLLRAKLQHCL EY  IESKLEEIDP L S +EKLFQ+RRGLLSL AS K+N++  
Sbjct: 194 IEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQIRRGLLSLVASAKKNSLLS 253

Query: 240 QGVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNGLLD 299
           Q       L+  E + ++L ELE E  ++ES+RD  GKF SLETGEI   GQNVL GL D
Sbjct: 254 QKELDEKHLISPEYLNKKLLELEKEFKDLESNRDEFGKFKSLETGEIPENGQNVLKGLED 313

Query: 300 DCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQKRL 359
           DC+DLINDLSH  N  ++LD  LQP+Y+ LI+IKTTLE L++TRRWTLRETDLF+YQK+L
Sbjct: 314 DCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTLEKLMITRRWTLRETDLFTYQKKL 373

Query: 360 SEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTV 419
            EID LRV GKFP++++D+KGQ I+LYLLRRCYAIIYKLLECSEPVSE+LQ IHNQLSTV
Sbjct: 374 GEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIYKLLECSEPVSESLQPIHNQLSTV 433

Query: 420 RRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECF 479
           RRCLL++KR+GGV N+RELYPYQMKLASLDN+R DG FYD DGNIPEGQGTLNALLA CF
Sbjct: 434 RRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDGIFYDSDGNIPEGQGTLNALLAACF 493

Query: 480 DILHELKIEA 489
           DI+HE+K+EA
Sbjct: 494 DIVHEMKVEA 503

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/491 (69%), Positives = 405/491 (82%), Gaps = 10/491 (2%)

Query: 4   HPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSS 63
           HPQ+VP EEE  L Y LEVR+FLS+LK+NR+QYLNSKDV++TYQ+VLT+VRELD IRKSS
Sbjct: 13  HPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGIRKSS 72

Query: 64  HH--RPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRL 121
               R    ATTLIH+ ++HNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTVQ L
Sbjct: 73  TDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQCL 132

Query: 122 LEHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRIDFAKIQDEKDRNKIE 181
           LEHL ESNVFTHHDLRPIKERLDEIS+IV +S     +   D   +F +I  E+++N+IE
Sbjct: 133 LEHLCESNVFTHHDLRPIKERLDEISKIVEKSV---ESRPEDEVAEFKEIDTERNKNRIE 189

Query: 182 EDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMS--- 238
           +DLLL+AKLQHC+ EY  +ESKLEEI P L   ME+LF++RRGLLSLAAS+K+N      
Sbjct: 190 QDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKNIPDENY 249

Query: 239 KQGVKTPDS--LLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNG 296
           K+  K  DS  +L QE +   L + + E+ ++E+ RD +G+FVS  TG+   +GQN+LNG
Sbjct: 250 KEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAEQRGQNILNG 309

Query: 297 LLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQ 356
           LLDDC+DLINDLSH  N  ++LD  LQPIY+ LIDIKTTLENL++TRRWTLRETDLF+YQ
Sbjct: 310 LLDDCNDLINDLSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTLRETDLFTYQ 369

Query: 357 KRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQL 416
           K+L+EID +RV GKFPT++ D+KGQ+I+LYLLRRCYAIIYKLLE SEPVSE+LQ +HNQL
Sbjct: 370 KQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKLLESSEPVSESLQPVHNQL 429

Query: 417 STVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLA 476
           STVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R DGKFYD DGNIPEGQG LNALLA
Sbjct: 430 STVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGILNALLA 489

Query: 477 ECFDILHELKI 487
            CFDILHELK+
Sbjct: 490 GCFDILHELKV 500

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/490 (69%), Positives = 404/490 (82%), Gaps = 6/490 (1%)

Query: 6   QEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSSHH 65
           Q +P EEE  L YFLE+RN+LSRLKQNR+Q+L SKDV+ TYQ+VLTKVRELD IRK++H 
Sbjct: 9   QGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKIRKTTHE 68

Query: 66  RPAN--SATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 123
              N    TTLIH+V+LHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTVQ LL+
Sbjct: 69  SSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLD 128

Query: 124 HLDESNVFTHHDLRPIKERLDEISEIVSQSSYLD-GTEISDGRIDFAKIQDEKDRNKIEE 182
           HL+ESNV+TH+DL+PIKERLDEISEIV ++SY +  T+  DG      ++D++  N IEE
Sbjct: 129 HLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDKRKENNIEE 188

Query: 183 DLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQGV 242
           +LLLRAKL++CL+ Y  IE+KLE I   LQ  ME+LFQ+RRGLLSLAAS K     ++  
Sbjct: 189 NLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSRVEQEEQD 248

Query: 243 KTPDSL--LPQEGIKQRLHELEAELTEIESHRDSSGKFVSL-ETGEIAGKGQNVLNGLLD 299
           +  D L  L  E I +RL  LE EL ++ SHR+ SGKFVS+ +  ++  KGQ VLNGLLD
Sbjct: 249 ENDDELCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQFVLNGLLD 308

