Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F06534g3.165ON46646624120.0
Kwal_33.141823.165ON46746721470.0
SAKL0C07414g3.165ON48248216680.0
TDEL0D045803.165ON48248516110.0
ZYRO0B04840g3.165ON47648215380.0
Kpol_1045.443.165ON46947314970.0
CAGL0C05203g3.165ON47547814790.0
NCAS0C035803.165ON49149414340.0
Ecym_52393.165ON46447714310.0
YOL062C (APM4)3.165ON49149614260.0
Suva_15.1033.165ON49149714210.0
Skud_15.913.165ON49149514170.0
Smik_15.963.165ON49149814060.0
NDAI0G029203.165ON48648813850.0
TBLA0F008403.165ON48148112911e-175
TPHA0P006603.165ON47348312581e-170
KNAG0K011503.165ON47448512551e-170
KLLA0C03894g3.165ON47548412501e-169
ADR315W3.165ON49243911981e-161
KAFR0C010203.165ON42847610361e-137
Kwal_55.208437.127ON4414745702e-67
KLTH0F12584g7.127ON4414735692e-67
NDAI0E036807.127ON4444745544e-65
Ecym_83507.127ON4454675527e-65
YPL259C (APM1)7.127ON4755045478e-64
KLLA0D14311g7.127ON4434755413e-63
NCAS0E021407.127ON4814865443e-63
Smik_6.4667.127ON4765045401e-62
SAKL0F05346g7.127ON4474865381e-62
Suva_16.457.127ON4785065391e-62
KNAG0L009507.127ON4614895345e-62
ADL017C7.127ON4434755292e-61
TDEL0H028907.127ON4424805265e-61
ZYRO0C05236g7.127ON4474715204e-60
Skud_16.197.127ON4765105215e-60
CAGL0K00539g7.127ON4564805197e-60
KAFR0L004707.127ON4654975181e-59
Kpol_1062.567.127ON4504785082e-58
TBLA0A009507.127ON4694975102e-58
TPHA0C043207.127ON4544794971e-56
KLTH0D07502g2.555ON5044792513e-22
SAKL0D13090g2.555ON4994792494e-22
Kwal_26.81462.555ON5055252264e-19
ZYRO0E05874g2.555ON5493282256e-19
Ecym_45912.555ON5015162212e-18
KLLA0F25432g2.555ON5073452175e-18
KAFR0A020602.555ON5402242122e-17
TDEL0B064302.555ON5255452105e-17
TBLA0B067602.555ON6572242052e-16
Kpol_1056.132.555ON5415582042e-16
TPHA0I023902.555ON5592452033e-16
Skud_8.262.555ON5963572033e-16
CAGL0K03223g2.555ON5982542016e-16
ABR047W2.555ON4984811981e-15
Suva_8.332.555ON5963611982e-15
NCAS0A126502.555ON5883531962e-15
YHL019C (APM2)2.555ON6053621911e-14
Smik_8.232.555ON6033621911e-14
KNAG0C055502.555ON5821811883e-14
NDAI0B016102.555ON6722491883e-14
Kwal_26.79572.522ON4563131802e-13
KLTH0D06556g2.522ON4563141651e-11
KLLA0E18789g2.522ON4971351552e-10
TDEL0A029702.522ON4961461518e-10
ZYRO0B01738g2.522ON4923281463e-09
KAFR0D035602.522ON4551331463e-09
TBLA0I006202.522ON6092331446e-09
AGL061W2.522ON4113041365e-08
SAKL0A09218g2.522ON4733041331e-07
Smik_2.4302.522ON4843221285e-07
NCAS0A048702.522ON4891531241e-06
Kpol_1018.422.522ON5751491171e-05
TPHA0C041302.522ON5331371161e-05
YBR288C (APM3)2.522ON4833191152e-05
Suva_4.5482.522ON4843231091e-04
NDAI0K019302.522ON6122311063e-04
Skud_2.4192.522ON4843221044e-04
CAGL0L02145g2.522ON543187970.003
KNAG0A069702.522ON50536880.037
KNAG0F010602.44ON42862741.4
KAFR0A077602.44ON42587713.5
Kwal_55.209727.159ON13571666.9
Kpol_507.73.575ON53358688.0
Smik_10.131singletonON59730688.1
KNAG0B043505.400ON96693688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F06534g
         (466 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   933   0.0  
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   831   0.0  
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   647   0.0  
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   625   0.0  
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   597   0.0  
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   581   0.0  
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   574   0.0  
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   556   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   555   0.0  
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   553   0.0  
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   551   0.0  
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   550   0.0  
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   546   0.0  
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   538   0.0  
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   501   e-175
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   489   e-170
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   488   e-170
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   486   e-169
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   466   e-161
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   403   e-137
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   224   2e-67
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   223   2e-67
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   218   4e-65
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   217   7e-65
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   215   8e-64
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   213   3e-63
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   214   3e-63
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   212   1e-62
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   211   1e-62
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   212   1e-62
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   210   5e-62
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   208   2e-61
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   207   5e-61
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   204   4e-60
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   205   5e-60
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   204   7e-60
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   204   1e-59
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   200   2e-58
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   201   2e-58
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   196   1e-56
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   101   3e-22
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   100   4e-22
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...    92   4e-19
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...    91   6e-19
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...    90   2e-18
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...    88   5e-18
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...    86   2e-17
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...    86   5e-17
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    84   2e-16
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...    83   2e-16
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...    83   3e-16
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...    83   3e-16
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...    82   6e-16
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...    81   1e-15
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...    81   2e-15
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...    80   2e-15
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    78   1e-14
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...    78   1e-14
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...    77   3e-14
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    77   3e-14
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    74   2e-13
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    68   1e-11
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    64   2e-10
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    63   8e-10
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    61   3e-09
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    61   3e-09
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    60   6e-09
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    57   5e-08
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    56   1e-07
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    54   5e-07
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    52   1e-06
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    50   1e-05
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    49   1e-05
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    49   2e-05
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    47   1e-04
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    45   3e-04
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    45   4e-04
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    42   0.003
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    39   0.037
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    33   1.4  
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    32   3.5  
Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W...    30   6.9  
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    31   8.0  
Smik_10.131 Chr10 complement(209599..209681,209864..211574) [179...    31   8.1  
KNAG0B04350 Chr2 (828924..831824) [2901 bp, 966 aa] {ON} Anc_5.4...    31   8.7  

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/466 (97%), Positives = 455/466 (97%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60

Query: 61  GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDGVP 120
           GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDGVP
Sbjct: 61  GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDGVP 120

Query: 121 VDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXXXXXKV 180
           VDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRAR           KV
Sbjct: 121 VDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHDSHSKV 180

Query: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240
           PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG
Sbjct: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240

Query: 241 LNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPPD 300
           LNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPPD
Sbjct: 241 LNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPPD 300

Query: 301 GSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRIPVPPE 360
           GSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRIPVPPE
Sbjct: 301 GSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRIPVPPE 360

Query: 361 TVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSALNIDQWSKPPMS 420
           TVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSALNIDQWSKPPMS
Sbjct: 361 TVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSALNIDQWSKPPMS 420

Query: 421 LKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEVRY 466
           LKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEVRY
Sbjct: 421 LKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEVRY 466

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/467 (85%), Positives = 430/467 (92%), Gaps = 1/467 (0%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           ML+ALFI+SLRGELLISKHV+ SV KSMSEIFRIQVINNLDVRSPVLTLGSTTFHH+KS 
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60

Query: 61  GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDGVP 120
            NLWIVAVSRSNADSAAIWEFLY+L+ LLEAF L+SENELKE FM CYELLDIVLEDG+P
Sbjct: 61  KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDGLP 120

Query: 121 VDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXXXXXKV 180
           VDTELSSVASKMSVKP+A  +  N F E+G+GGTNRILPV+QFLR R           + 
Sbjct: 121 VDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIASEA 180

Query: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240
           PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG
Sbjct: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240

Query: 241 LNDSLSVSTPFG-DNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPP 299
           LND+LSVSTPFG D+E   TNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFI P
Sbjct: 241 LNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAP 300

Query: 300 DGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRIPVPP 359
           DGSFELMKYHVRENLNLPFK+TP+VT+ ++NSIDY++TIKSLFPSKLTAKDVQLRIPVPP
Sbjct: 301 DGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRIPVPP 360

Query: 360 ETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSALNIDQWSKPPM 419
           ETV CHISTSNG+CKFVPEESAI+WKFSKYQGLTENS+SATAVPMKDS LNI+QW +PP+
Sbjct: 361 ETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQWPRPPI 420

Query: 420 SLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEVRY 466
           SLKFEIVMFSNSGLVVRFF+VSE DRNYKMVKWIKYLSKSGAYEVRY
Sbjct: 421 SLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAYEVRY 467

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/482 (66%), Positives = 386/482 (80%), Gaps = 16/482 (3%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           ML+ALF+FS +GEL++SK +R ++ +S++EIFRIQVINNLDVRSPVLTLGSTTFHH++S 
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60

Query: 61  GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDGVP 120
            NLWIVAV+RSNADSAAIWEFLYK +ALLEA+GL+SE  LKE+FMTCYELLD+VLE+GVP
Sbjct: 61  SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVP 120

Query: 121 VDTELSSVASKMSVKPSASAER---INTFIESGNGGTNRILPVAQFLRARXXXXXXXXXX 177
           VDTELSSVASKMS +P  S E     +  + S     +    + +FL             
Sbjct: 121 VDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSSSVSSP 180

Query: 178 XKV-----PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLS 232
                   P   PWR +GIKYKKNE+FL+VNERI+ILVSKDGSILKSYVDG+V+ TTHLS
Sbjct: 181 ANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLS 240

Query: 233 GMPVCRFGLNDSLSV--STPFGD----NESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLD 286
           G P+C+FGLNDSLS+   T   D    +E    NKKAIPKAAAGSV LEDCKFHQCVQL+
Sbjct: 241 GTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLN 300

Query: 287 KFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKAN-SIDYRVTIKSLFPSK 345
           +F ++R I F+PPDGSFELM+YHVR+NLNLPFKITP+ ++   N +++YRV +KSLFPSK
Sbjct: 301 RFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLFPSK 360

Query: 346 LTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMK 405
           LTAKDV LRIPVPP TVDC I+TSNGRC+FVPEE+A++WKF+KYQGLTEN+LSA  VPM 
Sbjct: 361 LTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALTVPMD 420

Query: 406 D-SALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEV 464
           + S+LN+ QWS+PPMSL FEI+MFSNSGLVVRFF VSE D +Y  VKW+KY+S+SGAYEV
Sbjct: 421 NQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSGAYEV 480

Query: 465 RY 466
           RY
Sbjct: 481 RY 482

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/485 (63%), Positives = 377/485 (77%), Gaps = 22/485 (4%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M+SA+ IFS RGEL+++K ++SS+ KS+S+IFRIQVINNLDVRSP+LTLGSTTFHH++S 
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60

Query: 61  GN--LWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDG 118
           G+  LW+VAVSRSNA+S AIWEFLYKL+ +++ +GL  E  LKE+FM CYE+LD VLE+G
Sbjct: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120

Query: 119 -VPVDTELSSVASKMSVKPSASAE----------RINTFIESGNGGTNRILPVAQFLRAR 167
            +PVDTEL+SV SKM+VKP                +++   S  G ++  L + +FL  R
Sbjct: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFL-TR 179

Query: 168 XXXXXXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEA 227
                        PSN+ WR +GIKYKKNEV LNVNE+ISILVS+DGSILKSYVDGT++ 
Sbjct: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDL 239

Query: 228 TTHLSGMPVCRFGLNDSLSVSTPFGDNE----SPTTNKKAIPKAAAGSVMLEDCKFHQCV 283
           TTHLSGMP+C+FGLNDSLSV   FGD+         NKKAIPKAAAG VMLEDCKFHQCV
Sbjct: 240 TTHLSGMPICQFGLNDSLSVE--FGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCV 297

Query: 284 QLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVT-LFKANSIDYRVTIKSLF 342
            LDKF  +R I F+PPDGS ELMKY VR+NLNLPFK+TP+VT + + N+IDYRVT+KSLF
Sbjct: 298 SLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLF 357

Query: 343 PSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAV 402
           P KL+AKDV LRIPVPP TVDC I+ SNG+CKFVPEESA+IWKF+KY GLTEN+LSA  V
Sbjct: 358 PGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTV 417

Query: 403 PMKDSA-LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGA 461
           P  D+  L + QW +PPMSL FEI+MFSNSGLVVR+F VS+ D  Y+  KWIKY+SKSG+
Sbjct: 418 PSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGS 477

Query: 462 YEVRY 466
           YE+RY
Sbjct: 478 YEIRY 482

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/482 (62%), Positives = 372/482 (77%), Gaps = 22/482 (4%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M++A+FI+S RGEL++SK   +S+ +S+S+IFRIQVINNLDVRSP+LTLGSTTFHH++S 
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GN--LWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVL-ED 117
           G+  LWIV VSR+NA+S AIWEFLYK +A+L+A+ L  E +LKEDFM CYE+LD+V+   
Sbjct: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120

Query: 118 GVPVDTELSSVASKMSVKPSAS--------AERINTFIESGNGGTNRILPVAQFLRARXX 169
           G+P+DTEL S+ASK+SVKP  S        +  +  F  S    +N  +P  +FL  R  
Sbjct: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMP--KFL-TRNN 177

Query: 170 XXXXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATT 229
                      PSN PWR NGIKYKKNEVFL VNE+I+ILVS+DGSILK+YVDGT++ TT
Sbjct: 178 RSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTT 237

Query: 230 HLSGMPVCRFGLNDSLSVSTPFGD----NESPTTNKKAIPKAAAGSVMLEDCKFHQCVQL 285
           HLSG P+C+FGLNDS SV   FGD    +     NKKA+PKAAAGSVMLEDCKFHQCV L
Sbjct: 238 HLSGTPICQFGLNDSPSVE--FGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295

Query: 286 DKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSK 345
           DKF  ER I F+PPDG+ ELMKY VR+NLNLPFKITPVVT    ++++YR+T+KSLFP+K
Sbjct: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC-GSTVEYRITLKSLFPNK 354

Query: 346 LTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMK 405
           L+AKDV L IPVPP TVDC I+ SNG+CKF  EE+A++W+F+KY GLTEN+LSA  VP  
Sbjct: 355 LSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTS 414

Query: 406 DSA-LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEV 464
           D+  L + QW +PPMSL FEI+MFSNSGLVVR+F VS+ D  Y++VKWIKY+SKSG+YEV
Sbjct: 415 DTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGSYEV 474

Query: 465 RY 466
           RY
Sbjct: 475 RY 476

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/473 (59%), Positives = 366/473 (77%), Gaps = 11/473 (2%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M++ + +++ +GEL++SK  +S+  +S+S+IFR+QVINNLDVRSP+LTLGSTTFHH++S 
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  G--NLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLE-D 117
              +LW+VAV+RSNA+S AIWEFLYK  +LL AFGL +E  LKE+FMTCYELLD++L  D
Sbjct: 61  SRDHLWLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLDLMLNVD 120

Query: 118 GVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXXXX 177
           GVP+DTELSSV++KMS KP  S   IN+  +S    ++  L +++FL  R          
Sbjct: 121 GVPLDTELSSVSAKMSTKPLHS---INSPSDSSLDNSSSPLSISKFLN-RNNRSMSVDTM 176

Query: 178 XKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVC 237
              PSN PWR NGIKYKKNE+FLN+NE+ISILVSKD +ILK+YVDGTV+ T+HLSG P C
Sbjct: 177 NTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPTC 236

Query: 238 RFGLNDSLSVSTP--FGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTIN 295
           +FGLNDSLSV  P  +  +++   N++ IP+A AG+V+LEDCKFH+CV LDKF  +R I 
Sbjct: 237 QFGLNDSLSVDEPNYYNSDDNGFRNQQNIPRATAGTVVLEDCKFHECVSLDKFNRDRIIK 296

Query: 296 FIPPDGSFELMKYHVRENLNLPFKITP-VVTLFKANSIDYRVTIKSLFPSKLTAKDVQLR 354
           F+PPDG  ELMKYHVR+N+NLPFK+TP V+       +DYR+T+KSLFPSKL+A DV L+
Sbjct: 297 FVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLSANDVVLK 356

Query: 355 IPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSA-LNIDQ 413
           IPVP  TVDC ++ SNG+C+FVPEES IIWKF+KY GLTEN LSA  V   D+  L + Q
Sbjct: 357 IPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAVTVSSNDTTQLMLQQ 416

Query: 414 WSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEVRY 466
           W++PP+SL FEI+MFSNSGLVVR+  + E D+ Y+ VKWIKY+S+SG+YEVRY
Sbjct: 417 WARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSGSYEVRY 469

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/478 (58%), Positives = 363/478 (75%), Gaps = 15/478 (3%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKS- 59
           M+SA+ +FS RGEL++SK  ++++ +S+S+IFRIQVINNLDVRSP+LTLGSTTF H++S 
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60

Query: 60  --PGNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVL-E 116
               +LW+V+V+RSN +  A+WEFLYK   +LE +GL++E  LKE+FM CYELLD++L E
Sbjct: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120

Query: 117 DGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRA-----RXXXX 171
           +G P+DT+ ++V  KMSVKPS   E I  F  S     + +  + +FLR           
Sbjct: 121 NGTPMDTDPATVIKKMSVKPSK--ETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQESS 178

Query: 172 XXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231
                   +   +PWR  GI +KKNE+FL VNE+ISILVSK+GSILKSYVDGT++  THL
Sbjct: 179 NNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTHL 238

Query: 232 SGMPVCRFGLNDSLSV-STPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS 290
           SG PVC+FGLNDSLSV +  +GD+     NKKAIPKAAAGSV+LEDCKFHQCV L+KF  
Sbjct: 239 SGTPVCQFGLNDSLSVKNDDYGDSFDYIKNKKAIPKAAAGSVLLEDCKFHQCVSLEKFDK 298

Query: 291 ERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANS-IDYRVTIKSLFPSKLTAK 349
           +R I F+PPDGS ELMKYHVR N+NLPFK++P+VT   + + ++YR+T+KSLFPSKLTAK
Sbjct: 299 DRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTAK 358

Query: 350 DVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSA- 408
           +V ++IPVPPET+DC I  SNG CKF PEE A++W F+KY GLTEN+LSA  +  KD+  
Sbjct: 359 NVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKDAPR 418

Query: 409 LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEVRY 466
           LNI QW KPP+SL FEI+MFSNSGLVVR+F + E +R YK VKWI+Y+SKSG+YE+RY
Sbjct: 419 LNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESER-YKTVKWIRYVSKSGSYEIRY 475

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/494 (55%), Positives = 362/494 (73%), Gaps = 31/494 (6%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M++AL IF+ RGEL++SK  + S+ +S+++IFRIQVINNLDVRSP+LTLGSTTFHH+KS 
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST 60

Query: 61  --GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVL--E 116
              NLWIVAVSR+N DSAAIWEFLYKL +LL+++GL+ E  LKE+FM  +ELLD+++   
Sbjct: 61  RGDNLWIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLDVMMCGS 120

Query: 117 DGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGT---------NRILPVAQFLRAR 167
            G+P+ TE S V S+MSVKPS S           +            + ++   + LR  
Sbjct: 121 GGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPKLLRRN 180

Query: 168 XXXXXXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEA 227
                       + ++  WR  GI +KKNEV L+VNERI+ILVSKDGS+LK+YVDG+++ 
Sbjct: 181 SASLSQDL---SILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSIDL 237

Query: 228 TTHLSGMPVCRFGLNDSLSVST-------------PFGDNESPTTNKKAIPKAAAGSVML 274
            THLSG P+C+FGLNDSLSVS               FGD     T+KK +  A+ GSV+L
Sbjct: 238 ETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVGSVIL 297

Query: 275 EDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFK-ANSID 333
           EDCKFHQCV LDKF  +R I F+PPDGS ELMKYHVR+NLNLPFK++P+VT  +   +++
Sbjct: 298 EDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRNGTALE 357

Query: 334 YRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLT 393
           YR+T+KSLFP +L+AK+V L IPVPP T+DC I+ +NG CKF+PEESA+IW+F+K+ GLT
Sbjct: 358 YRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKFNGLT 417

Query: 394 ENSLSATAVPMKD-SALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKW 452
           EN+LSA  +P KD + L++ QWSKPPMSL FEI+MFSNSGLVVR+F ++E D+ YK VKW
Sbjct: 418 ENTLSAVTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKYKAVKW 477

Query: 453 IKYLSKSGAYEVRY 466
           IKY+S+SG+YE+RY
Sbjct: 478 IKYISRSGSYEIRY 491

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/477 (57%), Positives = 347/477 (72%), Gaps = 24/477 (5%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M+SALF++S RG+L+ISK ++ ++   +SEIFRIQVINNLDVRSP+LTLGSTTFHH++S 
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDGVP 120
           G LW+V VSR N DSA IWEFLY  + LLE + ++SE+ L+ DFM CYE+LDIVL++G+P
Sbjct: 61  GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIP 120

Query: 121 VDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFL-RARXXXXXXXXXXXK 179
            DTEL+ +   +S KP          +     G++ IL    +L +A             
Sbjct: 121 RDTELTHIMPYISKKP----------LSENLLGSDDILNTPSWLVKAGARGMSSENLGLT 170

Query: 180 VPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRF 239
                 WR  GI+YKKNEV+L+V E ISILV+KDG+ILKSYVDG+V+   HLSGMPVC+F
Sbjct: 171 SKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQF 230

Query: 240 GLNDSLSVST--------PFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE 291
           G ND LS S+         + + E+ T   KAI  A  GSV+LEDCKFHQCVQLDKF  E
Sbjct: 231 GFNDYLSPSSNTQSSGNDGWAEEENGT---KAIKNAITGSVILEDCKFHQCVQLDKFDQE 287

Query: 292 RTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDV 351
           R I F+PPDG FELMKYHVR+NLNLPFK+TP+VT  K  S++YR+T+KSLFPSKL AKDV
Sbjct: 288 RVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDV 347

Query: 352 QLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDS--AL 409
           +L IP PP+TV+  I+ S+G+ KF+PEE+AI+WK  KY GLTEN  SA  VPM +   +L
Sbjct: 348 ELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSL 407

Query: 410 NIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEVRY 466
           N++QWS+PP+S++FEI MFSNSGLVVR+  V E D NY  VKW+KY+SKSGAYEVRY
Sbjct: 408 NLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYEVRY 464

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/496 (56%), Positives = 362/496 (72%), Gaps = 35/496 (7%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKS- 59
           M+S + ++S RGEL+++K  ++S+ +S+S+IFR+QVINNLDVRSPVLTLGSTTFHH++S 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 60  -PGNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLE-D 117
              NLW+V ++RSNA+SAAIWEFLYKL A++ A+ L  E  LKE+FM  +E+LDI+L  +
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVA-------------QFL 164
           G+P+DTEL+SV ++MSVKP      +   ++S +G  N +L  +             +FL
Sbjct: 121 GIPIDTELNSVIAQMSVKP---VRNMGGLLDSPDG--NDVLSSSSSPTSSAGELHFPKFL 175

Query: 165 RARXXXXXXXXXXXKV---PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYV 221
             R                 + I WR  GI +KK+EVFL VNERI+ILVS+DGSILKSYV
Sbjct: 176 TKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYV 235

Query: 222 DGTVEATTHLSGMPVCRFGLNDSLSVST---------PFGDNESPTTNKKAIPKAAAGSV 272
           DGT++ TTHLSG P+CRFGLNDSL + +             + S   NK  IPKAAAGSV
Sbjct: 236 DGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAGSV 295

Query: 273 MLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTL-FKANS 331
           +LEDCKFH+CV LDKF     I F+PPDGS ELMKYHVR+N+NLPFK+TP+VT   + N 
Sbjct: 296 LLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNE 355

Query: 332 IDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQG 391
           IDYR+T+KSLFP KL+AKDV L IPVPP TVDC IS SNG CKFVPEE+A+IW+F+KY G
Sbjct: 356 IDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNG 415

Query: 392 LTENSLSATAVPMKDSA-LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMV 450
           LTEN+LSA  V   D+  LN+ QW++PP+SL+FE++MFSNSGLVVR+F +S  D  ++ V
Sbjct: 416 LTENTLSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAV 475

Query: 451 KWIKYLSKSGAYEVRY 466
           KWIKY+SK+G+YEVRY
Sbjct: 476 KWIKYISKAGSYEVRY 491

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/497 (55%), Positives = 360/497 (72%), Gaps = 37/497 (7%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKS- 59
           M+S + ++S RGEL+++K  ++S+ +S+S+IFR+QVINNLDVRSPVLTLGSTTFHH++S 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 60  -PGNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLE-D 117
              NLW+V ++RSNA+SAAIWEFLYKL +++ A+ L  E  LKE+FM  +E+LDI+L  +
Sbjct: 61  RGDNLWLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GVPVDTELSSVASKMSVKPSASAERINTFIESGN--------------GGTNRILPVAQF 163
           G+P+DTEL+SV ++MSVKP      +   +ES +              GG    L   +F
Sbjct: 121 GIPIDTELNSVIAQMSVKP---IRNVGGLLESPDSIDMLSSTSSPSSVGGE---LHFPKF 174

Query: 164 LRARXXXXXXXXXXXKVPSN---IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSY 220
           L+ R              S+   I WR  GI +KK+EVFL VNER++ILVS+DGSILKSY
Sbjct: 175 LKKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSY 234

Query: 221 VDGTVEATTHLSGMPVCRFGLNDSLSVSTPFGDN---------ESPTTNKKAIPKAAAGS 271
           VDGT++ TTHLSG PVCRFGLNDSL + +   +N          +   NK   PKAAAGS
Sbjct: 235 VDGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAAGS 294

Query: 272 VMLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTL-FKAN 330
           V+LEDCKFH+CV +DKF     I F+PPDGS ELMKYHVR+N+NLPFKITP+V    + N
Sbjct: 295 VLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSARDN 354

Query: 331 SIDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQ 390
            +DYR+T+KSLFP KL+AKDV L IPVPP TVDC IS SNG CKFVPEE+A+IW+F+K+ 
Sbjct: 355 EVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFN 414

Query: 391 GLTENSLSATAVPMKDSA-LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKM 449
           GLTEN+LSA  V   D+  L++ QW++PPMSL FE++MFSNSGLVVR+F +S  D  ++ 
Sbjct: 415 GLTENTLSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRA 474

Query: 450 VKWIKYLSKSGAYEVRY 466
           VKWIKY+SKSG+YEVRY
Sbjct: 475 VKWIKYISKSGSYEVRY 491

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/495 (56%), Positives = 358/495 (72%), Gaps = 33/495 (6%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M+S + ++S RGEL+++K  ++S+ +S+S+IFR+QVINNLDVRSPVLTLGSTTFHH++S 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK 60

Query: 61  --GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLE-D 117
              NLW+V ++RSNA+SAAIWEFLYKL A++ A+ L  E  LKE+FM  +E+LDI+L  +
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRI------------LPVAQFLR 165
           G+P+DTEL+SV ++MSVKP     R    +  G  G++ +            L   +FL+
Sbjct: 121 GIPIDTELNSVVARMSVKPM----RNTGGLLDGADGSDILSSSSSPSSAGGELHFPKFLK 176

Query: 166 ARXXXXXXXXXXXK--VPSN-IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVD 222
                             SN I WR  GI +KK+EVFL VNER++ILVS+DGSILKSYVD
Sbjct: 177 KSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVD 236

Query: 223 GTVEATTHLSGMPVCRFGLNDSLSVSTPFGDN---------ESPTTNKKAIPKAAAGSVM 273
           GT++  THL+G PVCRFGLNDSL + +    N          S   NK  +PKAAAGSV+
Sbjct: 237 GTIDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSVL 296

Query: 274 LEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTL-FKANSI 332
           LEDCKFH+CV ++KF     I FIPPDGS ELMKYHVR+N+NLPFKITP+V+   + N I
Sbjct: 297 LEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNEI 356

Query: 333 DYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGL 392
           DYR+T+KSLFP KL+AKDV L IPVPP TVDC IS SNG CKFVPEE+A+IW+F+KY GL
Sbjct: 357 DYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGL 416

Query: 393 TENSLSATAVPMKDSA-LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVK 451
           TEN+LSA  V   D+  L+  QW++PPMSL FE++MFSNSGLVVR+F +S  D  ++ VK
Sbjct: 417 TENTLSAATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAVK 476

Query: 452 WIKYLSKSGAYEVRY 466
           WIKY+SKSG+YEVRY
Sbjct: 477 WIKYISKSGSYEVRY 491

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/498 (55%), Positives = 357/498 (71%), Gaps = 39/498 (7%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKS- 59
           M+S + I+S RGEL+++K  ++S+ +S+S+IFR+QVINNLDVRSPVLTLGSTTFHH++S 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 60  -PGNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLE-D 117
              NLW+V ++RSNA+SAAIWEFLYKL  ++ A+ L  E  LKE+FM  +E+LDI+L  +
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GVPVDTELSSVASKMSVKPSASAERINTFIESGNGG-----------TNRILPVAQFLRA 166
           G+P+DTEL+SV ++MSVKP          ++S +G             +  L   +FL+ 
Sbjct: 121 GIPIDTELNSVIAQMSVKP---VRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPKFLKK 177

Query: 167 RXXXXXXXXXXXKV---PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDG 223
                             + I WR  GI +KK+EVFL VNER++ILVS+DGSILKSYVDG
Sbjct: 178 SSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDG 237

Query: 224 TVEATTHLSGMPVCRFGLNDSLSVSTP-------------FGDNESPTTNKKAIPKAAAG 270
           T++ TTHLSG P+CRFGLNDSL + +               G+ ES    K  I KAAAG
Sbjct: 238 TIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFES----KNFIHKAAAG 293

Query: 271 SVMLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTL-FKA 329
           SV+LEDCKFH+CV LDKF    TI F+PPDGS ELMKYHVR+N+NLPFKITP+VT   + 
Sbjct: 294 SVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRD 353

Query: 330 NSIDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKY 389
           N IDYR+T+KSLFP KL+AKDV L IPVPP TVDC IS SNG CKFVPEE+A++W+F+KY
Sbjct: 354 NEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKY 413

Query: 390 QGLTENSLSATAVPMKDSA-LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYK 448
            GLTEN+LSA  V   D+  LN+ QW++PPMSL FE++MFSNSGLVVR+F +   D  ++
Sbjct: 414 NGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHR 473

Query: 449 MVKWIKYLSKSGAYEVRY 466
            VKWIKY+S+SG+YEVRY
Sbjct: 474 AVKWIKYISRSGSYEVRY 491

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/488 (54%), Positives = 359/488 (73%), Gaps = 24/488 (4%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M++ + I+S RGEL++SK  + ++ +S+++IFRIQVINNLDVRSP+LTLGSTTFHH++S 
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60

Query: 61  ---GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLED 117
               NLW+VA +R+NA+SAAIWEFLYKL ++L  +GL+ E  LKE+FM  +ELLD++L  
Sbjct: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120

Query: 118 -GVPVDTELSSVASKMSVKPSASAERINTFIESGNGGT--NRILPVAQFLRARXXXXXXX 174
            G+P++TE S V +KMSVKP+       + +  G+ G+  N  + + +FL+         
Sbjct: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDSSQSHD 180

Query: 175 XXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234
                  ++  WR   IK+KKNEV L+VNE+I+ILV+KDGSILK+YVDG+++  T LSG 
Sbjct: 181 SNFSF--NDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGT 238

Query: 235 PVCRFGLNDSLSVSTP----------FGDNESPTTN----KKAIPKAAAGSVMLEDCKFH 280
           PVC+FGLNDSL++ +            G+N+S   +     K + KA+ G+V+LEDCKFH
Sbjct: 239 PVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFH 298

Query: 281 QCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVT-LFKANSIDYRVTIK 339
           QCV LDKF  ER I F+PPDGS ELMKYH+R NLNLPFKITP+VT     +++DYR+ +K
Sbjct: 299 QCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALK 358

Query: 340 SLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSA 399
           SLFP +L+AK V L IPVPP  +DC+IS SNG CKFVP E+A++WKF+KY GLTEN+LSA
Sbjct: 359 SLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA 418

Query: 400 TAVPMKD-SALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSK 458
             VP K+ +   + QW++PPMSL FEI+MFSNSGLVVR+F +SEG +NYK VKWIKY+SK
Sbjct: 419 VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSK 478

Query: 459 SGAYEVRY 466
           SG+YEVR+
Sbjct: 479 SGSYEVRF 486

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  501 bits (1291), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 244/481 (50%), Positives = 345/481 (71%), Gaps = 15/481 (3%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M++A+ IF+ RGELL+ K  +SSV +++S+IFR+QVINN ++RSP+LTLGSTTFH +++ 
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT 60

Query: 61  GN--LWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLE-D 117
               LW+VAV+RSNADS AIWE+LYKL++L+E +GL  E+ LK++F+ C+ELLDI L  +
Sbjct: 61  AGSKLWLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLDITLGMN 120

Query: 118 GVPVDTELSSVASKMSVKP----SASAERINTFIESGNGGTNRILPVA--QFL-RARXXX 170
           G+P+DTELSSV  KM++KP    ++SA+R +    S     +   P++  +FL R     
Sbjct: 121 GLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSRNSNRS 180

Query: 171 XXXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTH 230
                     PSNIPWR   IKYKKNE+ +NV E+I++LV KD +IL++YVDGT++ T H
Sbjct: 181 VTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTIDITAH 240

Query: 231 LSGMPVCRFGLNDSLSVS---TPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDK 287
           LSGMP+C+ G+ND  ++         NE   +N+ A+P  +   V+LE  KFHQCV LDK
Sbjct: 241 LSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSGDRVILEGSKFHQCVALDK 300

Query: 288 FQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLF-KANSIDYRVTIKSLFPSKL 346
           +  +  I FIPPDG FELMKYHV  NLNLPF+ITP VTL     ++ Y + +KSLFP KL
Sbjct: 301 YNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIKLKSLFPRKL 360

Query: 347 TAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKD 406
           +A++V LRIPVPP T+DC I+ S+G+CKF+PEE+ ++W F ++ G TEN L+A  VP + 
Sbjct: 361 SAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHLNAQTVPTQS 420

Query: 407 -SALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEVR 465
            ++ +I QW++PPMSL F+++MFSN+GL+VR+  V E + +Y  +KWIKY+S +G+YEVR
Sbjct: 421 IASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYISAAGSYEVR 480

Query: 466 Y 466
           Y
Sbjct: 481 Y 481

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  489 bits (1258), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 241/483 (49%), Positives = 346/483 (71%), Gaps = 27/483 (5%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M++ + I+S RG+L++   ++SS+ +++S+IF+IQVIN+L+++SP+LTLGSTTFHH++S 
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS 60

Query: 61  G--NLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVL-ED 117
               LWIVA++RSNA+S  IWEFLYKL ++L A+ L++E +L E FM  YE++D++L  +
Sbjct: 61  SESKLWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMIDVMLTSN 120

Query: 118 GVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXXXX 177
            +P++TELSS+ASK+S +   +     T  ++ N G    L + +FL  R          
Sbjct: 121 AMPINTELSSIASKISYRLPKTISNSPTNEKNNNNG----LSIPKFL-TRNSRSMSQEFS 175

Query: 178 XKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVC 237
               S+IPWR  GIKYKKNEVFL VNE+I+ILVSKD +ILK+YVDG+++  +HLSG P+C
Sbjct: 176 NITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPIC 235

Query: 238 RFGLNDSLSVST------------PFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQL 285
           +FGLND LS++              F D+E  +T      ++++ SV +EDC FHQCV L
Sbjct: 236 QFGLNDYLSMTGNNISNRGDEFRHDFMDDEDLSTG-----RSSSSSVKIEDCTFHQCVSL 290