Query: 300 DCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQKRL 359
           DCHDLI DLSH  +  + LD  +QPIYD+L+ IKT LENLLVTRRWTLRETDLF+YQK+L
Sbjct: 309 DCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETDLFTYQKKL 368

Query: 360 SEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTV 419
           +E+D LRV GKFP+E++D+KGQAILLYLLRRCYAIIYKLLE SEPVSE+L++IHNQLSTV
Sbjct: 369 AELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKLLESSEPVSESLERIHNQLSTV 428

Query: 420 RRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECF 479
           R CLLELKRMGGV+N+RELYPYQMKLASLDN+RVDGKFYD DGNIPEGQGTLNALLAECF
Sbjct: 429 RHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLAECF 488

Query: 480 DILHELKIEA 489
           DILHE+KIEA
Sbjct: 489 DILHEMKIEA 498

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 119/262 (45%), Gaps = 36/262 (13%)

Query: 159 TEISDGRI---DFAKIQDEKDRNKIEE--DLLLRAKLQHC---LQEYEHIESKLEEIDPR 210
           TE++D R    +  K     D N + E    +L   L  C   +++  H  S   ++DP 
Sbjct: 271 TELADVRSHRNESGKFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPH 330

Query: 211 LQSTMEKLFQLRRGLLSLAASTKRNAMSKQGVKTPDSLLPQEGIKQRLHELEAELTEIES 270
           +Q   + L  ++  L +L   T+R  + +  + T                 + +L E++S
Sbjct: 331 IQPIYDDLVSIKTILENLLV-TRRWTLRETDLFT----------------YQKKLAELDS 373

Query: 271 HRDSSGKFVSLETGEIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLI 330
            R  +GKF S  +     KGQ +L  LL  C+ +I  L   +     +   L+ I++ L 
Sbjct: 374 LR-VNGKFPSESSD---SKGQAILLYLLRRCYAIIYKLLESSE---PVSESLERIHNQLS 426

Query: 331 DIKTTLENLLVTRRWTL-RETDLFSYQKRLSEIDKLRVGGKFPTENAD-AKGQAILLYLL 388
            ++  L  L + R   +  E +L+ YQ +L+ +D +RV GKF   + +  +GQ  L  LL
Sbjct: 427 TVRHCL--LELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALL 484

Query: 389 RRCYAIIYKLLECSEPVSEALQ 410
             C+ I++++   +E   EA Q
Sbjct: 485 AECFDILHEMKIEAEVREEAAQ 506

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/503 (67%), Positives = 393/503 (78%), Gaps = 20/503 (3%)

Query: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62
           +HPQ VP EEE  L YFLE+R  LS+LKQNR++YL+SK V +TY+QVLT+VRELD +RKS
Sbjct: 14  QHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKS 73

Query: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122
           +H  P++SATTLIHN ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPA Y+SLSTVQRLL
Sbjct: 74  NHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLL 133

Query: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQSS------------YLDGTEISDGRIDFA- 169
           EHL+ESNVFT HDLRPIKERL EI +IV +S             YL         +D A 
Sbjct: 134 EHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKNA----PDLDEAD 189

Query: 170 -KIQDEKDRNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSL 228
             + +E  RNKIEEDLLLRAKLQHCL EY   E+K+E +DP L + M+KLFQ+RR LLSL
Sbjct: 190 RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRELLSL 249

Query: 229 AASTKRNAMSKQGVKTPDS--LLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEI 286
           AAS K+   S    K  ++  +L  E +  R+  L+ EL EIES+RD +GKF S E+ + 
Sbjct: 250 AASAKKTTSSASAEKELENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKSPESEQS 309

Query: 287 AGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWT 346
           A KGQNVLNGLL DC+DL+ DLSH  N  + LD +LQPIY  LIDIKTTLENLL+TRRWT
Sbjct: 310 AEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENLLITRRWT 369

Query: 347 LRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVS 406
           LRETDLF+YQK L EID LRV  KFPT++ D KGQ ILLYLLRRCYAIIYKLLE SEPVS
Sbjct: 370 LRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKLLESSEPVS 429

Query: 407 EALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPE 466
           E+LQ +HNQLSTVRRCLL L+RMGG+ N RELYPYQMKLASLD +RVDGKFYD DGNIPE
Sbjct: 430 ESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGNIPE 489

Query: 467 GQGTLNALLAECFDILHELKIEA 489
           GQ TLNALLAECFDI+HE+KIEA
Sbjct: 490 GQATLNALLAECFDIIHEMKIEA 512

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/514 (62%), Positives = 391/514 (76%), Gaps = 32/514 (6%)

Query: 6   QEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSSHH 65
           Q VP EEE  L YFL+VR  LS+LK+NR+QYLNS +V  TYQ+VLTKVRELDAIRK +H 
Sbjct: 13  QNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKKNHD 72

Query: 66  RPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLEHL 125
             A +  TLIHN +LHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LL+HL
Sbjct: 73  AVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLQHL 132

Query: 126 DESNVFTHHDLRPIKERLDEISEIV----SQSSYLDGTEISDGRIDFAKIQDEKDRNKIE 181
           +E+ ++THHDL+PIK+RL+EIS+IV    +Q++ +     +D       I  E+ RNK+E
Sbjct: 133 EEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDAERTRNKLE 192

Query: 182 EDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAAS---------- 231
           ++LLL+AKL+HC+  Y  +ESKLE+IDP L S MEKLFQ+RRGLLSL AS          
Sbjct: 193 QNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQISE 252

Query: 232 ----TKRNAMSKQGVKTP----------DSLLPQEGIKQRLHELEAELTEIESHRDSSGK 277
               T     S+  +  P           + +  + ++++   L  +L  +E+HRD  GK
Sbjct: 253 EDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRDEDGK 312

Query: 278 FVSLETGEIAGKGQNVLNGLLDDCHDLINDLSHH---ANNF-VSLDSKLQPIYDNLIDIK 333
           F SLET ++A  GQ VLNGLLDDC+DL++DLSH     N   +S+D  LQP+Y+ L++IK
Sbjct: 313 FKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLLEIK 372

Query: 334 TTLENLLVTRRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYA 393
           TTLENL++TRRWTLRETDLFSYQK+L+EID LRV G+FPTE AD++GQ+ILLYLLRRCYA
Sbjct: 373 TTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLRRCYA 432

Query: 394 IIYKLLECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRV 453
           IIYKLLE SEPVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R 
Sbjct: 433 IIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRQ 492

Query: 454 DGKFYDEDGNIPEGQGTLNALLAECFDILHELKI 487
           DG FYD DGNIPEGQG LNALLA CFDI+HELK+
Sbjct: 493 DGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/487 (65%), Positives = 380/487 (78%), Gaps = 19/487 (3%)

Query: 6   QEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSSHH 65
           Q VP EEE  L Y L+VR  LS LKQNRSQ+LNSKD+  TYQ+VLTKVRELD IR+  H 
Sbjct: 10  QAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRRQKHG 69

Query: 66  RPANSAT-TLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLEH 124
               +   T +H+ ELHNRVD+VLDDVFQLLSL F+T GLKNSAPATYASLSTVQ LLEH
Sbjct: 70  NSQETEIKTFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQSLLEH 129

Query: 125 LDESNVFTHHDLRPIKERLDEISEIVSQS----SYLDGTEISDGRIDFAKIQDEKDRNKI 180
           L ES ++THHDL+PIKERLDEI++IV Q+    +Y D + + D   + ++I +E+++NKI
Sbjct: 130 LIESKIYTHHDLKPIKERLDEIAKIVDQNCESNTYQDASTLDDDDNEVSRIDNERNKNKI 189

Query: 181 EEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQ 240
           E++LLL+AKL HCL EY +IES+LEE+DP   S +EKLFQ+RR L+SL   +K N     
Sbjct: 190 EQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLVEISKSNT---- 245

Query: 241 GVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNGLLDD 300
           GV        Q+ I ++L  L+ +L EIE++RD  G FVS+E+G    KG NVLNGL DD
Sbjct: 246 GV--------QDQIDKKLKHLQLQLNEIENNRDPDGNFVSIESGNPIIKGSNVLNGLSDD 297

Query: 301 CHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQKRLS 360
           CHDLI+DL+HH   F  LD  LQ +YDNLID+K +LENL+VTRRWTLRETDLFSY K+L+
Sbjct: 298 CHDLISDLTHHTKTF--LDPDLQNVYDNLIDVKGSLENLMVTRRWTLRETDLFSYLKKLN 355

Query: 361 EIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTVR 420
           EID LRV GKFPT++   KGQAILLYLLRRCY +IYKLLE SEPVSEALQ IHNQLSTVR
Sbjct: 356 EIDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLLESSEPVSEALQPIHNQLSTVR 415

Query: 421 RCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECFD 480
           RCLL+LKRMGGV N+RELYPYQMKLASLDN+R DGKFYD  GNIPEGQG LNALLA CFD
Sbjct: 416 RCLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSKGNIPEGQGILNALLAGCFD 475

Query: 481 ILHELKI 487
           ILHELKI
Sbjct: 476 ILHELKI 482

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/498 (62%), Positives = 390/498 (78%), Gaps = 14/498 (2%)

Query: 4   HPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSS 63
           HPQ VP EEE  L + LEVR  L++LKQNR+Q+LN+K V  TYQ VLTKVRELD IRK+S
Sbjct: 14  HPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNS 73