Query: 286 DKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKAN-SIDYRVTIKSLFPS 344
           DKF  ER INF+PPDGSFELM+YHVR++LN+PFK+TP V++  +  S+ Y++ +KSLFP+
Sbjct: 291 DKFNDERLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSSRCSMRYKIILKSLFPT 350

Query: 345 KLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPM 404
            L+A D  L+IP+PP TVDC I+ S+G+C F   ++  IWKF+KY+GLTEN L    VP 
Sbjct: 351 SLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILETVPS 410

Query: 405 KDS-ALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYE 463
             +  L++ QW++PPMS+ FEI+MFSNSGLVV++  V E  + Y+ VKWIKY+SKSG+YE
Sbjct: 411 SSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSGSYE 470

Query: 464 VRY 466
           +RY
Sbjct: 471 IRY 473

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  488 bits (1255), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 251/485 (51%), Positives = 333/485 (68%), Gaps = 30/485 (6%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M++A+ ++S RGEL++SK  + ++ +S+ +IFR+QVIN+LDVRSP+LTLGSTTFH+V++P
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRTP 60

Query: 61  G-NLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDG- 118
           G  LW+V+VSR+N +SAA WEFLYK + +L A+ L SE  LKE+FM  +ELLD ++E G 
Sbjct: 61  GEGLWVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLDTMVEGGG 120

Query: 119 VPVDTELSSVASKMSVKPSAS-----AERINTFIESGNGGTNRILPVAQFLRARXXXXXX 173
           +P +T+   + S MSVKP+ S     A+       +  G      P  Q L         
Sbjct: 121 IPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFP--QLLHRASNPGGI 178

Query: 174 XXXXXKVPSNIPWRM-NGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLS 232
                   S +P    +G + K+NE+ + V E ISILVSKDGSILK+YVDG ++ TT L 
Sbjct: 179 --------SILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLE 230

Query: 233 GMPVCRFGLNDSLSVST-------PFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQL 285
           G  VC+FGLNDSLS          P    E+  TN + +  A  G+V+L DCKFHQCV L
Sbjct: 231 GAAVCQFGLNDSLSTDNSSNSKWDPLRSKETQGTNLE-MKNAHVGTVLLRDCKFHQCVSL 289

Query: 286 DKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSK 345
           ++F  +R I F PP+G+ ELMKYHVR+NLNLPFK+T +V     N  DYRVTIKSLFP K
Sbjct: 290 ERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTIKSLFPGK 349

Query: 346 LTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMK 405
           L+AK+V +RIPVPP T+DC I+ SNG CKF+PEE+A++WKF KY GLTEN LSA  VP +
Sbjct: 350 LSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSAITVPTR 409

Query: 406 DSA-LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRN---YKMVKWIKYLSKSGA 461
           D+  L + QWS+PP+SL FEI+M+SN+GLVVR+F V +   N   +K VKWIKY+S SG+
Sbjct: 410 DTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHSGS 469

Query: 462 YEVRY 466
           YEVRY
Sbjct: 470 YEVRY 474

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  486 bits (1250), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 241/484 (49%), Positives = 346/484 (71%), Gaps = 27/484 (5%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHV--K 58
           MLSA+FI++ +G+LLISK ++  V +S++++FR QVIN+  VRSP+LTLGSTTF HV  +
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60

Query: 59  SPGNL--WIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLE 116
           S  NL  W+VAVSRSN DS+ IWE+L+KL  L+EAFG++ E+ LK++FM  YE+L++ LE
Sbjct: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120

Query: 117 DGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRA-RXXXXXXXX 175
           +G+P  T+L+ +  ++S KP  +    NT  +S +   +  L  +  L+A +        
Sbjct: 121 NGIPQTTDLAQIIPRVSRKPIEN----NTISKSPD--LDDFLSGSNILKAPKLSKRSSSS 174

Query: 176 XXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
                 S  PWR +G+KYKKNEV+L++NE+I+ILV KDGSI+KS+VDG+V+  +HLSGMP
Sbjct: 175 IALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMP 234

Query: 236 VCRFGLNDSLSVSTPFGDNESPTT-----------NKKAIPKAAAGSVMLEDCKFHQCVQ 284
           +C+ GLND+ S+    G+ +S  +           NKKAIP AAAGSV+LEDCKFHQCVQ
Sbjct: 235 LCQLGLNDTYSI---HGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQ 291

Query: 285 LDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPS 344
           L+K+++   I F+PPDG F+LM+Y V +N+N+PF + P V + K ++++Y+VT++SLFPS
Sbjct: 292 LNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPS 351

Query: 345 KLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSA-TAVP 403
            ++AKDV ++IPVPP T+ C  + S G+CK+   E  ++WK++KY+G TEN+LS   A+P
Sbjct: 352 NVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIP 411

Query: 404 MKDSAL-NIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAY 462
                L ++ +WS+PP+S+ FEIVMFSNSGLVVR     E   NY+ VKWIKY+S SGAY
Sbjct: 412 ATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGAY 471

Query: 463 EVRY 466
           E+RY
Sbjct: 472 EIRY 475

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  466 bits (1198), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 226/439 (51%), Positives = 304/439 (69%), Gaps = 23/439 (5%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M+ A F+F+ RG L++SK +     +S+SE+FR+QVIN L++RSPVLTLGSTTF H+++ 
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60

Query: 61  GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDGVP 120
           G LW+V V R NADSAAIWEFLY ++ LL+A+ +++E  L +DFM CYELLD+VL+ G+P
Sbjct: 61  GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLP 120

Query: 121 VDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXXXXXKV 180
            DTELS +   +S KP+          ES +G  +  L  A+  R               
Sbjct: 121 QDTELSHIVPLLSRKPATG--------ESASG--DDFLNSARLRRTGTKNVSVETLDHFS 170

Query: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240
               PWR  GIKYKKNEV+L+V E++S+LV++DG+ILK+YVDGTV+ T HLSGMP+C FG
Sbjct: 171 RDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFG 230

Query: 241 LNDSLSVSTPFGDNESPTTNKKAIPKAAAG----SVMLEDCKFHQCVQLDKFQSERTINF 296
            NDS S+        SP   ++  P+        SV+LEDCKFHQCVQL+KF  ER I F
Sbjct: 231 FNDSQSLR-----QRSP--RRQYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRF 283

Query: 297 IPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRIP 356
           +PPDG FELMKYH+R++L  PFK+TPVV+     SI+YR+T++SLFP+KL+AKDV+L IP
Sbjct: 284 VPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIP 343

Query: 357 VPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDS--ALNIDQW 414
            PP T+   ++ S G+CKFVPEE+AIIWK  K+ GLTEN+LSA  +  +    A  +DQW
Sbjct: 344 APPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQW 403

Query: 415 SKPPMSLKFEIVMFSNSGL 433
            +PP+S+K EI+MFS + L
Sbjct: 404 PRPPISMKLEIMMFSTAAL 422

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  403 bits (1036), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 213/476 (44%), Positives = 312/476 (65%), Gaps = 58/476 (12%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M+SA+ I++ RGEL++SK  R+++ +S+SEIFRIQVINN +VRSP+LTLGSTTFHH++S 
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 61  GN------LWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLD-I 113
            N      LW+V V+R+NA+SAAIWEFL KL+ +L+ +G+ SE++LK++FMT +E+LD +
Sbjct: 61  ANDPTDDELWLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILDNM 120

Query: 114 VLEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXX 173
           +L  G+  +T+L S+  KMSVKP +   R N    +  G          FL+ R      
Sbjct: 121 LLGTGIIQNTDLKSIVDKMSVKPIS---RTNETTSTQTG----------FLKRRNTILTT 167

Query: 174 XXXXXK-VPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLS 232
                  +P+N   R +   +KKNE+F  VNE +++LVSKDGSILK+YVDG +E  +HL+
Sbjct: 168 PGANFSLIPTN---RHDA--HKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLN 222

Query: 233 GMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSER 292
           G P C+F L D  +  T F                          KF QC++  K QS R
Sbjct: 223 GNPTCQFELVDDQTKITDF--------------------------KFDQCIE--KVQS-R 253

Query: 293 TINFIPPDGSFELMKYHVREN-LNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDV 351
           T+     DG  E++ YHVR++ +N+PFKITP+V+  K +++DYR+++KSLFP  L+A DV
Sbjct: 254 TVRVAATDGELEIVNYHVRDDKINIPFKITPIVSTVK-DTVDYRISLKSLFPKNLSATDV 312

Query: 352 QLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSALNI 411
            L IPVPP T+DC I+ SNG CKF  E++A+IW F+K+ G TEN+LSA  +      +N+
Sbjct: 313 VLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITIADGRQIMNL 372

Query: 412 DQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGD-RNYKMVKWIKYLSKSGAYEVRY 466
           + W++P + L FEI M+S SGL++R   +++ D R YK  +WIKY+S++G+YE+R+
Sbjct: 373 ESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAGSYEMRF 428

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  224 bits (570), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 146/474 (30%), Positives = 244/474 (51%), Gaps = 44/474 (9%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIF---RIQVINNLDVRSPVLTLGSTTFHHV 57
           M S ++     G++++S+  R  VP S  E F    ++      V  P LT     +  +
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKL-SALLEAFGLHSENELKEDFMTCYELLDIVL 115
           +   +++++ +SRS + + A ++ FLYKL   L E      E  ++++F+  YELLD +L
Sbjct: 61  QH-NDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML 119

Query: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXX 175
           + G+P  TE   +   ++       ++    I+S     N + P AQ  ++         
Sbjct: 120 DYGIPQITETKMLKQYIT-------QKSYKLIKSVKKSKNVVRPPAQLTKS--------- 163

Query: 176 XXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
                   + WR  GI YKKNE FL+V E I++L++  G +L+S + G V+  + LSGMP
Sbjct: 164 --------VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMP 215

Query: 236 VCRFGLND-SLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTI 294
             + GLND  +  S   G+N    + KK+       ++ LED +FHQCV+L KF++E+ I
Sbjct: 216 DLKLGLNDKGIFTSEEGGNNAEGGSGKKS-------NIELEDLQFHQCVRLSKFENEKII 268

Query: 295 NFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLR 354
           +FIPPDG F+LM Y +   +         + +   + I+     K+    K TA +V++ 
Sbjct: 269 SFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEIL 328

Query: 355 IPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-AVP-MKDSALNID 412
           IPVP +        S+G  K+VPE+SAI+W+   + G  E S +A   +P M D  +   
Sbjct: 329 IPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEV--- 385

Query: 413 QWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465
             +K P+ +KF+I  F+ SG+ VR+  V E    Y+   W++Y+++SG  Y +R
Sbjct: 386 PKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  223 bits (569), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 146/473 (30%), Positives = 243/473 (51%), Gaps = 42/473 (8%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIF---RIQVINNLDVRSPVLTLGSTTFHHV 57
           M S ++    +G++++S+  R  VP S  E F    ++      +  P LT     +  +
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIVL 115
           +   +++++ +SRS + + A ++ FLYKL  +L  +    E E ++++F+  YELLD +L
Sbjct: 61  QH-NDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEML 119

Query: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXX 175
           + G+P  TE   +   ++ K           I+S     N I P +Q  ++         
Sbjct: 120 DYGIPQITETKMLKQYITQKSYK-------LIKSAKKSKNVIRPPSQLTKS--------- 163

Query: 176 XXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
                   + WR  GI YKKNE FL+V E I++L++  G +L+S + G V   + LSGMP
Sbjct: 164 --------VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVNVRSRLSGMP 215

Query: 236 VCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTIN 295
             + GLND    ++    + S  T  K        ++ LED KFHQCV+L KF++E+ I 
Sbjct: 216 DLKLGLNDKGIFTSVESASSSEATEGK------KSNIELEDLKFHQCVRLSKFENEKIIT 269

Query: 296 FIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRI 355
           FIPPDG FELM Y +   +         + +   + I+     K+    K TA +V++ I
Sbjct: 270 FIPPDGDFELMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILI 329

Query: 356 PVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-AVP-MKDSALNIDQ 413
           PVP +        S+G  K+VPE+SAI+WK   + G  E S +A   +P M D+ +    
Sbjct: 330 PVPEDADSPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQLGLPSMTDAEV---P 386

Query: 414 WSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465
            +K P+ +KF+I  F+ SG+ VR+  ++E    Y+   W++Y+++SG  Y +R
Sbjct: 387 RAKRPIQVKFQIPYFTTSGIQVRYLKINEPKLQYQSYPWVRYITQSGDDYTIR 439

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  218 bits (554), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 144/474 (30%), Positives = 251/474 (52%), Gaps = 41/474 (8%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M SA++   ++G  L+S+  R  +P +  + F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59

Query: 57  VKSPGNLWIVAVS---RSNADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLD 112
           ++   ++++VA++   R+N   A ++ FLYK+  +L  +    E E ++++++  YELLD
Sbjct: 60  IQH-SDIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116

Query: 113 IVLEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXX 172
            +++ G+P  TE   +   ++ K         +F               + ++A      
Sbjct: 117 ELMDYGIPQITETKMLKQYITQK---------SF---------------KLVKAAKKKQN 152

Query: 173 XXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLS 232
                  +  ++ WR  GIKYKKNE FL++ E I++L+++ G IL+S + G V+  + LS
Sbjct: 153 AARPPSALTDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLS 212

Query: 233 GMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSER 292
           GMP  + G+ND    S    +++   TN  A  K     + LED KFHQCV+L KF++E+
Sbjct: 213 GMPDLKLGINDKGIFSKQLTEDD---TNNNATSKKQ-NKIELEDLKFHQCVRLSKFETEK 268

Query: 293 TINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQ 352
            I FIPPDG FELM Y +  ++         V +   + I+     K+    K TA +V+
Sbjct: 269 IITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVE 328

Query: 353 LRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSALNID 412
           + IPVP +    +   S+G  K+VPE+SAI+WK   + G  E S++A       S+ + +
Sbjct: 329 ILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEE 388

Query: 413 QWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465
             +K P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG  Y +R
Sbjct: 389 VQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 442

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  217 bits (552), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 138/467 (29%), Positives = 245/467 (52%), Gaps = 36/467 (7%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVI---NNLDVRSPVLTLGSTTFHHV 57
           M S ++    +G+LL+S+  +  +P S  E F   +I      +V  P  +     +  +
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAF-GLHSENELKEDFMTCYELLDIVL 115
           +   +L+I+ ++RS  A+ A ++ FL+ L  +L+ +  +  E  +K++F+  YELLD V+
Sbjct: 61  QH-NDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVM 119

Query: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXX 175
           + G+P  T+   +   ++ K           I S     N + P +    A         
Sbjct: 120 DSGIPQITDTKMLRQYITQKSFK-------LIRSAKKKKNVVRPPSSLTTA--------- 163

Query: 176 XXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
                   + WR  GIKYKKNE FL+V E I++++++ G +L+S + G V+  + LSGMP
Sbjct: 164 --------VSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMP 215

Query: 236 VCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTIN 295
             + GLND    +    + E   +++ +I +  + ++ LED KFHQCV+L KF++E+ I 
Sbjct: 216 DLKLGLNDKGIFTQSNEEEEDEPSSQPSITRKKS-NIELEDLKFHQCVRLSKFENEKIIT 274

Query: 296 FIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRI 355
           FIPPDG FELM Y +   +         + +   + ++     K+   +K TA +V++ I
Sbjct: 275 FIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILI 334

Query: 356 PVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSA-TAVPMKDSALNIDQW 414
           PVP +        S+G  K+VPE++AI+WK   + G  + S++A   +P   S  +I  +
Sbjct: 335 PVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLP---SVNDIADY 391

Query: 415 S-KPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG 460
           + K P+ +KF+I  F+ SG+ VR+  ++E    Y    W++Y+++SG
Sbjct: 392 NFKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSG 438

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  215 bits (547), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 158/504 (31%), Positives = 260/504 (51%), Gaps = 70/504 (13%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M SA++     G+ L+S+  R  +P S  + F I ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  VKSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIV 114
           ++   +L++VA+  S +A++AAI+ FL+KL  +L  +    E E ++++F+  YELLD V
Sbjct: 60  IQH-NDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 115 LEDGVPVDTE---LSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXX 171
           ++ G+P  TE   L    ++ S K   SA++                PVA          
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRP---------PVA---------- 159

Query: 172 XXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231
                   + +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + L
Sbjct: 160 --------LTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKL 211

Query: 232 SGMPVCRFGLNDS-------------LSVSTPFGDNESPTTNKKAIPKAAAG-----SVM 273
           SGMP  + G+ND               S S    DN + T  K +I  ++A      ++ 
Sbjct: 212 SGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIE 271

Query: 274 LEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANS-I 332
           LED KFHQCV+L KF++E+ I FIPPDG F+LM Y +   +  P     V     +NS I
Sbjct: 272 LEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRI 330

Query: 333 DYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGL 392
           +     K+    K TA +V++ IPVP +        S+G  K+VPE+SAI+WK   + G 
Sbjct: 331 EIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGG 390

Query: 393 TENSLSATAVPMKDSALNID----------QWSKPPMSLKFEIVMFSNSGLVVRFFDVSE 442
            E S+SA  + +   + N D          +  K P+ +KF+I  F+ SG+ VR+  ++E
Sbjct: 391 KEYSMSA-ELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINE 449

Query: 443 GDRNYKMVKWIKYLSKSG-AYEVR 465
               YK   W++Y+++SG  Y +R
Sbjct: 450 PKLQYKSYPWVRYITQSGDDYTIR 473

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  213 bits (541), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 144/475 (30%), Positives = 243/475 (51%), Gaps = 43/475 (9%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHV 57
           M S +     +G+ L+S+  +  V +S  E F+   ++      V  P        + +V
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIVL 115
           +   +++++A++RS + ++  ++ F+YKL  ++E +    E E ++++++  YELLD ++
Sbjct: 61  QY-NDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMM 119