Query: 64  HHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 123
              PA +ATTLIH+ +LHNRVDSVLDDVFQLLSL FLTVG+KNSAPATY+SLSTVQ LLE
Sbjct: 74  LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLE 133

Query: 124 HLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRI--------DFAKIQDEK 175
           HL+ES +FT HDLRPIKERLDEI EIV +SSY +  E +D  +        +  +I++E+
Sbjct: 134 HLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRND-EFNDSALVGLSKQEHELIEIENER 192

Query: 176 DRNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRN 235
            RN+IEEDLL+RAKLQ C++++  +ES+LE+I+P L S ++KL+ +RRGLLSLA+ T  +
Sbjct: 193 TRNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTN-D 251

Query: 236 AMSKQG----VKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQ 291
            +SK        T  ++  +   +  L +++ +L EIES RD +G + SLET ++  +GQ
Sbjct: 252 TLSKSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKSLETNKVEMEGQ 311

Query: 292 NVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETD 351
            ++N L+DDC+DLINDLSH  N  +  D  LQ IY NLIDIKT L NL+VTRRWTLRETD
Sbjct: 312 GIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLMVTRRWTLRETD 371

Query: 352 LFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQK 411
           LFSYQK+L+EID LRV GKF +  +DAKGQ+I+LYLLRRCYAIIYKLLE SEP+SE+LQ 
Sbjct: 372 LFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKLLESSEPISESLQS 431

Query: 412 IHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTL 471
           IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD +R+DGKFYD +G+IPEGQG L
Sbjct: 432 IHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPEGQGIL 491

Query: 472 NALLAECFDILHELKIEA 489
           NA+LAECFD++HELK +A
Sbjct: 492 NAMLAECFDMVHELKCDA 509

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 55/121 (45%), Gaps = 22/121 (18%)

Query: 197 YEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQGVKTPDSLLPQEGIKQ 256
           Y+ +ES  E I   LQS   +L  +RR L++L    KR      GV     L P +    
Sbjct: 416 YKLLESS-EPISESLQSIHTQLSTVRRCLMTL----KRLG----GVTDIKELYPYQMKLA 466

Query: 257 RLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNGLLDDCHDLINDLSHHANNFV 316
            L EL  +           GKF     G+I  +GQ +LN +L +C D++++L   A  + 
Sbjct: 467 SLDELRID-----------GKFYD-ANGDIP-EGQGILNAMLAECFDMVHELKCDAEAYS 513

Query: 317 S 317
           S
Sbjct: 514 S 514

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/491 (63%), Positives = 379/491 (77%), Gaps = 14/491 (2%)

Query: 1   MPKHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIR 60
           + K+   VP EEES L Y L+VR  L++LK NRSQ+LNSK+V + +Q+VLTKVRELD IR
Sbjct: 13  LSKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIR 72

Query: 61  KSSHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 120
           K      A  + T+IHN  LHN+VDS+LDDVFQLLSL FLTVGLKNSAPATY+SLSTVQ+
Sbjct: 73  KRQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQK 132

Query: 121 LLEHLDESNVFTHHDLRPIKERLDEISEIVSQSSY----LDGTEISDGRIDFAKIQDEKD 176
           LLEHLDESN+FT+HDLRPIK+RLDEIS IV  +SY     D T  +D      + +++++
Sbjct: 133 LLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPAD------ETEEKRN 186

Query: 177 RNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNA 236
           +NKIEEDLLLRAKL+HCL EY  I SKLEEI P L S MEKL+ +RR LLSLA+ +++  
Sbjct: 187 KNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLSLASPSRKID 246

Query: 237 MSKQGVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNG 296
             +   +   S   QE +       E EL E+ESHRD +G F SLETGE+  KGQNVL G
Sbjct: 247 TREDFSQFNSSKESQEALSSL----EQELEELESHRDENGNFKSLETGEVVLKGQNVLAG 302

Query: 297 LLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQ 356
           L+D+CHDLIND ++  N    +D +L+PIYD LI+IKT L NL++TRRWTLR+TDLF YQ
Sbjct: 303 LVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQYQ 362

Query: 357 KRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQL 416
           K+L  ID  RV GKFPT++ D KGQAILLYLLRRCYAIIYKLLE S PVSE+LQ IHNQL
Sbjct: 363 KKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVSESLQSIHNQL 422

Query: 417 STVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLA 476
           ST RRCLL LKRMGGV ++RELYPYQ+KLASLD +R+DGKF+D +G IPEGQGTLNALLA
Sbjct: 423 STARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNALLA 482

Query: 477 ECFDILHELKI 487
           ECFDI+HEL+I
Sbjct: 483 ECFDIMHELEI 493

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/492 (63%), Positives = 372/492 (75%), Gaps = 18/492 (3%)

Query: 8   VPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSS---- 63
           VP  E   L Y ++VR  L++LK NRS+YLNSK+V   +Q+VLTKVRELD IRKS     
Sbjct: 17  VPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVRELDDIRKSKLKDD 76

Query: 64  --HHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRL 121
                     TTL+ N+ LHN+VDS++DDVFQLLSL FLTVGLKNSAPATY SLSTVQ+L
Sbjct: 77  GQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQKL 136

Query: 122 LEHLDESNVFTHHDLRPIKERLDEISEIVSQSSY----LDGTEISDGRIDFAKIQDEKDR 177
           LEHLDESN+FT+HDLRPIKERLDEIS+IV  +SY     +  EI+  ++D     DE  +
Sbjct: 137 LEHLDESNIFTNHDLRPIKERLDEISKIVQNNSYKNYEFNEDEINPNQVD----DDEIKQ 192

Query: 178 NKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAM 237
           N IEEDLLLRAKL+ C  E+  I SKLEEIDP L S MEKL+ +RR LLSLA+ T +   
Sbjct: 193 NLIEEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLSLASPTHK-ID 251

Query: 238 SKQGVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNGL 297
           + + +   ++    E  ++ L  L  ELTE+E+HRD  G F SLET E+  KGQN L GL
Sbjct: 252 TTENISIFNN---NEESRKMLKHLSDELTELETHRDEDGNFKSLETNEVKLKGQNALAGL 308

Query: 298 LDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQK 357
           +D+CHDLIND ++ + +   LD  LQPIY+NLI+IKT L NL++TRRWTLRETDLF YQK
Sbjct: 309 VDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMITRRWTLRETDLFQYQK 368

Query: 358 RLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLS 417
           RL EID  RV GKFP+E+ + KGQ+ILLYLLRRCYAIIYKLLE SEPVSE+LQ IHNQLS
Sbjct: 369 RLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESSEPVSESLQPIHNQLS 428

Query: 418 TVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAE 477
           T RRCLL LKRMGGV + RELYPYQ+KLASLD +R+DGKFYD  G IPEGQGTLNALLAE
Sbjct: 429 TTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSGEIPEGQGTLNALLAE 488

Query: 478 CFDILHELKIEA 489
           CFD+LHEL+IE+
Sbjct: 489 CFDMLHELEIES 500

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/451 (65%), Positives = 358/451 (79%), Gaps = 8/451 (1%)

Query: 43  MSTYQQVLTKVRELDAIRKSSH-HRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLT 101
           M+TYQ VLTKVR LD +RK  H         TLIH+  LHNRVDSVLDDVFQLLSLSFLT
Sbjct: 1   MATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLT 60

Query: 102 VGLKNSAPATYASLSTVQRLLEHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEI 161
           VGLKN+APATYASLSTVQRLLEH++E+NV+T+ DLRPIKERLDEI EIV ++SY+   E 
Sbjct: 61  VGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVE- 119

Query: 162 SDGRIDFAKIQDEKDRNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQL 221
            +  +D  ++ +EK  NK+EEDLL+RAKLQHC+  Y+ ++SK   I P LQ   +KLF +
Sbjct: 120 DEAPLD--ELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHI 177

Query: 222 RRGLLSLAASTKRNAMSKQGVKTPDSLLPQE--GIKQRLHELEAELTEIESHRDSSGKFV 279
           RR LLSLAAS K +  + +G  T  S  P     +  RL +LE+ + E+ESHRD SGKF+
Sbjct: 178 RRELLSLAASAKTDRAAGEG-STERSTTPASPNTLASRLKDLESMILEVESHRDDSGKFI 236

Query: 280 SLETGE-IAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLEN 338
           S +  + +  KGQ+ LNGLLDDC +L  DLSH  +  + LD +LQPIY+ L++IKTTLEN
Sbjct: 237 SPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLEN 296

Query: 339 LLVTRRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKL 398
           LLVTRRWTLRETDLF+YQKRL+E+D LRV  K P+ ++ +KGQA++LYLLRRCYA IYKL
Sbjct: 297 LLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQALILYLLRRCYATIYKL 356

Query: 399 LECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFY 458
           LE SEPVSE+LQKIHNQLSTVRRCL ELKRMGGV+++R+LYPYQMKLASLDN+RVDGKFY
Sbjct: 357 LESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKFY 416

Query: 459 DEDGNIPEGQGTLNALLAECFDILHELKIEA 489
           D DGNIPEGQGTLNALLAECFDILHE+KIEA
Sbjct: 417 DADGNIPEGQGTLNALLAECFDILHEMKIEA 447

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 101/217 (46%), Gaps = 28/217 (12%)

Query: 199 HIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQGVKTPDSLLPQEGIKQRL 258
           H  S +  +DP+LQ   E+L +++  L +L   T+R  + +  +            ++RL
Sbjct: 268 HQTSGVLHLDPQLQPIYEELLEIKTTLENLLV-TRRWTLRETDLF---------AYQKRL 317