Query: 116 EDGVPVDTE---LSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXX 172
           + GVP  TE   L    ++ S K + SA++           TN                 
Sbjct: 120 DKGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTN----------------- 162

Query: 173 XXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLS 232
                     ++ WR  GIKYKKNE FL+V E I++L+++ G +L+S + GTV+  + LS
Sbjct: 163 ----------SVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLS 212

Query: 233 GMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSER 292
           GMP  + GLND   + T     +SP     +  K    ++ LED KFHQCV+L KF++E+
Sbjct: 213 GMPDLKLGLNDK-GIFTTNDQEDSPEPVVSS--KKKNSNIELEDLKFHQCVRLSKFENEK 269

Query: 293 TINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQ 352
            I FIPPDG F+LM Y +   +         V +   + I+     K+    K  A +V+
Sbjct: 270 IITFIPPDGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVE 329

Query: 353 LRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-AVPMKDSALNI 411
           + IP+P +        S G  K+VPE++AI+WKFS +QG  E S++A   +P    A   
Sbjct: 330 ILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPP 389

Query: 412 DQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465
               K P+ +KF+I  F+ SG+ VR+  + E    Y    W++Y+++SG  Y +R
Sbjct: 390 K--LKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIR 442

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  214 bits (544), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 151/486 (31%), Positives = 252/486 (51%), Gaps = 59/486 (12%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M SA++    +G  L+++  R  +P S  E F   ++++L+  +    P L+     +  
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90

Query: 57  VKSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIV 114
           ++   ++++VA++ S +A++A I+ FLYKL  +L  +    E E ++++F+  YELLD  
Sbjct: 91  IQH-NDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDET 149

Query: 115 LEDGVPVDTE---LSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXX 171
           ++ G+P  TE   L    ++ S K   +A++           TN                
Sbjct: 150 MDYGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTN---------------- 193

Query: 172 XXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231
                      ++ WR   IKYKKNE FL++ E I++L+++ G IL+S + G V+  + L
Sbjct: 194 -----------SVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRL 242

Query: 232 SGMPVCRFGLNDSLSVSTPFGDNE---------SPTTNKKAIPKAAAGSVMLEDCKFHQC 282
           SGMP  + G+ND    S    D+          S TT+KK        ++ LED KFHQC
Sbjct: 243 SGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKK------KNNIELEDLKFHQC 296

Query: 283 VQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLF 342
           V+L KF++E+ I FIPPDG FELM Y +  ++         + +   + I+     K+  
Sbjct: 297 VRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQI 356

Query: 343 PSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-A 401
             K TA +VQ+ IPVP +        S+G  K+VPE++ IIWK   + G  E S+SA   
Sbjct: 357 KKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQ 416

Query: 402 VPMKDSALNIDQW-SKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG 460
           +P   S  NI++  +K P+ +KF+I  F+ SG+ V++  ++E    YK   W++Y+++SG
Sbjct: 417 LP---SIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSG 473

Query: 461 -AYEVR 465
             Y +R
Sbjct: 474 DDYTIR 479

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  212 bits (540), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 159/504 (31%), Positives = 260/504 (51%), Gaps = 69/504 (13%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M SA++     G+ L+S+  R  VP S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFST-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  VKSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIV 114
           ++   +L++VA+  S  A++AAI+ FL+KL  +L  +    E E ++++F+  YELLD V
Sbjct: 60  IQH-NDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 115 LEDGVPVDTE---LSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXX 171
           ++ G+P  TE   L    ++ S K   SA++                PVA          
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRP---------PVA---------- 159

Query: 172 XXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231
                   + +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + L
Sbjct: 160 --------LTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKL 211

Query: 232 SGMPVCRFGLNDS--------------LSVSTPFGDNESPTTNKKAIPKAAAG-----SV 272
           SGMP  + G+ND                +VS    DN + T  K +I  ++       ++
Sbjct: 212 SGMPDLKLGINDKGIFSKYLDNDSNIPSAVSAATSDNNTDTDKKPSITSSSTTSKRKVNI 271

Query: 273 MLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANS- 331
            LED KFHQCV+L KF++E+ I FIPPDG F+LM Y +   +  P     V     +NS 
Sbjct: 272 ELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSR 330

Query: 332 IDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQG 391
           I+     K+    K TA +V++ IPVP +        S+G  K+VPE+SAI+WK   + G
Sbjct: 331 IEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPG 390

Query: 392 LTENSLSAT-AVP----MKDSALNIDQWS----KPPMSLKFEIVMFSNSGLVVRFFDVSE 442
             E S+SA   +P     KD +  I + +    K P+ +KF+I  F+ SG+ VR+  ++E
Sbjct: 391 GKEYSMSAELGLPSISTSKDGSRTIPKSNAKLLKGPVQIKFQIPYFTTSGIQVRYLKINE 450

Query: 443 GDRNYKMVKWIKYLSKSG-AYEVR 465
               YK   W++Y+++SG  Y +R
Sbjct: 451 PKLQYKSYPWVRYITQSGDDYTIR 474

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  211 bits (538), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 143/486 (29%), Positives = 247/486 (50%), Gaps = 62/486 (12%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS---PVLTLGSTTFHHV 57
           M S ++    +G+ ++S+  +  +P +  + F + ++      S   P L      +  V
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKL-SALLEAFGLHSENELKEDFMTCYELLDIVL 115
           +   +L+++ ++RS + + A ++ FLYK+   L E   +  E  ++++F+  YELLD ++
Sbjct: 61  QH-NDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMM 119

Query: 116 EDGVPVDTE---LSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXX 172
           + G+P  TE   L    ++ S K   SA++    I           P+A           
Sbjct: 120 DYGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRP---------PIA----------- 159

Query: 173 XXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLS 232
                  + +++ WR  GI YKKNE FL+V E I++L+++ G +L+S + G V+  +HLS
Sbjct: 160 -------LTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLS 212

Query: 233 GMPVCRFGLNDSLSVSTPF-------GDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQL 285
           GMP  + GLND    S           D+ S T  KKA       ++ LED KFHQCV+L
Sbjct: 213 GMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKA-------NIELEDLKFHQCVRL 265

Query: 286 DKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSK 345
            KF++E+ I FIPPDG FELM Y +   +         + +   + I+     K+    K
Sbjct: 266 SKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKK 325

Query: 346 LTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-AVPM 404
            TA +V++ IPVP +        S+G  K+ PE++AI+WK   + G  E S++A   +P 
Sbjct: 326 STANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLP- 384

Query: 405 KDSALNIDQWSKP----PMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG 460
                ++  + +P    P+ +KF+I  F+ SG+ VR+  ++E    Y+   W++Y+++SG
Sbjct: 385 -----SVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSG 439

Query: 461 -AYEVR 465
             Y +R
Sbjct: 440 DDYTIR 445

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  212 bits (539), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 158/506 (31%), Positives = 260/506 (51%), Gaps = 71/506 (14%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M SA++     G+ L+S+  R  +P S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  VKSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIV 114
           ++   +L++VA++ S +A++AAI+ FL+KL  +L  +    E E ++++F+  YELLD V
Sbjct: 60  IQH-NDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 115 LEDGVPVDTE---LSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXX 171
           ++ G+P  TE   L    ++ S K   SA++                PVA          
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRP---------PVA---------- 159

Query: 172 XXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231
                   + +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + L
Sbjct: 160 --------LTNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKL 211

Query: 232 SGMPVCRFGLNDS--------------LSVSTPFGDNES--PTTNKKAIPKAAAGS---- 271
           SGMP  + G+ND                + ST   DN++   T  K +I  ++  S    
Sbjct: 212 SGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKV 271

Query: 272 -VMLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKAN 330
            + LED KFHQCV+L KF++E+ I FIPPDG F+LM Y +   +  P     V     +N
Sbjct: 272 NIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSN 330

Query: 331 S-IDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKY 389
           S I+     K+    K TA +V++ IPVP +        S+G  K+VPE+SAI+WK   +
Sbjct: 331 SRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSF 390

Query: 390 QGLTENSLSAT-AVP--------MKDSALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDV 440
            G  E S+SA   +P         K    N  +  K P+ +KF+I  F+ SG+ VR+  +
Sbjct: 391 PGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKI 450

Query: 441 SEGDRNYKMVKWIKYLSKSG-AYEVR 465
           +E    YK   W++Y+++SG  Y +R
Sbjct: 451 NEPKLQYKSYPWVRYITQSGDDYTIR 476

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  210 bits (534), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 145/489 (29%), Positives = 247/489 (50%), Gaps = 54/489 (11%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLD---VRSPVLTLGSTTFHHV 57
           M SA++    +G+ L+S+  +  VP S  + F   + +  D   V  P +      +  +
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALL-EAFGLHSENELKEDFMTCYELLDIVL 115
           +   +L++VA++ S   + A ++ FL+KL  +L E      E  ++++F+  YEL+D ++
Sbjct: 61  QH-NDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMM 119

Query: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXX 175
           + G+P  TE   +   ++ K         +F               +  +A         
Sbjct: 120 DYGIPQITEPRMLKKYITQK---------SF---------------KLEKAHKKKRNAAR 155

Query: 176 XXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
              ++ +++ WR  GIKYKKNE FL++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 156 PPSELNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMP 215

Query: 236 VCRFGLND-----------SLSVSTP------FGDNESPTTNKKAIPKAAAGSVMLEDCK 278
             + G+ND           ++ V+ P       G  ES  TN     K    ++ LED K
Sbjct: 216 DLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDG---KKRKTNIELEDLK 272

Query: 279 FHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTI 338
           FHQCV+L KF++E+ I FIPPDG F+LM Y +  ++         + +   + I+ R   
Sbjct: 273 FHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRA 332

Query: 339 KSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLS 398
           K+    K  A +VQ+ IPVP +        S+G  K+VPE+SAI+WK   + G  E ++ 
Sbjct: 333 KAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMF 392

Query: 399 A-TAVPMKDSALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLS 457
           A   +P  DS    +   K P+ +KFEI  F+ SG+ VR+  ++E    YK   W++Y++
Sbjct: 393 AEMGLPSMDSYE--EPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYIT 450

Query: 458 KSG-AYEVR 465
           +SG  Y +R
Sbjct: 451 QSGDDYTIR 459

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  208 bits (529), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/475 (28%), Positives = 242/475 (50%), Gaps = 43/475 (9%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIF---RIQVINNLDVRSPVLTLGSTTFHHV 57
           M S ++    +G+LL+S+  +  +P +  E F    I+      V  P  +     +  +
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAF-GLHSENELKEDFMTCYELLDIVL 115
           +   +L+++ +++S + + A ++ +L+KL  +LE +  +  E  +K++F+  YELLD ++
Sbjct: 61  QH-NDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMM 119

Query: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXX 175
           + G+P  T+   +   ++ K           I S     N + P A              
Sbjct: 120 DHGIPQITDTKMLRQYITQKSFK-------LIRSAKKKKNVVRPPAT------------- 159

Query: 176 XXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
               + +++ WR  GI YKKNE FL+V E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 160 ----LTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMP 215

Query: 236 VCRFGLND----SLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE 291
             + GLND    +        +  S  T KK+       ++ LED KFHQCV+L KF++E
Sbjct: 216 DLKLGLNDKGIFAQGDDDDDEEGASGGTKKKS-------NIELEDLKFHQCVRLTKFENE 268

Query: 292 RTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDV 351
           + I FIPPDG FELM Y +   +         + +   + I+     K+    K TA +V
Sbjct: 269 KIITFIPPDGDFELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNV 328

Query: 352 QLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSALNI 411
           ++ IPVP +        S+G  K+VP ++AI+WK   + G  + S++A  + +   + N 
Sbjct: 329 EILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAA-EMGLPSVSDNS 387

Query: 412 DQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465
           D   K P+ +KF+I  F+ SG+ VR+  ++E    Y    W++Y+++SG  Y +R
Sbjct: 388 DHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIR 442

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  207 bits (526), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 144/480 (30%), Positives = 243/480 (50%), Gaps = 55/480 (11%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M+S ++   ++G  ++S+  R  +P S  + F   ++ +L+  S    P L      +  
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRF-APLLADLEEESSVIPPCLNHRGIQYLF 59

Query: 57  VKSPGNLWIVAVSRSNADSAA-IWEFLYKL-SALLEAFGLHSENELKEDFMTCYELLDIV 114
           ++   +L++VA+S S A +AA ++ FL+KL  AL +      E  ++++F+  YELLD +
Sbjct: 60  IEHE-DLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEM 118

Query: 115 LEDGVPVDTE---LSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXX 171
           ++ G+P  TE   L    ++ S K   + +++        G TN                
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTN---------------- 162

Query: 172 XXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231
                      ++ WR +GI YKKNE FL++ E I++++++ G +L+S + G V   + L
Sbjct: 163 -----------SVSWRADGITYKKNEAFLDIVESINMVMNQQGQVLRSEIIGQVIVRSRL 211

Query: 232 SGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE 291
           SGMP  + G+ND    +      ES  T  K        S  LED KFHQCV+L KF++E
Sbjct: 212 SGMPDLKLGINDKGIFTRDPETGESQVTAGK-----KKSSAELEDLKFHQCVRLSKFENE 266

Query: 292 RTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDV 351
           + I FIPPDG FELM Y +   +         V +   + I+     K+    K  A +V
Sbjct: 267 KIITFIPPDGEFELMSYRLTTPVKPLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNV 326

Query: 352 QLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-AVPMKDSALN 410
           ++ IPVP +        S+G  K+VPE++AI+WK   + G  E S++A   +P      +
Sbjct: 327 EILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQMGLP------S 380

Query: 411 IDQWSKP----PMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465
           I+   KP    P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y++++G  Y +R
Sbjct: 381 INGVEKPKFKRPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQNGDDYTIR 440

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  204 bits (520), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 138/471 (29%), Positives = 245/471 (52%), Gaps = 44/471 (9%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHV 57
           M+SA++    +G  ++S+  R  +P S  + F    +Q+     V  P L+     +  +
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 58  KSPGNLWIVAVSRSNADSAA-IWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIVL 115
           +   +L++VA++ S A + A ++ FL+KL  +LE +    E E ++++F+  YELLD ++
Sbjct: 61  QH-NDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMM 119

Query: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXX 175
           + G+P  TE   +   ++ K         +F               + ++A         
Sbjct: 120 DYGIPQITETKMLKQYITQK---------SF---------------KLMKAVKKSKAAPR 155

Query: 176 XXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
              +V +++ WR   I +KKNE FL++ E I++L+++ G +L+S + G ++  + LSGMP
Sbjct: 156 PPTEVTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMP 215

Query: 236 VCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTIN 295
             + G+ND    S     +  P T      K    ++ LED KFHQCV+L KF++E+ I 
Sbjct: 216 DLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKT-NIELEDLKFHQCVRLSKFENEKIIT 274

Query: 296 FIPPDGSFELMKYHVRENLNLPFKITPV------VTLFKANSIDYRVTIKSLFPSKLTAK 349
           FIPPDG+FELM Y     L++P K  P+      V +   + I+     ++    +  A 
Sbjct: 275 FIPPDGAFELMNYR----LSMPVK--PLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIAN 328

Query: 350 DVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSAL 409
            V++ IPVP +        ++G  K+VP+++AI+WK   + G  E S+SA       +AL
Sbjct: 329 SVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINAL 388

Query: 410 NIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG 460
           +  +  K P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG
Sbjct: 389 DKPK-VKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSG 438

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  205 bits (521), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 154/510 (30%), Positives = 260/510 (50%), Gaps = 81/510 (15%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M SA++     G+ L+S+  R  +P S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  VKSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIV 114
           ++   +L++VA+  S  A++AAI+ FL+KL  +L  +    E E ++++F+  YELLD V
Sbjct: 60  IQH-NDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 115 LEDGVPVDTE---LSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXX 171
           ++ G+P   E   L    ++ S K   SA++                PVA          
Sbjct: 119 MDYGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRP---------PVA---------- 159

Query: 172 XXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231
                   + +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + L
Sbjct: 160 --------LTNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKL 211

Query: 232 SGMPVCRFGLNDSLSVSTPFGDNESPT--------------TNKKAIPKAAAG------S 271
           SGMP  + G+ND   + + + D++S T              T+KK    +++       +
Sbjct: 212 SGMPDLKLGINDK-GIFSKYLDDDSNTPPPTSAATSDNITDTDKKPSITSSSTTSKRKVN 270

Query: 272 VMLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANS 331
           + LED KFHQCV+L KF++E+ I FIPPDG F+LM Y +   +  P     V     +NS
Sbjct: 271 IELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNS 329

Query: 332 -IDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQ 390
            I+     K+    K TA +V++ IPVP +        S+G  K+VPE+SAI+WK   + 
Sbjct: 330 RIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFP 389

Query: 391 GLTENSLSAT--------------AVPMKDSALNIDQWSKPPMSLKFEIVMFSNSGLVVR 436
           G  E S+SA               A+P  ++ +      K P+ +KF+I  F+ SG+ VR
Sbjct: 390 GGKEYSMSAELGLPSISNDIEGHRAIPKSNAEI-----LKGPVQIKFQIPYFTTSGIQVR 444

Query: 437 FFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465
           +  ++E    YK   W++Y+++SG  Y +R
Sbjct: 445 YLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  204 bits (519), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 140/480 (29%), Positives = 242/480 (50%), Gaps = 41/480 (8%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVIN---NLDVRSPVLTLGSTTFHHV 57
           M SA++    +G  L+S+  R  +P S  + F I + N     ++  P +      F  +
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIVL 115
           +   +L++VA++ S + ++A I+ FL+K+  +L  +    E E ++++F+  YELLD ++
Sbjct: 61  QH-NDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMM 119

Query: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXX 175
           + G+P  TE   +   ++ K     +       +    T+                    
Sbjct: 120 DYGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTS-------------------- 159

Query: 176 XXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
               + +++ WR  GIK+KKNE FL++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 160 ----LTNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMP 215