Query: 259 HELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSL 318
               AEL  +  +R S        +   A KGQ ++  LL  C+  I  L   +     +
Sbjct: 318 ----AELDNLRVNRKSP-------SSSSASKGQALILYLLRRCYATIYKLLESSE---PV 363

Query: 319 DSKLQPIYDNLIDIKTTLENLLVTRRWTL-RETDLFSYQKRLSEIDKLRVGGKFPTENAD 377
              LQ I++ L  ++  L  L   R   +  E DL+ YQ +L+ +D +RV GKF   + +
Sbjct: 364 SESLQKIHNQLSTVRRCLFEL--KRMGGVDSERDLYPYQMKLASLDNMRVDGKFYDADGN 421

Query: 378 -AKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIH 413
             +GQ  L  LL  C+ I++++   +E   E L +++
Sbjct: 422 IPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVN 458

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  182 bits (462), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 133/413 (32%), Positives = 219/413 (53%), Gaps = 39/413 (9%)

Query: 110 ATYASLSTVQRLLEHLDESNVFTHHDLRPIKERLDEISEIVSQSSYL------------- 156
           + Y+S+  ++ LL  L++SN+FT +DL P+K RLDEI +I+     L             
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECEENDNEDNE 132

Query: 157 ----------DGTEISDGRIDFAKIQDEKDR-----NKIEEDLL---LRAKLQHCLQEYE 198
                        EI     D    Q   D       K ++  L   +  +L  C + + 
Sbjct: 133 DNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDDCYKVHN 192

Query: 199 HIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQGVKTPDSLLPQEGIKQRL 258
            IE K + ID  L S ++K+  +R+ LL +  S  ++   +  V    + +      ++L
Sbjct: 193 VIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSRVKSVFPQCFVLKDPNHMSNSTFDKKL 252

Query: 259 HELEAELTEIE---SHRDSSGKFVSLETGEIAGKGQNVLNGLLDDCHDLINDLSHHANNF 315
           +E++  L  I+   +  D      +   G I   GQ +LNGL+D C ++I+D+   A + 
Sbjct: 253 NEIQRNLDVIKEKNTEYDEGQSQRNKNEGNI--NGQRILNGLVDYCQEVIHDVKLLAIDK 310

Query: 316 VSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQKRLSEIDKLRVGGKFPTEN 375
           +  D K   +++  + +K  LE +LVT R +L+  DLF+  K LS+++K R    +  E+
Sbjct: 311 ID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEK-RTIRHYNIED 368

Query: 376 ADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVEND 435
           +  + ++I+++ LRRC+ IIYK+LE SEPV   L+ ++NQLST+ R LL+LK  GGVE  
Sbjct: 369 S-FQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKIAGGVEKM 427

Query: 436 RELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECFDILHELKIE 488
            +L P ++KL ++ + R++  F DE GNIP GQ  LNALL EC ++L  L+I+
Sbjct: 428 DDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEID 480

>YBL034C Chr2 complement(153848..158389) [4542 bp, 1513 aa] {ON}
           STU1Component of the mitotic spindle that binds to
           interpolar microtubules via its association with
           beta-tubulin (Tub2p); required for interpolar
           microtubules to provide an outward force on the spindle
           poles
          Length = 1513

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 74/184 (40%), Gaps = 37/184 (20%)

Query: 308 LSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVT--------RRWTLRETDLFSYQKRL 359
           L   +NN  S D  ++  Y++L  ++  LENLL          + W LR++++       
Sbjct: 294 LPQLSNNLSSKDPAMKKNYESLNQLQQDLENLLAPFQSVKETEQNWKLRQSNII------ 347

Query: 360 SEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTV 419
            E+D + + G  P +N +              +  + K ++  E +S A   +   LS  
Sbjct: 348 -ELDNI-ISGNIPKDNPEE-------------FVTVIKEVQLIELISRATSSLRTTLSLT 392

Query: 420 RRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECF 479
              LL LKR+  + ND      Q+ L+ LD + V  K           Q   + L+    
Sbjct: 393 --ALLFLKRLIHILND------QLPLSILDQIFVIFKNLLSSTKKISSQTAFHCLITLII 444

Query: 480 DILH 483
           DI H
Sbjct: 445 DINH 448

>Skud_2.69 Chr2 complement(137636..142177) [4542 bp, 1513 aa] {ON}
           YBL034C (REAL)
          Length = 1513

 Score = 35.0 bits (79), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 73/184 (39%), Gaps = 37/184 (20%)

Query: 308 LSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVT--------RRWTLRETDLFSYQKRL 359
           L   +NN  S DS  +  Y++L  ++  LENLLV         + W LR++++       
Sbjct: 291 LPQLSNNLSSKDSSTKKNYESLNQLQQDLENLLVPFQNIKETEQNWKLRQSNII------ 344

Query: 360 SEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTV 419
            E+D + + G  P  N +              +  I K ++  E +S A   +   LS  
Sbjct: 345 -ELDNI-ISGNVPKNNPEE-------------FVTIMKEVQLIELISRATSSLRTTLSLT 389

Query: 420 RRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECF 479
              LL LK++  + ND       + L+ LD + V  K           Q   + L+    
Sbjct: 390 --ALLFLKKLIHILND------NLSLSILDQIFVIFKNLLSSTKKISSQTAFHCLITLII 441

Query: 480 DILH 483
           DI H
Sbjct: 442 DINH 445

>Smik_2.80 Chr2 complement(147598..152148) [4551 bp, 1516 aa] {ON}
           YBL034C (REAL)
          Length = 1516

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 91/220 (41%), Gaps = 42/220 (19%)

Query: 277 KFVSLETGEIAGKGQNVLNGLLDDCHD---LIND--LSHHANNFVSLDSKLQPIYDNLID 331
           KFVSL + +     Q   + L D+ ++   L+ +  L   +NN  S DS ++  Y++L  
Sbjct: 258 KFVSLASSQDQCGLQEDKSALFDEEYEFQLLLTEAKLPQLSNNLSSKDSVVKKNYESLSQ 317

Query: 332 IKTTLENLLVT--------RRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAI 383
           ++  LENLLV         + W LR++++        E+D + + G  P +N +      
Sbjct: 318 LQQDLENLLVPFQSIKETEQNWKLRQSNII-------ELDNI-ISGNVPKDNPEG----- 364

Query: 384 LLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQM 443
                   +    + ++  E +S A   +   LS     LL LKR+  + +D       +
Sbjct: 365 --------FVTAMREVQLIELISRATSSLRTTLSLT--ALLFLKRLIHILSD------HL 408

Query: 444 KLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECFDILH 483
            L+ LD V V  K           Q   + L+    DI H
Sbjct: 409 PLSILDQVFVIFKNLLSSTKKISSQTAFHCLITLIIDINH 448

>Smik_2.81 Chr2 complement(147598..152148) [4551 bp, 1516 aa] {ON}
           YBL034C (REAL)
          Length = 1516

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 91/220 (41%), Gaps = 42/220 (19%)

Query: 277 KFVSLETGEIAGKGQNVLNGLLDDCHD---LIND--LSHHANNFVSLDSKLQPIYDNLID 331
           KFVSL + +     Q   + L D+ ++   L+ +  L   +NN  S DS ++  Y++L  
Sbjct: 258 KFVSLASSQDQCGLQEDKSALFDEEYEFQLLLTEAKLPQLSNNLSSKDSVVKKNYESLSQ 317

Query: 332 IKTTLENLLVT--------RRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAI 383
           ++  LENLLV         + W LR++++        E+D + + G  P +N +      
Sbjct: 318 LQQDLENLLVPFQSIKETEQNWKLRQSNII-------ELDNI-ISGNVPKDNPEG----- 364

Query: 384 LLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQM 443
                   +    + ++  E +S A   +   LS     LL LKR+  + +D       +
Sbjct: 365 --------FVTAMREVQLIELISRATSSLRTTLSLT--ALLFLKRLIHILSD------HL 408

Query: 444 KLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECFDILH 483
            L+ LD V V  K           Q   + L+    DI H
Sbjct: 409 PLSILDQVFVIFKNLLSSTKKISSQTAFHCLITLIIDINH 448

>KLLA0D03036g Chr4 complement(255868..256974) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q06697 Saccharomyces cerevisiae
           YLR418C CDC73 Substituent of the Paf1 complex together
           with RNA polymerase II Paf1p Hpr1p Ctr9 Leo1 Rtf1 and
           Ccr4p distinct from Srb-containing Pol II complexes
           required for the expression of certain genes and
           modification of some histones
          Length = 368

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 6/86 (6%)

Query: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62
           K P  + P   SS+     +R FL       S+Y+N KD+  +++ ++T V++ D I + 
Sbjct: 211 KDPIILIPSAASSIFTIANIRQFLEE-----SKYVNPKDLPISHKDLVTAVKKFDRISRP 265

Query: 63  SHHRPANSATTLIHNVELHNRVDSVL 88
                 N+ T L    E  +RV ++ 
Sbjct: 266 IRFLIVNN-TKLFTQPEYWDRVVAIF 290

>NCAS0I00760 Chr9 complement(135901..137943) [2043 bp, 680 aa] {ON}
           Anc_7.149 YER005W
          Length = 680

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 66/160 (41%), Gaps = 38/160 (23%)