Query: 236 VCRFGLNDSLSVS---------TPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLD 286
             + G+ND    S          P   ++S     K   K  + ++ LED KFHQCV+L 
Sbjct: 216 DLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKP-KKKRSNNMELEDLKFHQCVRLS 274

Query: 287 KFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKL 346
           KF++E+ I FIPPDG FELM Y +   +         +     + I+     K+    K 
Sbjct: 275 KFENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKS 334

Query: 347 TAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKD 406
           TA +V++ IPVP +        S+G  K+VPE++AI+WK   + G  E S++A       
Sbjct: 335 TATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPST 394

Query: 407 SALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465
           +A    +  K P+ +KF+I  F+ SG+ VR+  + E +  YK   W++Y++KSG  Y +R
Sbjct: 395 NAGEESEKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIR 454

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  204 bits (518), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 142/497 (28%), Positives = 255/497 (51%), Gaps = 65/497 (13%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M SA++    +G+ L+S+  R  +P S  + F   ++++ +  S    P ++     +  
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFS-SLLSDKEEESNLLPPCISHNGIQYMF 59

Query: 57  VKSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIV 114
           ++   +L++ A++ S  A+ + I+ FL+K+  +L+ +    E E ++++F+  YELLD +
Sbjct: 60  IQH-NDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEM 118

Query: 115 LEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXX 174
           ++ G+P  TE   +   ++ K         +F               +  +A        
Sbjct: 119 MDYGLPQITETKMLKKYITTK---------SF---------------KLEKAHKKKRNAA 154

Query: 175 XXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234
               ++ +++ WR  GIKYKKNE FL++ E I++L+++ G +L+S + G V   + LSGM
Sbjct: 155 RPPTELTNSVSWRPEGIKYKKNEAFLDIIESINMLITQKGQVLRSEIVGNVRVKSRLSGM 214

Query: 235 PVCRFGLNDSLSVSTPF-----------GDNESP--TTNKKAIPKAAAG----SVMLEDC 277
           P  + G+ND   + T +           GD+E    T N+ +I    +     ++ LED 
Sbjct: 215 PDLKLGINDR-GIFTKYLEGNNIGIAKNGDDEDADDTNNESSIVSEGSNKRKTNIELEDL 273

Query: 278 KFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVV---TLFKANSIDY 334
           KFHQCV+L KF++E+ I+FIPPDG F+LM Y       L   I P++      +   I+ 
Sbjct: 274 KFHQCVRLSKFENEKIISFIPPDGEFDLMNYR------LSTSIKPLIWCDVSIQTYRIEI 327

Query: 335 RVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTE 394
               K+    K  A +V++ IPVP +        S+G+ K++PE++ ++WK S + G  E
Sbjct: 328 HCKAKAQIKKKSIATNVEILIPVPEDADSPIFKYSHGKIKYLPEKNLLLWKISSFPGGKE 387

Query: 395 NSLSAT-AVPM----KDSALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKM 449
            S++A   +P      D    +   SK P+ +KF+I  F+ SG+ VR+  V+E    YK 
Sbjct: 388 YSMAAQMGLPSISGEDDLNTRVSNQSKKPVQVKFKIPYFTTSGIQVRYLKVNEPKLQYKT 447

Query: 450 VKWIKYLSKSG-AYEVR 465
             W++Y+++SG  Y +R
Sbjct: 448 YPWVRYITQSGDDYTIR 464

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  200 bits (508), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 136/478 (28%), Positives = 244/478 (51%), Gaps = 41/478 (8%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLD---VRSPVLTLGSTTFHHV 57
           M+S ++     G+ ++S+  R  +P S  + F   ++ + +   V  P L      +  +
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIVL 115
           +   ++++VA++ S   + A I+ FL++L ++L  +    E E ++++F+  YELLD ++
Sbjct: 61  QH-SDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMM 119

Query: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXX 175
           + G+P  TE     +KM +K   + +       +         PVA              
Sbjct: 120 DYGIPQITE-----TKM-LKQYITQKSFKLIKAAKKKRNAARPPVA-------------- 159

Query: 176 XXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
               + +++ WR  GIKYKKNE +L++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 160 ----LTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMP 215

Query: 236 VCRFGLNDSLSVSTPFGDNES------PTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ 289
             + G+ND   + + + +NE          N  +       ++ LED KFHQCV+L KF+
Sbjct: 216 DLKLGINDK-GIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFE 274

Query: 290 SERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAK 349
           +E+ I FIPPDG FELM Y +   +         + +   + I+     K+    K  A 
Sbjct: 275 NEKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIAN 334

Query: 350 DVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-AVPMKDSA 408
           +V++ IPVP +        S+G  K++PE++AI+WK   + G  E S++A   +P  D  
Sbjct: 335 NVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGI 394

Query: 409 LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465
                  K P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG  Y +R
Sbjct: 395 EPPK--VKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  201 bits (510), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 141/497 (28%), Positives = 248/497 (49%), Gaps = 63/497 (12%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHV 57
           M+S++     +G+ L+S+  R  +P +  + F    +++     V  P LT     +  +
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIVL 115
           +   +L+IVA++ S + +++ ++ FL+KL  ++  +    E E ++++F+  YELLD ++
Sbjct: 61  QH-NDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119

Query: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXX 175
           + G+P  TE     +KM +K   + +       +         P A              
Sbjct: 120 DYGIPQITE-----TKM-LKQYITQKSFKLVKAAKKKRNAARPPQA-------------- 159

Query: 176 XXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
               + +++ WR  GIKYKKNE FL++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 160 ----LTNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMP 215

Query: 236 VCRFGLNDS---------------------LSVSTPFGDNESPTTNKKAIPKAAAGSVML 274
             + G+ND                        V++       P+T +         +V L
Sbjct: 216 DLKLGINDKGIFSKYLESTSSNSNSNDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVEL 275

Query: 275 EDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDY 334
           ED KFHQCV+L KF++E+ I FIPPDG+FELM Y +   +         + +   + ++ 
Sbjct: 276 EDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEI 335

Query: 335 RVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTE 394
               K+    K  A +V++ IPVP +        S+G  K+VPE++AI+WK   + G  E
Sbjct: 336 HCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKE 395

Query: 395 NSLSAT-AVPMKDSALNIDQWSKP----PMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKM 449
            S++A   +P      +ID   KP    P+ +KF+I  F+ SG+ VR+  V+E    YK 
Sbjct: 396 YSMAAQLGLP------SIDDNEKPKLKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKS 449

Query: 450 VKWIKYLSKSG-AYEVR 465
             W++Y+++SG  Y +R
Sbjct: 450 YPWVRYITQSGDDYTIR 466

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  196 bits (497), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 137/479 (28%), Positives = 240/479 (50%), Gaps = 42/479 (8%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHV 57
           M+S ++     G+ ++++  R  +  +  + F    +Q+     V  P +      +  +
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAF-GLHSENELKEDFMTCYELLDIVL 115
           K   ++++VA++ S   + A I+ FL++L  +LE +  +  E  ++++F+  YELLD ++
Sbjct: 61  KH-SDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMM 119

Query: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXXX 175
           + G+P  TE   +   ++ K   S + I T          R  P A+             
Sbjct: 120 DFGIPQITETKMLKKYITQK---SFKLIKTSTSKKKKNAAR--PPAELT----------- 163

Query: 176 XXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
                 +++ WR  GI YKKNE FL++ E I++LV++ G +L+S + G V   + LSGMP
Sbjct: 164 ------NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMP 217

Query: 236 VCRFGLNDSLSVSTPFGDNE-SPTTNKKAIPKAAAG---SVMLEDCKFHQCVQLDKFQSE 291
             + G+ND    S    +N    +++   IP+        + LED KFHQCV+L KF++E
Sbjct: 218 DLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENE 277

Query: 292 RTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDV 351
           + I FIPPDG F+LM Y +   +         + +   + I+     K+    K  A +V
Sbjct: 278 KIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNV 337

Query: 352 QLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSALNI 411
           ++ IPVP +        S+G  K++PE++AI+WK   + G  E S+SA          ++
Sbjct: 338 EILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQL-----HLPSV 392

Query: 412 DQWSKP----PMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGA-YEVR 465
           D    P    P+ +KF+I  F+ SG+ VR+  V+E    YK   W++Y+++SG  Y +R
Sbjct: 393 DGVEPPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  101 bits (251), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 106/479 (22%), Positives = 192/479 (40%), Gaps = 93/479 (19%)

Query: 43  RSPVLTLGSTTFHHVKSPGNLWIVAVSRSNA--DSAAIWEFLYKLSALLEAF---GLHSE 97
           R PV+      + ++   G L+ V+VS      +   I  +L    ALL  +        
Sbjct: 41  RGPVIYSKGIIYIYILRDG-LYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDR 99

Query: 98  NELKEDFMTCYELLDIVLEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRI 157
             + ++F   YEL D  L+ G+P  T+ + +   + ++ +      N+  +S       I
Sbjct: 100 TGIIDNFNLIYELFDESLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEI 159

Query: 158 LPV------AQFLRARXXXXXXXXXXXKVPSN-IPWRMNGIKYKKNEVFLNVNERISILV 210
           L        A     R           +  +  I WR  GI Y KNE+F+++ ER S L+
Sbjct: 160 LQSKENKDKADIHGFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLM 219

Query: 211 S-KDGSILKSYVDGTVEATTHLSGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAA 269
             K+  + +++V G +   ++LSGMP+ R  +N  L     F                  
Sbjct: 220 DFKNSQVRQTFVYGKINCRSYLSGMPIVRVCINKMLKDKDLF------------------ 261

Query: 270 GSVMLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLF-- 327
               L   KFHQCV L+   S+  I FIPPDG F+L +Y ++ ++N     +P++ L   
Sbjct: 262 ----LGSSKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHIN----DSPIIKLIDY 313

Query: 328 ------KANSIDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTS--------NGRC 373
                 K + +   VTI+  F ++ +A  +++ IP      +  I  +        +G  
Sbjct: 314 KINERQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSV 373

Query: 374 KFVPEESAIIWKFSKYQGLTENSLSATAVPM-----KDSALNIDQWSK----PPM----- 419
            F   +  ++W     +G    +  +  V       ++ A  ++Q  K    PP+     
Sbjct: 374 FFNLSDELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAH 433

Query: 420 -----------------------SLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKY 455
                                  + +FE+  +++SGL V +  +SE +  Y+   W++Y
Sbjct: 434 LEELYAQVKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRY 492

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  100 bits (249), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 116/479 (24%), Positives = 195/479 (40%), Gaps = 103/479 (21%)

Query: 45  PVLTLGSTTFHHVKSPGNLWIVAVS--------RSNADSAAIWEFLYKLSALLEA-FGLH 95
           PV       F +++  G  +I AV         +S+ +  AI  +L     LL+  F   
Sbjct: 44  PVFHYKGIHFVYIRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQ 103

Query: 96  SENE--LKEDFMTCYELLDIVLEDGVPVDTELSSVASKMSVKPS-----ASAERINTFIE 148
             N   + ++F   YELLD  L+ GVP  T+ + +   + V+ +     A + +  +  E
Sbjct: 104 KLNRWLIVDNFHLIYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKE 163

Query: 149 SGNGGTNRILPVAQFLRARXXXXXXXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISI 208
             +G  +    +  F+ AR              S I WR  GI Y KNE FL+V E I  
Sbjct: 164 DLHGFEDDESYMNSFI-ART-----------TTSAISWRPKGIHYTKNEFFLDVIEEIEY 211

Query: 209 LVSKDGS-ILKSYVDGTVEATTHLSGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKA 267
            +  + S I K++V G +   ++LSGMP  + GL+   S                ++PK 
Sbjct: 212 CMDFNKSKIRKNFVHGRIRCRSYLSGMPKLKIGLSKITS----------------SLPKE 255

Query: 268 AAGSVMLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLF 327
                 + + KFHQCV L+  Q +  ++FIPPDG F+L +Y ++ ++  P    PV+ L 
Sbjct: 256 REQ--FMNNAKFHQCVSLEDLQ-KNIVSFIPPDGEFQLCEYKLKRHVRDP----PVIKLV 308

Query: 328 KAN---------SIDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTS--------N 370
           K +          I   +TI + F S+ +   + +RIP+     +  I  +         
Sbjct: 309 KFDVKKEEKKRPKILISLTITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKCDQ 368

Query: 371 GRCKFVPEESAIIWKFSKYQG---LTENSLSAT-----AVPMKDSALNIDQWSKPP---- 418
           G   F   +  ++W+    +G    TE+S+            K     +     PP    
Sbjct: 369 GNVLFNLTDDLLLWEVGSIKGGHAQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPLRQ 428

Query: 419 ----------------------MSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKY 455
                                 +S++FEI  ++ SGL V++  + E    Y    W++Y
Sbjct: 429 GPKLEELYKQVHENENTNRSRLVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVRY 487

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 112/525 (21%), Positives = 212/525 (40%), Gaps = 102/525 (19%)

Query: 1   MLSALFIFSLRGELLISKHVRS-SVPKSMSEIFR-IQVINNLDVRSPVLTLGSTTFHHVK 58
           M S++F+   +   LI K  +S   P++ +  F+ +  ++N+    PV+      F  + 
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKSVQHPEAFAYRFKEVYKVSNV----PVIYHKGIVFISIC 56

Query: 59  SPGNLWIVAVS----RSNADSAAIW--EFLYKLSALLEAFGLHSENELKEDFMTCYELLD 112
             G L+ V++S    RS+  S  ++  +F   L   L    L     + ++F   YELLD
Sbjct: 57  RDG-LYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNAL-DRTRIVDNFNLIYELLD 114

Query: 113 IVLEDGVPVDTELSSVASKMSVKPSASAE----RINTFIESGNGGTNRILPVAQFLRARX 168
             L+ G+P  T+ + +   + ++P+   +    R N+  +      + +    +      
Sbjct: 115 ESLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHG 174

Query: 169 XXXXXXXXXXKV----PSNIPWRMNGIKYKKNEVFLNVNE-RISILVSKDGSILKSYVDG 223
                      V       I WR  GI Y KNE+F++V E +  ++  K   + K+++ G
Sbjct: 175 FQDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFG 234

Query: 224 TVEATTHLSGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCV 283
            +   ++LSGMPV +  +N  L     F                      L   KFHQCV
Sbjct: 235 RIICRSYLSGMPVVKICINKMLKDRDQF----------------------LSSAKFHQCV 272

Query: 284 QLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLF--------KANSIDYR 335
            L+   S+  I FIPPDG F+L +Y ++ +++     +PV+ L         K + +   
Sbjct: 273 SLESLSSQDFIEFIPPDGDFQLCEYKIKRHIS----DSPVIKLIEYKVVEKPKKHKLQIS 328

Query: 336 VTIKSLFPSKLTAKDVQLRIPVPP--ETVDCHISTS-NGRCKFVP-----EESAIIWKFS 387
           + I+  F ++ +A  + +R+P+    ET    ++     +C F        +  ++WK +
Sbjct: 329 MKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKAN 388

Query: 388 KYQGLTENSLSATAVPM--------KDSALNIDQWSKPP--------------------- 418
             +G    +  +  V          +  A  +     PP                     
Sbjct: 389 GMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQ 448

Query: 419 --------MSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKY 455
                   ++ +FE+  F++SGL V +  + E    Y+   W++Y
Sbjct: 449 INNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRY 493

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score = 91.3 bits (225), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 130/328 (39%), Gaps = 82/328 (25%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           + WR  GI Y KNE FL+V E++  L   K+  + K+ + G +   ++LSGMP  +  LN
Sbjct: 236 VSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALN 295

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPPDGS 302
             L     F                      +   KFHQCV L+   +E+ + FIPPDG 
Sbjct: 296 KLLQRDAQF----------------------MSHSKFHQCVALETL-NEKELEFIPPDGE 332

Query: 303 FELMKYHVRENLN-------LPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRI 355
           F L +Y ++ ++N         F+I P +  FK   +   +TI++ F ++ +   + ++I
Sbjct: 333 FILCEYELKRHVNDTPILKITSFEIKPQLKKFKLRIL---LTIETHFKTRNSTSILNVKI 389

Query: 356 PVPPETVDCHISTSN--------GRCKFVPEESAIIWKFSKYQG---------------- 391
           P+     D +I  S         G+  F   +  ++W+  + +G                
Sbjct: 390 PLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSLF 449

Query: 392 --------------------LTE----NSLSATAVPMKDSALNIDQWSKPPMSLKFEIVM 427
                               L E      L A     KD  + +       + + FEI  
Sbjct: 450 NKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEIPY 509

Query: 428 FSNSGLVVRFFDVSEGDRNYKMVKWIKY 455
            + SGL V +  + E    Y+   W++Y
Sbjct: 510 TTCSGLKVEYLKIEEEQLQYQSFPWVRY 537

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 110/516 (21%), Positives = 199/516 (38%), Gaps = 88/516 (17%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M+S LFI     +LL  + ++  VP  +  +   +       +SP+L      +  ++  
Sbjct: 1   MISCLFILDEELQLLTVRLLKP-VPSLLEPL---EWFIRHPKKSPILQNMDYDYIFIQRD 56

Query: 61  GNLWIVAVSR--SNADSAAIWEFLYKLSALLEAFGLHSENE--LKEDFMTCYELLDIVLE 116
           G L+ +++S   +N     ++ +L +L  L + +   + N+  +  +F   +EL+D  + 
Sbjct: 57  G-LYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLITGNFHLIHELIDESIF 115

Query: 117 DGVPVDTELSSVASKMSVK----PSASAERINTFIESGNGGTNRILPVAQFLRARXXXXX 172
            G P  T+ + +   + V+        A R  T   +            +   A      
Sbjct: 116 MGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDSKKKEEDTEATDENYM 175

Query: 173 XXXXXXKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKS-YVDGTVEATTHL 231
                    S I WR  GI Y KNE +L+V E +  LV      +KS  V G ++  ++L
Sbjct: 176 NSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYIQCRSYL 235

Query: 232 SGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE 291
           SGMP+   GLN   S +  F                      +    FHQCV LD+  ++
Sbjct: 236 SGMPMLTIGLNKLNSENEYF----------------------MRRANFHQCVNLDQLTTD 273