Query: 8   VPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSSHHRP 67
           +PP++ SS   F++    +  L + +SQ                  R LD + K      
Sbjct: 92  IPPKKLSSTPIFIQATAGMRLLPKKKSQ------------------RILDQLCKDIKK-- 131

Query: 68  ANSATTLIHNVELH-NRVDSVLDDVFQLLSLSFLTVGLKNSAP--ATYASL-------ST 117
             S   L+ + E   N +D  L+ ++  LSL++L+   KN +P  AT+ SL       ++
Sbjct: 132 --STNFLLSDCESQINIIDGELEGLYGWLSLNYLSNNFKNFSPSSATHQSLGFMDMGGAS 189

Query: 118 VQRLLEHLDESNVFTHHD------LRPIKERLDEISEIVS 151
           VQ      D+  V  HHD      LR +   L E    VS
Sbjct: 190 VQIAFAPSDKEQVKKHHDDIAKVTLRSLNGDLQEWDVFVS 229

>Suva_7.179 Chr7 (336046..337338) [1293 bp, 430 aa] {ON} YGL090W
           (REAL)
          Length = 430

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 63/130 (48%), Gaps = 11/130 (8%)

Query: 145 EISEIVSQSSYLDGTEISDGRIDFAKIQDE--KD--------RNKIEEDLLLRAKLQHCL 194
           E S I+ + +  D   + +G  D  ++ D+  +D        RN  E DL  R++++  +
Sbjct: 134 ESSAIIRKIAEFDLCPVKNGEADLFEMADKLYQDICSVNDSYRNMKESDLRNRSRVKELV 193

Query: 195 QEYEHIESKLEEIDPRLQSTMEKLF-QLRRGLLSLAASTKRNAMSKQGVKTPDSLLPQEG 253
           QE E ++  LEE D + ++ +  L  + ++ +  L  + +RN +   G   PDS L    
Sbjct: 194 QERELLDKLLEERDNKTRAIVVTLLNEKKKKIRELNETLRRNNIKVCGDDIPDSGLINME 253

Query: 254 IKQRLHELEA 263
           + + + EL +
Sbjct: 254 VAKPISELNS 263

>Kwal_33.14659 s33 complement(760813..765849) [5037 bp, 1678 aa]
           {ON} YNL139C (RLR1) - Involved in transcription [contig
           388] FULL
          Length = 1678

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 114 SLSTVQRLLEHLDESNVFTHHDLRPIKERLDEISEI----VSQSSYLDGTE-ISDGRIDF 168
           SLS V  LLEH   S V      + I  R+DE+S +    +  S Y  GTE  ++  + F
Sbjct: 794 SLSEVIILLEHFKNSMVSQEAHYKVISSRIDEVSSLLWSFIDMSKYFLGTEKFAENIVPF 853

Query: 169 AKIQDE 174
            ++ DE
Sbjct: 854 DQLVDE 859

>KNAG0A01920 Chr1 complement(146963..147691) [729 bp, 242 aa] {ON}
           Anc_8.549 YPL078C
          Length = 242

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 94  LLSLSFLTVGL---KNSAPA--TYASLSTVQRLLEHLDESNVFTHHDLRPIKERLDEISE 148
           +L LSFLTVG    K +APA  T+A      R+ +  D  N      +  +KER+D +SE
Sbjct: 90  ILLLSFLTVGALMAKFAAPAYNTFAE----ARMKKVADVLNASRERHVSAVKERIDSVSE 145

Query: 149 IVSQS 153
           + + S
Sbjct: 146 LTNVS 150

>Ecym_2643 Chr2 complement(1239905..1241359) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii ACR284C
          Length = 484

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 58/129 (44%), Gaps = 30/129 (23%)

Query: 119 QRLLEHLDESNVFTHHDLRPIKERLDEISE-----IVSQSSYLDGT--EIS-------DG 164
           QR+LE+    N+F HH+++  +  L EI E       S+  YL+ T  EIS         
Sbjct: 228 QRILEY----NLFKHHNIKSCRLTLHEIHEKTKTDATSRRLYLNATNQEISVVYFRAGYS 283

Query: 165 RIDFAKIQDEKDRNKIEEDLLLRA-----------KLQHCLQEYEHIESKL-EEIDPRLQ 212
             DF+  QD ++R  +E  L ++A           K+Q  L     +   + EE+  +L 
Sbjct: 284 PADFSCDQDWENRLSLETSLAIKAPNLLTQLSGTKKIQQLLTSSSVLTRFVSEEVASKLS 343

Query: 213 STMEKLFQL 221
            T  K++ L
Sbjct: 344 PTFVKMYPL 352

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,541,815
Number of extensions: 2332305
Number of successful extensions: 10275
Number of sequences better than 10.0: 229
Number of HSP's gapped: 10642
Number of HSP's successfully gapped: 260
Length of query: 595
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 480
Effective length of database: 40,294,809
Effective search space: 19341508320
Effective search space used: 19341508320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)