Query: 292 RTINFIPPDGSFELMKYHVRENLNLP---------FKITPVVTLFKANSIDYRVTIKSLF 342
           + I+F PPDG F+L  Y +  N++ P          K+ P  T    + +   VTI + F
Sbjct: 274 KLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKDGLDRLILAVTISTYF 333

Query: 343 PSKLTAKDVQLRIPVPPETVDCHISTS--------NGRCKFVPEESAIIWKFSKYQG--- 391
             + +   + +++P+     D  +  S         G+  F   +  ++W+  K +G   
Sbjct: 334 KLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLWEVGKVKGGHG 393

Query: 392 -------------------LTENSLSATAVP-------------MKDSALNIDQWSKPPM 419
                                +  LS +  P              +   LN        +
Sbjct: 394 DKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHELNSPTSEAALL 453

Query: 420 SLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKY 455
            ++FEI  ++ SGL V F  + E    ++   W++Y
Sbjct: 454 KVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRY 489

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 83/345 (24%), Positives = 136/345 (39%), Gaps = 99/345 (28%)

Query: 182 SNIPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFG 240
           S + WR  GI Y KNE FL+V E++  ++  ++G +  + ++GT+   ++LSGMP    G
Sbjct: 177 SAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIG 236

Query: 241 LNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERT--INFIP 298
           LN  +  +  F                      ++  KFH+CV L     E +  I FIP
Sbjct: 237 LNKLMQKNVHF----------------------MKRLKFHECVDLHTLIKEESPVIKFIP 274

Query: 299 PDGSFELMKYHVRENLNLPFKITPVVTLFK-------------ANSIDYRVTIKSLFPSK 345
           PDG FEL  Y     LN P    PV+ L                + +  +  I + F ++
Sbjct: 275 PDGEFELCNY----KLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHFKAQ 330

Query: 346 LTAKDVQLRIPVPPETVDCHISTSN--------GRCKFVPEESAIIWKFSKYQGLTENS- 396
            +AK++ ++IP+       +I            G   F     +IIWK +  +G   N  
Sbjct: 331 DSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLKGGHGNKN 390

Query: 397 --------------LSATAVPMKDS--------------------------------ALN 410
                           A  V +++S                                  +
Sbjct: 391 YGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYDGNENQKED 450

Query: 411 IDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKY 455
           +D+++   MS  FEI  ++ SGL V +F + E   NY+   W++Y
Sbjct: 451 VDKFALIAMS--FEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRY 493

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 100/224 (44%), Gaps = 41/224 (18%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILK-SYVDGTVEATTHLSGMPVCRFGLN 242
           + WR  GI+Y KNE FL+V E++   +    +I+K + + G +   + LSGMP  +  LN
Sbjct: 223 VSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSLN 282

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPPDGS 302
             +     F                      L  CKFHQCV  D     + + F+PPDG 
Sbjct: 283 KIIYQDKQF----------------------LSSCKFHQCVMPDSVDEGKVLEFVPPDGD 320

Query: 303 FELMKYHVRENLN-LP------FKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRI 355
           F L KY ++ ++N LP      +++ P +  +K       VTI+S F    +   + ++I
Sbjct: 321 FVLCKYELKRHVNDLPLLKLISYEVKPKLDKYKLKLF---VTIESTFKKTNSTTKLNIKI 377

Query: 356 P--VPPETVDCHISTS------NGRCKFVPEESAIIWKFSKYQG 391
           P  V  E  D  +S +       G+  F   +  ++W+    +G
Sbjct: 378 PLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKG 421

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 119/545 (21%), Positives = 208/545 (38%), Gaps = 122/545 (22%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M S +FI     E LISK++++ +P ++  I R+          PV++  S  F H+K  
Sbjct: 1   MSSCIFITDENLEPLISKNIKA-IP-NLQGILRLFKSVYTPESQPVISASSFHFVHIKRS 58

Query: 61  GNLWIVAVSRSNADSAA--IWEFLYKLSALLE---AFGLHSENELKEDFMTCYELLDIVL 115
             L++  +   +A +    I  FL +  +LL+   A     +N + ++ +   EL+D  +
Sbjct: 59  SLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELIDESI 118

Query: 116 EDGVPVDTELSSVASKMSVK---------------PSASAERINTFIESGNGGTNRILPV 160
           + GV   T+ S +   + VK                S + E  N   +  +G  N    +
Sbjct: 119 DFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDNKKTKRRSGKPN----L 174

Query: 161 AQFLRARXXXXXXXXXXXKVPSN------------------IPWRMNGIKYKKNEVFLNV 202
            +FLR                                    + WR  GI Y +NE FL+V
Sbjct: 175 YKFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKGIHYARNEFFLDV 234

Query: 203 NERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLNDSLSVSTPFGDNESPTTNK 261
            E++  L+    G I K+ + G +   ++LSGMP  +   N        F          
Sbjct: 235 VEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFNKLSQKDEQF---------- 284

Query: 262 KAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLN------ 315
                       +   KFHQCV      +E+ I FIPPDG F L +Y ++ ++       
Sbjct: 285 ------------ISHSKFHQCVTWPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQPMLK 331

Query: 316 -LPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHIS------- 367
            + F + P +  +K   I    TI++ F ++ +   + L+IP+     +  I        
Sbjct: 332 LVSFGVKPKLKKYK---IQMSCTIETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPARF 388

Query: 368 -TSNGRCKFVPEESAIIWKFSKYQ-GLTENSLSATAV----------------------- 402
            + +G+  F   +  ++W     + G  +  LS  A                        
Sbjct: 389 KSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPP 448

Query: 403 PMKDSALNIDQWS-----KPP-------MSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMV 450
           P++D     + +      K P       +S+KFEI   + SGL V +  + E    Y+  
Sbjct: 449 PLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSF 508

Query: 451 KWIKY 455
            W++Y
Sbjct: 509 PWVRY 513

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 97/224 (43%), Gaps = 42/224 (18%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           I WR  GI Y KNE FL+V E+   ++  K+  I K+ + G +     LSGMP  +  LN
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPPDGS 302
             L     F                      L   +FHQCV L+  Q+ + I FIPPDG 
Sbjct: 347 KLLQKDQQF----------------------LSQLRFHQCVSLETIQN-KEIEFIPPDGE 383

Query: 303 FELMKYHVRENLNLP-------FKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRI 355
           F L +Y ++ ++  P       F+I P +  FK   I   ++I + F  + +   + L+I
Sbjct: 384 FILCEYELKRHVKDPPNIKLISFEIKPKLKKFK---IQINLSITTFFKVQNSTSILNLKI 440

Query: 356 PVPPETVDCHISTSN--------GRCKFVPEESAIIWKFSKYQG 391
           P+     D  I            G+ KF   +  ++W+    +G
Sbjct: 441 PLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKG 484

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 80/164 (48%), Gaps = 11/164 (6%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVP--KSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVK 58
           MLS +FI     E LISK++R ++P  KS+ E+FR     N     P++++    F  +K
Sbjct: 1   MLSCIFILDENLEPLISKNIR-AIPNFKSIVELFRKHRSTNT-TELPIVSINDWNFIQIK 58

Query: 59  SPGNLWIVAVS----RSNADSAAIW--EFLYKLSALLEAFGLHSENELKEDFMTCYELLD 112
               +++ A++     S+  S +I+  +F Y L   L+   L+  N + ++ +   EL+D
Sbjct: 59  RDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLN-RNIILDNILLIMELID 117

Query: 113 IVLEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNR 156
             ++ G+   T+ + +   + VK +   E I+  I       +R
Sbjct: 118 ESIDFGIIQMTDPNIIKDYVRVKVNLPDEDISLSINKNQSSLDR 161

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 398 SATAVPMKDSALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKY 455
           S   +P+K +  N  Q+    +++ FEI  ++ SGL V +  + E    Y+   W++Y
Sbjct: 592 SNKEIPLKKALSNKPQY----LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRY 645

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 118/558 (21%), Positives = 212/558 (37%), Gaps = 132/558 (23%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M S LFI     E LISK+V+S   ++++ I     +N  +   PV T+    +  +K  
Sbjct: 1   MSSCLFILDESLEPLISKNVKSV--RNLTGILEFFKLNYKENGPPVFTVLEWHYVFIKR- 57

Query: 61  GNLWIVAVSRSNADS----AAIWEFLYKLSALLEAFGLHS---ENELKEDFMTCYELLDI 113
            +LW +       D      A+  +L +L  LL+ +   S    N + ++ +   EL+D 
Sbjct: 58  DSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELIDE 117

Query: 114 VLEDGVPVDTELSSVASKMSVKPSASAERI----NTFIESGNGGTNRILP----VAQFLR 165
            ++ G+   T+ S +   + VK ++    +    ++  E  + G +  +P    + +  +
Sbjct: 118 SMDFGIVQLTDPSIIKDYIRVKVNSPITHLTSDDDSDTEEKHKGLSTYIPGKTDIVKLWK 177

Query: 166 ARXXXXXXXXXXXKVPSN--------------------IPWRMNGIKYKKNEVFLNVNER 205
            +           +  +                     + WR  GI Y KNE FL+V E+
Sbjct: 178 GQPAVTANEGKSNEQDNYDDDDDENFINSYIAKTTIMPVSWRTKGIYYAKNEFFLDVIEK 237

Query: 206 ISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAI 264
           +  L+    G I K+ + G ++   +LSGMP  +  LN  +     F             
Sbjct: 238 VQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALNKLIKNDEQF------------- 284

Query: 265 PKAAAGSVMLEDCKFHQCVQLDKFQSE------------RTINFIPPDGSFELMKYHVRE 312
                    + + KFHQCV ++  + E            + I FIPPDG F L KY ++ 
Sbjct: 285 ---------ISNSKFHQCVSINSLKREINNEEEENTYHGKEIEFIPPDGEFVLCKYELKR 335

Query: 313 NLNLPFKITPVVTL--------FKANSIDYRVTIKSLFPSKLTAKDVQLRIPVP------ 358
           ++    +  PV+ L         K   I   VTI++ F  + +   + ++IP+       
Sbjct: 336 HV----RDVPVIKLSNIEIKPKLKKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFSQY 391

Query: 359 --PETVDCHISTSNGRCKFVPEESAIIWKFSKYQG------------------------L 392
               T      +  G   F   +  +IW+    +G                         
Sbjct: 392 KIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEYDRLQ 451

Query: 393 TENSLSATAVPMKD----------SALNIDQWSKPPMS-----LKFEIVMFSNSGLVVRF 437
            E   S    P+++          +  N D+  K  +S     +KFE+   + SGL V +
Sbjct: 452 EEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMKFEVPYSTCSGLKVEY 511

Query: 438 FDVSEGDRNYKMVKWIKY 455
             + E   NY+   W++Y
Sbjct: 512 LKIEENQVNYQSFPWVRY 529

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 101/245 (41%), Gaps = 63/245 (25%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           + WR  GI Y KNE FL+V E +  L++ KD  I ++ + G ++  ++LSGMP  R  LN
Sbjct: 225 VSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIALN 284

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLD---------------- 286
             L     F                      L   KFHQCV L+                
Sbjct: 285 KILQDDKQF----------------------LGHAKFHQCVSLNSINIKDLEKDLEGPND 322

Query: 287 ----KFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTL--------FKANSIDY 334
                F +++ I FIPPDG F L +Y +R ++  P    PV+ +        FK   +  
Sbjct: 323 ISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDP----PVINMTSFDIKPNFKKFRVQI 378

Query: 335 RVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSN--------GRCKFVPEESAIIWKF 386
            + I++ F  + +   + ++IP+     D  I  S         G+  F   E  +IW+ 
Sbjct: 379 SLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEI 438

Query: 387 SKYQG 391
              +G
Sbjct: 439 DALKG 443

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 86/357 (24%), Positives = 134/357 (37%), Gaps = 110/357 (30%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           I WR  GI Y KNE FL+V ER+  L+  + G I K+ + G +   ++LSGMP  +  +N
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS------------ 290
             L+    F  N +                      FHQCV LD   +            
Sbjct: 313 KILNRDPQFMSNSN----------------------FHQCVSLDSINTIEKGQEKEQNTG 350

Query: 291 -------ERTINFIPPDGSFELMKY----HVRENLNLPFKITPVVTLFKANSIDYRVTIK 339
                   R I F+PPDG F L +Y    HV++   +  K   +    K + I     I+
Sbjct: 351 DSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQILTKIQ 410

Query: 340 SLF-PSKLTAKDVQLRIPVPPETVDCHISTS--------NGRCKFVPEESAIIWKFSKYQ 390
           + F P+  T+K + ++IP+     D  I  S        NG+  F   +  ++W+    +
Sbjct: 411 TNFKPTNSTSK-LNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQTMK 469

Query: 391 GLTENSLSATAVPMKD-------------SALNIDQWSK-----------PPM------- 419
           G  E   +A+  P  D             S  N +++ +           PP+       
Sbjct: 470 GHRER--NASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKLE 527

Query: 420 ---------------------SLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKY 455
                                S+ FEI   + SGL V +  V E    Y+   W++Y
Sbjct: 528 ELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRY 584

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 101/254 (39%), Gaps = 79/254 (31%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           + WR  GI Y KNE FL+V E++  LV  + G + +S + G +   ++LSGMP  +  LN
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ------------- 289
             L     F                      +   +FHQCV LD  +             
Sbjct: 309 KLLQNDKQF----------------------ISQVQFHQCVSLDSIEKVIKYAEEHSDEL 346

Query: 290 ---------SERTINFIPPDGSFELMKYHVRENLNLP-------FKITP----------- 322
                    +E  I FIPPDG F L  Y ++ ++  P       F+ITP           
Sbjct: 347 KTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYKLKISA 406

Query: 323 -VVTLFK----ANSIDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVP 377
            V T FK     + +D ++ I  +F      KD Q+ +  P         TSNGR  +  
Sbjct: 407 AVETHFKPTNSTSKLDVKIPISKVF------KDYQIDLKKP-----IKFKTSNGRVVYNI 455

Query: 378 EESAIIWKFSKYQG 391
            +  ++W+    +G
Sbjct: 456 SDDFLLWEIGVIKG 469

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 106/481 (22%), Positives = 179/481 (37%), Gaps = 97/481 (20%)

Query: 43  RSPVLTLGSTTFHHVKSPGNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELK- 101
           R PVL+     + +++  G L+ +++S        +  F Y L  L + F  +    L  
Sbjct: 39  RLPVLSHRGYDYIYIQRDG-LYFLSLSYGVETVVPMTVFAY-LGQLYQLFKKYLGERLNR 96

Query: 102 ----EDFMTCYELLDIVLEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRI 157
               ++F   YEL+D  ++ G+P  T+ + +   + V+    AE  +    +G     R 
Sbjct: 97  QLIMDNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAE--DGEKHAGKHKAKRD 154

Query: 158 LPVAQFLRARXXXXXXXXXXXKVP----SNIPWRMNGIKYKKNEVFLNVNERISILVSKD 213
               +   A             +     S I WR  GI Y KNE FL+V E +  L+  +
Sbjct: 155 KAGKEEEEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFE 214

Query: 214 GSILK-SYVDGTVEATTHLSGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSV 272
            + ++ + V G +   ++LSGMP    GLN  ++    F                     
Sbjct: 215 RAQVRLNQVHGAINCRSYLSGMPQLTVGLNKMVAQDRDFTSQ------------------ 256

Query: 273 MLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLN-LPF--------KITPV 323
                 FHQCV L++  ++R I F+PPDG F+L  Y +    N  P          + P 
Sbjct: 257 ----VHFHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPR 312

Query: 324 VTLFKANSIDYRVTIKSLFPSKLTAKDVQLRIPV-------------PPETVDCHISTSN 370
                A+ +   V+I + F  +     +++R+P+             PP           
Sbjct: 313 RRPADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPR-----FKCDA 367

Query: 371 GRCKFVPEESAIIWKFSKYQG------LTENS----------------LSATAVPMK--- 405
           G   F   +  ++W   K +G       T  S                LS +  P+    
Sbjct: 368 GCVMFNITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHP 427

Query: 406 ----DSALNIDQWSKPP-----MSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYL 456
               ++  N    S P      + + FE+   + SGL V F  + E    Y+   WI+Y 
Sbjct: 428 GQQLEALYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRYK 487

Query: 457 S 457
           S
Sbjct: 488 S 488

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 88/361 (24%), Positives = 135/361 (37%), Gaps = 117/361 (32%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           I WR  GI Y KNE FL+V ER+  L+  + G I K+ + G +    +LSGMP  +  +N
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ------------- 289
             L+    F  N                       KFHQCV LD                
Sbjct: 312 KLLNRDPQFMSN----------------------SKFHQCVSLDSINIIEEEGRDTDDAG 349

Query: 290 -----SERTINFIPPDGSFELMKYHVRENL-NLP------FKITPVVTLFKANSIDYRVT 337
                  + I FIPPDG F L +Y ++ ++ + P      F+I P +  FK   I     
Sbjct: 350 SQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKPKLKKFKIQII---TK 406

Query: 338 IKSLF-PSKLTAKDVQLRIPVPPETVDCHISTSN--------GRCKFVPEESAIIWKFSK 388
           I++ F P+  T+K + ++IP+     D  I  S         G+  F   +  ++W+   
Sbjct: 407 IQTNFKPTNSTSK-LNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEIGT 465

Query: 389 YQGLTENSLSATAVPMKDSA------------LNIDQWSK-----------PPM------ 419
            +G  E   +   VP +D A             N +++ +           PP+      
Sbjct: 466 MKGHRER--NTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKL 523

Query: 420 -------------------------SLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIK 454
                                    S+ FEI   + SGL V +  V E    Y+   W++
Sbjct: 524 EELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVR 583

Query: 455 Y 455
           Y
Sbjct: 584 Y 584

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 68/141 (48%), Gaps = 8/141 (5%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M S+LFI     E L+SK++R ++P   S +   +   + D   P+L+     F H+K  
Sbjct: 1   MSSSLFILDEDLEPLVSKNIR-AIPNLSSILSSFKQCYHRD-SPPILSQNGWFFIHLKRD 58

Query: 61  GNLWIV---AVSRSNADSAAIWEFLYKLSALLEAF---GLHSENELKEDFMTCYELLDIV 114
              +I    A  + N D  +I  FL +   LL+ +    + S+N + ++ +   EL+D  
Sbjct: 59  FLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLELVDEC 118

Query: 115 LEDGVPVDTELSSVASKMSVK 135
           ++ G+   T+ S +   + VK
Sbjct: 119 IDFGIVQVTDPSIIKDYIRVK 139

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/353 (23%), Positives = 134/353 (37%), Gaps = 107/353 (30%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           I WR  GI Y KNE FL+V E++   +  K G I K+ + G +   ++LSGMP  +  +N
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERT--------- 293
             L     F                      L + KFHQCV LD  ++            
Sbjct: 310 KILKQDVQF----------------------LSNVKFHQCVSLDSIRARSNPPAVEEDGK 347

Query: 294 --------------INFIPPDGSFELMKYHVRENL-NLP------FKITPVVTLFKANSI 332
                         I FIPPDG F L KY ++ ++ + P      F+I P +  FK   I
Sbjct: 348 KKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLHKFK---I 404

Query: 333 DYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKY--- 389
              V I++ F +  +   + LRIP+        I  S  + KF  E+  +++  S     
Sbjct: 405 KIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSK-QPKFKCEQGTVLFNLSDKFLL 463

Query: 390 -------QGLTENSLSATAV-----------------------PMKD------------- 406
                   G  EN+LS  A                        P+++             
Sbjct: 464 WEVGTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHE 523

Query: 407 ----SALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKY 455
                 ++  + ++  +++ FE+   + SGL + +  + E    Y+   W++Y
Sbjct: 524 EGDSDEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRY 576

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 70/144 (48%), Gaps = 13/144 (9%)

Query: 1   MLSALFIFSLRGELLISKHVRS-----SVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFH 55
           M S++FI     E +I K++R+     S+     E++R   ++ L    P+L      F 
Sbjct: 1   MSSSIFILDETLEPIICKNIRALPNLPSLVTKFQELYRSNGVSPL----PILNDIDWQFL 56

Query: 56  HVKSPGNLWIVAV-SRSNADSAAIWEFLYKLSALLEAF---GLHSENELKEDFMTCYELL 111
           H+K    +++  V + S  +   ++ +L +   LL+ +   G+ + N L ++F+   EL+
Sbjct: 57  HIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIELI 116

Query: 112 DIVLEDGVPVDTELSSVASKMSVK 135
           D  L+ GV   T+ S +   + VK
Sbjct: 117 DESLDFGVVQFTDSSLIKDYVRVK 140

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/362 (23%), Positives = 136/362 (37%), Gaps = 116/362 (32%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           I WR  GI Y KNE FL+V ER+  L+  + G I K+ + G +    +LSGMP  +  +N
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS------------ 290
             L+    F  N S                      FHQCV LD   +            
Sbjct: 318 KILNRDPQFMSNSS----------------------FHQCVSLDSINTIEKDEEKNSDDD 355

Query: 291 --------ERTINFIPPDGSFELMKYHVRENL-NLP------FKITPVVTLFKANSIDYR 335
                    R I FIPPDG F L +Y ++ ++ + P      F+I P +  FK   I   
Sbjct: 356 AGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFK---IQIV 412

Query: 336 VTIKSLF-PSKLTAKDVQLRIPVPPETVDCHISTSN--------GRCKFVPEESAIIWKF 386
             I++ F P+  T+K + +RIP+     +  I  S         G+  F   +  ++W+ 
Sbjct: 413 TKIQTNFKPTNSTSK-LNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEI 471

Query: 387 SKYQGLTENSLSATAVPMKDSA--------------LNIDQWSK-----------PPM-- 419
              +G  E+S + ++    D                 N +++ +           PP+  
Sbjct: 472 QTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRT 531

Query: 420 --------------------------SLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWI 453
                                     ++ FEI   + SGL V +  V E    Y+   W+
Sbjct: 532 GPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWV 591

Query: 454 KY 455
           +Y
Sbjct: 592 RY 593

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 67/147 (45%), Gaps = 20/147 (13%)

Query: 1   MLSALFIFSLRGELLISKHVR-----SSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFH 55
           M S+LFI     E L+SK++R     SSV  S  + +        D   P+L+     F 
Sbjct: 1   MSSSLFILDENLEPLVSKNIRALPNLSSVLSSFKQCYH-------DGSPPILSQNDWFFI 53

Query: 56  HVKSPGNLWIVAV----SRSNADSAAIWEFLYKLSALLEAF---GLHSENELKEDFMTCY 108
           H+K    L  V+V     + N D   I  FL +   LL+ +    + ++N + ++ +   
Sbjct: 54  HLKRDF-LHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVL 112

Query: 109 ELLDIVLEDGVPVDTELSSVASKMSVK 135
           EL+D  ++ G+   T+ S +   + VK
Sbjct: 113 ELIDECIDFGIVQVTDPSIIKDYIRVK 139

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 82/362 (22%), Positives = 139/362 (38%), Gaps = 112/362 (30%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           I WR  GI Y KNE FL+V ER+  L+  + G I K+ + G +    +LSGMP  +  +N
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS------------ 290
             L+    F  N S                      FHQCV LD  ++            
Sbjct: 320 KILNRDAQFLSNSS----------------------FHQCVSLDSIKTIEKREEKEDDDT 357

Query: 291 -------ERTINFIPPDGSFELMKYHVRENL-NLP------FKITPVVTLFKANSIDYRV 336
                   + + F+PPDG F L +Y ++ ++ + P      F+I P +  FK   I    
Sbjct: 358 GLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFK---IQIET 414

Query: 337 TIKSLF-PSKLTAKDVQLRIPVPPETVDCHISTSN--------GRCKFVPEESAIIWKFS 387
            I++ F P+  T+K + ++IP+     +  I  S         G+  F   +  ++W+  
Sbjct: 415 KIQTNFKPTNSTSK-LNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQ 473

Query: 388 KYQGLTENSLSATAVPMKD-----------SALNIDQWSK-----------PPM------ 419
             +G  E++ + T+    D              N +++ +           PP+      
Sbjct: 474 AMKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRL 533

Query: 420 ----------------------SLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLS 457
                                 ++ FEI   + SGL + +  V E    Y+   W++Y +
Sbjct: 534 EELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKT 593

Query: 458 KS 459
            S
Sbjct: 594 TS 595

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 66/142 (46%), Gaps = 10/142 (7%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           M S+LFI     ELL+SK++R+    S       Q  +  D   P+L+     F H+K  
Sbjct: 1   MSSSLFILDENLELLVSKNIRALPSLSSVLSSFKQCYH--DEAPPILSQNDWFFIHLKRD 58

Query: 61  GNLWIVAV----SRSNADSAAIWEFLYKLSALLEAF---GLHSENELKEDFMTCYELLDI 113
             L  V+V     + N D   I  FL +   LL+ +    + +++ + ++ +   EL+D 
Sbjct: 59  F-LHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTKDVILDNVLLVLELMDE 117

Query: 114 VLEDGVPVDTELSSVASKMSVK 135
            ++ G+   T+ S +   + VK
Sbjct: 118 CIDFGIVQVTDPSIIKDYIRVK 139

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 81/181 (44%), Gaps = 29/181 (16%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSKDGSIL-KSYVDGTVEATTHLSGMPVCRFGLN 242
           I WR  GI Y KNE FLNV E++   +    +++ K+ + G +     LSGMP  +  +N
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS--ERTINFIPPD 300
             ++    F                      L +CKFHQCV L   +S   + + F+PPD
Sbjct: 313 KIVNEDKQF----------------------LANCKFHQCVSLASLESSDHKDVEFVPPD 350

Query: 301 GSFELMKY----HVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRIP 356
           G F L +Y    HVR+   +      V    K   +   +TI++ F +      + LR+P
Sbjct: 351 GEFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKLLLTIETHFKTTNATSKLALRVP 410

Query: 357 V 357
           +
Sbjct: 411 I 411

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 24/43 (55%)

Query: 419 MSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGA 461
           +++ FE+   ++SGL V +  + E    Y+   W++Y + S A
Sbjct: 533 LTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDA 575

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 100/249 (40%), Gaps = 66/249 (26%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           I WR  GI Y KNE FL+V E++   +  + G I K+ + G +    +LSGMP  +  +N
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ------------- 289
             L   + F                      L +  FHQCV LD                
Sbjct: 355 KILQNDSQF----------------------LSNAHFHQCVSLDSLHLQSAEDDDGDDNA 392

Query: 290 ------------SERTINFIPPDGSFELMKYHVRENL-NLP------FKITPVVTLFKAN 330
                        ++ I FIPPDG F L KY ++ ++ +LP      F I P ++ +K  
Sbjct: 393 NVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKLSKYK-- 450

Query: 331 SIDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTS--------NGRCKFVPEESAI 382
            +   V I++ F +      + L+IP+     +  I  S         G+  F   ++ +
Sbjct: 451 -LKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFL 509

Query: 383 IWKFSKYQG 391
           IW+    +G
Sbjct: 510 IWEIGSMKG 518

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 80/313 (25%), Positives = 130/313 (41%), Gaps = 73/313 (23%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILV---SKDGSI--LKSYVDGTVEATTHLSGMPVCR 238
           +PWR  G+KY  NE++++V E I +++    K G +  ++  +DG V+  +HL+G PV  
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 239 FGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIP 298
             LN                 +   +P              H C Q     S   + F+P
Sbjct: 246 LKLN--------------LHGHDLGVP------------ALHPCCQAQYTGSPENLQFVP 279

Query: 299 PDGSFELMKYHVR-ENLNLPFKITPVVTLFKANSIDYRVTIKSL---FPSKLT------- 347
           PDG F LM+Y +  E L    K+   + L    S+DY V +  L   F  K+        
Sbjct: 280 PDGKFRLMQYTIDLEALQTKSKLFSNMGLV---SLDYFVGLGDLRDEFEIKVNIAGSQHV 336

Query: 348 --AKDVQLRIPVPPETVDCHIS---TSNGRCKFVPEESAIIWKFSK---------YQGLT 393
               D+ + I     T DC I    +++G  +   E +   W F K         ++G  
Sbjct: 337 KLIDDLVVTIKFGKLTSDCRIKALRSTHGHFENGFENNIGKWSFDKETPTGTVPVFRGCL 396

Query: 394 ENSLSATAVPMKDSALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEG-DRNYKMVKW 452
           EN   AT   +K  +L I   +K  +           SG+ V   D+  G  +N K  K 
Sbjct: 397 EN---ATPEQIKTLSLAISYSNKGSLP----------SGIKVGAVDIISGLPKNTKPFKG 443

Query: 453 IKYLSKSGAYEVR 465
           +KY++++G + +R
Sbjct: 444 VKYVARTGQFNLR 456

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/314 (23%), Positives = 129/314 (41%), Gaps = 75/314 (23%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSKD---GSI--LKSYVDGTVEATTHLSGMPVCR 238
           +PWR  G+KY  NE++++V E + +++ K+   G +  ++  +DG V+  +HLSG PV  
Sbjct: 186 VPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHLSGNPVI- 244

Query: 239 FGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE-RTINFI 297
                +L++     D   P                      HQC  LD +Q     + F+
Sbjct: 245 -----ALNLRLRGHDLGMPA--------------------LHQCC-LDSYQGRPDQLRFV 278

Query: 298 PPDGSFELMKYHVR-ENLNLPFKITPVVTLFKANSIDYRVTIKSL---FPSKLT------ 347
           PPDG F+LM Y +  ++L    K+   + L    S DYR  +  L   F   L       
Sbjct: 279 PPDGKFQLMHYSIDLDSLQSKSKLFSNIGLV---SPDYRTELGDLGDEFEVNLNIAGSQH 335

Query: 348 ---AKDVQLRIPVPPETVDCHIS---TSNGRCKFVPEESAIIWKFSK---------YQGL 392
                D+ + +   P   +C I    +++G  +     +   W F K          +G 
Sbjct: 336 AKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDKETPTGTLPVLRGC 395

Query: 393 TENSLSATAVPMKDSALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEG-DRNYKMVK 451
            EN+       ++ S    ++   P             SG+ V   D+  G  +N K  K
Sbjct: 396 LENATREQVRALQLSVSYTNRGELP-------------SGIKVDSVDILSGLSKNIKPFK 442

Query: 452 WIKYLSKSGAYEVR 465
            +KY++K+G + +R
Sbjct: 443 GVKYIAKTGDFHLR 456

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 33/135 (24%)

Query: 182 SNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFGL 241
           S +PWRM+GI Y  NE+F++++E I+ +V K G +L  ++ G ++   HLSG P+    L
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIVEK-GKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 242 NDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSER--------T 293
                      D++    N                  FH+C+  DK  S           
Sbjct: 267 G--------LLDHKLSHLNT----------------TFHRCILEDKANSINDLIAGKFTK 302

Query: 294 INFIPPDGSFELMKY 308
           + F+PPDG   L +Y
Sbjct: 303 LTFVPPDGRTRLCQY 317

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 63/146 (43%), Gaps = 40/146 (27%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSKDG----------SILKSYVDGTVEATTHLSG 233
           +PWR  G+KY  NE+++++ E I ++  K G           ++   ++G      +LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 234 MPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ--SE 291
            P     L+                 N   +P             FH+CV+LD  Q  S 
Sbjct: 271 NPTVDLQLD--------------LAGNDLGVPA------------FHECVELDNHQNPSN 304

Query: 292 RTINFIPPDGSFELMKYHVRENLNLP 317
             + FIPPDG F LM+Y +  +L+ P
Sbjct: 305 CDLRFIPPDGRFNLMQYSI--DLDTP 328

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/328 (21%), Positives = 136/328 (41%), Gaps = 74/328 (22%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS---KDGSI--LKSYVDGTVEATTHLSGMPVCR 238
           +PWR   +KY  +E+++++ E + ++     ++ S+  +   ++G V   ++LSG P   
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 239 FGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIP 298
             ++                          AG+ M      HQCV++ +  S  ++ FIP
Sbjct: 252 MDMD-------------------------LAGNEMYAP-SMHQCVEMPQ-GSPSSLCFIP 284

Query: 299 PDGSFELMKYHVRENLNLPFKITPVVTLFKA--------NSIDYRVTIK-SLFPSKLTAK 349
           PDG+  L+ Y +  ++N   K+T  V L           N  ++ V +  S  PS    +
Sbjct: 285 PDGNCNLLNYTIDLDMNPKVKVTSPVGLVSVIYKDGLGLNRDEFEVHVNISNSPSVPHIQ 344

Query: 350 DVQLRIPVPPETV-----------DCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSL- 397
           D++L+I + P              D  + T   + +   E+   I       G  +NS+ 
Sbjct: 345 DLKLQIELQPRIQELEEQEEEAQRDAEMDTEAKKERSQLEDGK-IKVLRNTHGRFDNSVH 403

Query: 398 ---------SATAVPMKDSALNIDQWSKPPMSLKFEIVMFSNSGLV-----VRFFDV--- 440
                    S T V          + SK P+ ++   V ++N G++     +R  +V   
Sbjct: 404 PGRGTWIFDSETPVGSLPVLRGCVEDSKHPVRIQRVGVSYANEGMLPSGIGLRRINVRST 463

Query: 441 ---SEGDRNYKMVKWIKYLSKSGAYEVR 465
               E +R  ++ K +KY+ ++G YE+R
Sbjct: 464 TNLRENNRGKRLFKGVKYVCRTGDYEIR 491

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 66/133 (49%), Gaps = 34/133 (25%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSKDG------SILKSYVDGTVEATTHLSGMPVC 237
           +PWR   IK  +NE++++V E + + + K         +L  Y++G+V   + + G+P+ 
Sbjct: 173 VPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPM- 231

Query: 238 RFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE--RTIN 295
                  L VS  FG  +     K  IPK            FH CV++++F +     I 
Sbjct: 232 -------LEVS--FGGCDF----KDIIPK------------FHDCVEVNEFLTNDGNIIK 266

Query: 296 FIPPDGSFELMKY 308
           FIPPDG F+LM+Y
Sbjct: 267 FIPPDGKFQLMEY 279

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 90/233 (38%), Gaps = 53/233 (22%)

Query: 115 LEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARXXXXXXX 174
           + D VPV  +LS V +  +     S + + T    G G T  I   +  L          
Sbjct: 178 IRDNVPVKKDLSKVITSTAHTIQRSIQNVQT----GGGSTRSI--TSNLLSGSNNTSNVS 231

Query: 175 XXXXKVPSN---------------IPWRMNGIKYKKNEVFLNVNERISILVSKDGS---- 215
                + +N               +PWR   +KY  NE++++V E I ++  +  S    
Sbjct: 232 ISGNGMGNNSSSGFGNSGTINNKVVPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYH 291

Query: 216 --------------ILKSYVDGTVEATTHLSGMPVCRFGLNDSLSVSTPFGDNESPTTNK 261
                         ++++ + G +   ++LS  P+    L     V   + D ++  +  
Sbjct: 292 KINQFNRNDNSPMKLIRADIIGELNVRSYLSDNPMVEVTL-----VDRNYSDQKTGWSEN 346

Query: 262 KAIPKAAAGSVMLEDCKFHQCVQLDK----FQSERTINFIPPDGSFELMKYHV 310
               +   G  M     FH CV++D      Q  R I FIPPDG F LMKY++
Sbjct: 347 DLFKQLNLGLPM-----FHDCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 123/304 (40%), Gaps = 55/304 (18%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSKDGS---ILKSYVDGTVEATTHLSGMPVCRFG 240
           +PWR    +Y  NE+++++ E ++  + + GS   ++   + G ++   +LSG P  +  
Sbjct: 140 VPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLK 199

Query: 241 LNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPPD 300
           L  S     P                       L++   H+CV+L +     T+NF+PPD
Sbjct: 200 LRTS---GHP-----------------------LDNSALHRCVELGE-AGVATMNFVPPD 232

Query: 301 GSFELMKYHV---------RENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDV 351
           G F L +Y +         R   NL      + +    +  ++ + +     +++ A + 
Sbjct: 233 GRFTLAEYAIDLSAISQAARRLTNLGLVTVSLASGLGQHRDEFEIKVIIGNSTQVAAIE- 291

Query: 352 QLRIPVP-PETVDCH----ISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKD 406
            LRI V  P+  D      + T++G  +        +W F K   +    +    V   +
Sbjct: 292 DLRITVYFPDISDAAKIKILRTTHGGWESDLSRVRGVWAFDKQTAVGSVPVLRGCVENPE 351

Query: 407 SALNIDQWSKPPMSLKFEIVMFSN-----SGLVVRFFDVSEGDRNYKMVKWIKYLSKSGA 461
           S  +      PP+      V +S+     SG+ V    +S+     K  K +KY S++G 
Sbjct: 352 STPH-----APPVFPSHLAVSYSHVGQLPSGIRVDTIALSDLPPGSKPFKGVKYTSRAGD 406

Query: 462 YEVR 465
           Y VR
Sbjct: 407 YIVR 410

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 121/304 (39%), Gaps = 56/304 (18%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSKDGSI-----LKSYVDGTVEATTHLSGMPVCR 238
           +PWR  G+KY  NE+++++ E ++I+++K  +      +   +DG V    +LS  P+  
Sbjct: 204 VPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSIDGEVGFKCYLSENPLVE 263

Query: 239 FGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ-SERTINFI 297
             LN                TN   +   A          FH+CV+ +       T+ FI
Sbjct: 264 LDLN----------------TNGHDLGIPA----------FHRCVRTEGSDFHPGTLRFI 297

Query: 298 PPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRIPV 357
           PPDG F LM+Y++  +L+       +++     S+DY      L P K    + ++++ V
Sbjct: 298 PPDGDFCLMEYNI--DLDSLRNRNKILSNLGLVSVDYHT---GLGPKK---DEFEIKVTV 349

Query: 358 PPETVDCHISTSNGRCKFVP-EESAIIWKFSKYQGLTENSLSATAVPMKDSALNID---- 412
                  H+        F P  E   I       G  EN ++       D    +     
Sbjct: 350 ALSRNVKHVEDLKIDVHFDPLREDGKIKILRNTHGGFENGINNKGTWTFDKETPVGVFPV 409

Query: 413 -----QWSKPPMSLKFEIVMFSN-----SGLVVRFFDVSEG-DRNYKMVKWIKYLSKSGA 461
                +    P   K+  + +SN     SG+ V   ++  G     K  K +KY++K G 
Sbjct: 410 LRGCIEGCTEPTWPKYLSMSYSNKGQLPSGIRVNSVNILSGFPAGVKPFKGVKYITKIGD 469

Query: 462 YEVR 465
           Y VR
Sbjct: 470 YVVR 473

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 73/322 (22%), Positives = 136/322 (42%), Gaps = 77/322 (23%)

Query: 184 IPWRMN-GIKYKKNEVFLNVNERISILVSKDGS---ILKSYVDGTVEATTHLSGMPVCRF 239
           +PWR +   K++ NE++L++ E   ++  K  S   ++   + GT++  ++L+  P+   
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 240 GLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ--SERTINFI 297
            LN                 N   IP              H+CV+++     S   I FI
Sbjct: 259 KLN--------------TMGNDIGIPS------------LHECVEINDGGVFSPSNITFI 292

Query: 298 PPDGSFELMKYHVRENLN-----LPFKITPVVTLFKANSI-------DYRVTIKSLFPSK 345
           PPDG F L++Y V  +       +  K   +V+L   N +       +  + I++L  + 
Sbjct: 293 PPDGKFRLLEYCVDLDSQVIKSGVRMKSIGLVSLHFQNGLGKDSDEFELSLNIENL-KNV 351

Query: 346 LTAKDVQLRIPVPPETVDCH--------ISTSNGRCKFVPEESAIIWKFSKYQGLTENSL 397
               D++L +    E  D +        +  ++GR      E++II    + Q + + S 
Sbjct: 352 SQVDDLKLDLQFNVENSDSNEVAYKIKILRNTHGRF-----ENSII--MGQGQWIFDKST 404

Query: 398 SATAVPMKDSAL-----------NIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEG--- 443
           +   VP+    +           N+D  +   +SL++  V  S SG+ V   D+  G   
Sbjct: 405 ATGTVPVLHGCIEYETGRSNDQKNVDLQT---VSLEYSYVGQSASGIYVEAIDILSGLTI 461

Query: 444 DRNYKMVKWIKYLSKSGAYEVR 465
            +N K+ K  KY +++G Y+VR
Sbjct: 462 GKNTKLYKGAKYKTQTGDYQVR 483

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 62/153 (40%), Gaps = 54/153 (35%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSK-------DG--------SILKSYVDGTVEAT 228
           +PWR NGIK  K E+++++ E + +   K       DG         ++  ++ GT++  
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 229 THLSGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLD-- 286
            +L+G P          +VS  F        N   IP             FH CV+ +  
Sbjct: 249 CYLNGNP----------TVSLMF----DTMGNDLGIPS------------FHACVEQEDQ 282

Query: 287 -----------KFQSERTINFIPPDGSFELMKY 308
                       FQ +R + F+PPDG F L +Y
Sbjct: 283 VQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQY 315

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 61/149 (40%), Gaps = 46/149 (30%)

Query: 182 SNIPWRMNGIKYKKNEVFLNVNERISILV------------SKDG--SILKSYVDGTVEA 227
           +N PWR   +K+  NE+++++ E + ++             SK     I+  Y+ GT   
Sbjct: 199 ANAPWRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYV 258

Query: 228 TTHLSGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDK 287
            + L+G P+        L +     D   P+                    FH+CV +D+
Sbjct: 259 QSFLNGNPLVE------LQLELSGNDIGHPS--------------------FHECVDIDE 292

Query: 288 F------QSERTINFIPPDGSFELMKYHV 310
           +       S  ++ FIPPDG F LM Y +
Sbjct: 293 YLKNIDNSSISSLKFIPPDGKFTLMDYTI 321

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 65/137 (47%), Gaps = 24/137 (17%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVE-ATTHLSGMPVCRFGLN 242
           +PWRM  + +  NE++L++ E I +++        SY + T++  T ++ G  + +  LN
Sbjct: 202 VPWRMRNVDHVNNELYLDLVESIHVVLETKKR-KSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 243 DSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQ---LDK---FQSERTINF 296
            +  V                  K       LE    H+CV+   +DK   F++ + I F
Sbjct: 261 GNPIVEM----------------KIDMAGNDLESIFLHECVKSKDVDKDQEFENTKLIKF 304

Query: 297 IPPDGSFELMKYHVREN 313
           +PPDGSF+L  Y++  N
Sbjct: 305 LPPDGSFKLFDYNINLN 321

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/319 (21%), Positives = 135/319 (42%), Gaps = 72/319 (22%)

Query: 184 IPWRMN-GIKYKKNEVFLNVNERISILVSKDGS---ILKSYVDGTVEATTHLSGMPVCRF 239
           +PWR +   K++ NE+++++ E   ++  K  S   +L   + G V+  ++L+  P+   
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 240 GLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQL-DKFQSERTINFIP 298
            LN                 N   IP              H CV++ D   S   I FIP
Sbjct: 259 KLN--------------TMGNDIGIPS------------LHDCVEINDGVFSPSNITFIP 292

Query: 299 PDGSFELMKYHVRENLNLPFKITPV-------VTLFKANSI-----DYRVTIK-SLFPSK 345
           PDG F L++Y V  +L+   K + V       ++L   N +     ++ +++    F   
Sbjct: 293 PDGKFRLLEYSV--DLSSQVKQSGVRMNSIGLMSLHFQNGLGKDSDEFELSLNIENFKKV 350

Query: 346 LTAKDVQLRIPVPPETVDCH--------ISTSNGRCKFVPEESAIIWKFSKYQGLTENSL 397
               D+++ +    E  D +        +  ++GR      E++II    + Q + + S 
Sbjct: 351 SQVDDLKIDLQFNVENADPNEIAYKIKILRNTHGRF-----ENSII--MGQGQWIFDKST 403

Query: 398 SATAVPMKDSALNID----QWSK----PPMSLKFEIVMFSNSGLVVRFFDVSEG---DRN 446
           +   VP+    +  +     ++K      +SL++  +  S SG+ V   D+  G    +N
Sbjct: 404 ATGTVPVLRGCIEYENTGPNFTKKVDLQTVSLEYSYIGQSASGIYVEAIDIVSGLTIGKN 463

Query: 447 YKMVKWIKYLSKSGAYEVR 465
            K+ K  KY +++G ++VR
Sbjct: 464 TKLYKGAKYKTQTGNFQVR 482

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/323 (21%), Positives = 126/323 (39%), Gaps = 79/323 (24%)

Query: 184 IPWRMNGI-KYKKNEVFLNVNERISILVSKDGSILK---SYVDGTVEATTHLSGMPVCRF 239
           +PWR +   K++ NE+++++ E   +++ K  + L+     + G V+  ++L+  P+   
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 240 GLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQL--DKFQSERTINFI 297
            LN                 N+  IP              H+CV++  D   +   I FI
Sbjct: 259 KLN--------------TMGNEIGIPS------------LHECVEINDDGEFTPSNITFI 292

Query: 298 PPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRIPV 357
           PPDG F L++Y +  NL+   K + +    + NSI     I   F + L     +  + +
Sbjct: 293 PPDGKFRLLEYSI--NLDSQLKKSGI----RMNSIG---MISVHFQNGLGKDSDEFELSL 343

Query: 358 PPET-----------VDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLS-------- 398
             E+           +D   +  N     V  +  I+       G  ENS++        
Sbjct: 344 NVESSKKVSQIEDLKLDLQFNIENTGGSDVAYKVKIL---RNTHGRFENSVTMGQGQWIF 400

Query: 399 -----ATAVPMKDSALNID--------QWSKPPMSLKFEIVMFSNSGLVVRFFDVSEG-- 443
                   +P+    +  D              +SL +  V  S SG+ V   D+  G  
Sbjct: 401 DKATPTGTIPVLRGCIEYDGVQPNSTRSIDLHTVSLDYSYVGQSASGISVEAIDILSGLT 460

Query: 444 -DRNYKMVKWIKYLSKSGAYEVR 465
             +N K+ K  KY +K+G ++VR
Sbjct: 461 IGKNTKLYKGAKYKTKTGDFQVR 483

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 91/231 (39%), Gaps = 66/231 (28%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISI-----LVSKDG-------------------SILKS 219
           +PWR   IK  KNE+++++ E I +     + ++ G                    ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 220 YVDGTVEATTHLSGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKF 279
           Y+ G ++  ++L+G P+    LN      T   D  +P+                     
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLN------TCGNDMGTPS--------------------L 352

Query: 280 HQCVQL------DKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSID 333
           H CV+L      D  +   ++ FIPPDG F L +Y V  N N    +         N+ D
Sbjct: 353 HPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARYCVDLNKNNKNAVG-------VNNRD 405

Query: 334 YRVTIKSLFPSKLTAK--DVQLRIPVPPETVDCHISTSNGRCKFVPEESAI 382
             + +   F + L  +  + ++R+ +   T+  HI     + KFV   SA+
Sbjct: 406 IGL-VNVTFENGLGPQRDEFEVRLNIKGSTMVEHIEDLKLKLKFVLNHSAM 455

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 71/322 (22%), Positives = 131/322 (40%), Gaps = 77/322 (23%)

Query: 184 IPWRMN-GIKYKKNEVFLNVNERISILVSKDGSILK---SYVDGTVEATTHLSGMPVCRF 239
           +PWR +   K++ NE+++++ E   ++     S L+     + GTV+  ++L+  P+   
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 240 GLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE---RTINF 296
            LN      T   D   PT                     H+CV++ K   E     I F
Sbjct: 259 KLN------TMGNDIGVPT--------------------LHECVEI-KDDGEFLPSNITF 291

Query: 297 IPPDGSFELMKYHVRENLNLP---FKITPVVTL-------FKANSIDYRVTIK-SLFPSK 345
           IPPDG F L++Y V  +  +     +I  +  +          +S ++ +++    F   
Sbjct: 292 IPPDGKFRLLEYSVDLDSQVKQSGIRINSIGLMSLHFQNGLGKDSDEFELSLNIENFKKV 351

Query: 346 LTAKDVQLRIPVPPETVDC--------HISTSNGRCKFVPEESAIIWKFSKYQGLTENSL 397
               D++L +    E  D          +  ++GR     E SA +    K Q + + + 
Sbjct: 352 SQIDDLKLDLQFNVENADAIELSYKIKILRNTHGRF----ENSAAM---GKGQWIFDKAT 404

Query: 398 SATAVPMKDSAL-----------NIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEG--- 443
           +   VP+    +           NID  +   +SL++     S SG+ V   D+  G   
Sbjct: 405 ATGTVPVLRGCIEYESVKPNGSKNIDLQT---VSLEYSYTGRSASGIYVDAIDILSGLTI 461

Query: 444 DRNYKMVKWIKYLSKSGAYEVR 465
            +N K+ K  KY +++G ++VR
Sbjct: 462 GKNTKLYKGAKYRTQTGDFQVR 483

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 69/187 (36%), Gaps = 57/187 (30%)

Query: 185 PWRMNG--IKYKKNEVFLNVNERISILVSKDGS-------------------ILKSYVDG 223
           PWR NG  I   +NE++ +V E I ++  K  S                    ++  + G
Sbjct: 226 PWR-NGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISG 284

Query: 224 TVEATTHLSGMPVCRFGLNDS-LSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQC 282
           +V+    L+G P+    L    L +  P                            FH C
Sbjct: 285 SVDMRCFLTGNPLVEIALKQGGLDIGIP---------------------------GFHDC 317

Query: 283 VQ---LDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIK 339
           V    L K +    ++FIPPDG F LM+Y    N+NL       V L  A+  D+  T+ 
Sbjct: 318 VDKTSLLKQEKISKLSFIPPDGRFTLMQY----NINLDQGKRHSVGLVHADIEDHLGTLG 373

Query: 340 SLFPSKL 346
             F   L
Sbjct: 374 DEFEVTL 380

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 4/36 (11%)

Query: 279 FHQCVQLDKF----QSERTINFIPPDGSFELMKYHV 310
            H CV+LD          T+ FIPPDG F LM+Y V
Sbjct: 287 LHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSV 322

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 29  SEIFRIQVINNLDVRSPVLTLGSTTFHHVKSPGNLWIVAVSRSNADSAAIWEFLYKLSAL 88
           S+I+++   N ++    +  LG T+FH V++  +       R N+ + A W FL KL+A 
Sbjct: 107 SDIYKVSDKNGVEKVMKIHRLGRTSFHTVRNNRDYL-----RKNSKNGANWMFLSKLAAA 161

Query: 89  LE 90
            E
Sbjct: 162 KE 163

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 14/87 (16%)

Query: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60
           ML+   ++S+ G + + K          S+I+R+   N  +    +  LG T+FH VK+ 
Sbjct: 88  MLNRETVYSVGGTIGVGKE---------SDIYRVSDRNGTEKVMKIHRLGRTSFHTVKNK 138

Query: 61  GNLWIVAVSRSNADSAAIWEFLYKLSA 87
            +       + NA +   W +L K++A
Sbjct: 139 RDYI-----KKNAKNGVNWMYLSKIAA 160

>Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W
           (IST3) - U2 snRNP associated protein [contig 135] FULL
          Length = 135

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 7/71 (9%)

Query: 55  HHVKSPGNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIV 114
           + ++S  NL    + +      A W F YK  A +   GLH +       +T  ++L I 
Sbjct: 2   NQIRSIQNLSFRELEQGILSPTASWHFEYKDQAYIFVGGLHKD-------LTEGDILTIF 54

Query: 115 LEDGVPVDTEL 125
            + G+PVD +L
Sbjct: 55  SQYGIPVDLKL 65

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 34/58 (58%)

Query: 191 IKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFGLNDSLSVS 248
           IK + N + +++ E I+  +S+DG++  + + G +E   +   +   +  L+DS++VS
Sbjct: 272 IKPENNGILISIKETINAEISRDGAVRSTELKGVMELRINDESLAHSKVTLSDSVNVS 329

>Smik_10.131 Chr10 complement(209599..209681,209864..211574) [1794
           bp, 597 aa] {ON} YJL107C (REAL)
          Length = 597

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 22/30 (73%)

Query: 242 NDSLSVSTPFGDNESPTTNKKAIPKAAAGS 271
           ND L+ S+ + D+++PTT+++ I   AAG+
Sbjct: 273 NDELNASSIYSDSQAPTTDEEGISSVAAGN 302

>KNAG0B04350 Chr2 (828924..831824) [2901 bp, 966 aa] {ON} Anc_5.400
           YHR098C
          Length = 966

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 17/93 (18%)

Query: 303 FELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLR-IPVPPET 361
           F+LMKY + ++  L FK+ P +  F           + L  + L   D   R + V P T
Sbjct: 750 FDLMKYSMFDSAKLSFKLYPQIIPFH----------EMLEETDLMFYDTNERLLQVSPTT 799

Query: 362 V------DCHISTSNGRCKFVPEESAIIWKFSK 388
           +      D H S  NG C FV + + I   F++
Sbjct: 800 IPNLSVRDGHASLMNGGCYFVFDGTHIYLWFNE 832

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,933,228
Number of extensions: 2031386
Number of successful extensions: 5824
Number of sequences better than 10.0: 93
Number of HSP's gapped: 5734
Number of HSP's successfully gapped: 129
Length of query: 466
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 353
Effective length of database: 40,524,141
Effective search space: 14305021773
Effective search space used: 14305021773
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)