Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F06512g3.164ON37037018650.0
Kwal_33.141793.164ON3743697622e-98
SAKL0C07392g3.164ON3613054873e-57
ZYRO0B04862g3.164ON4083154213e-47
TDEL0D045903.164ON3762883836e-42
NCAS0I020703.164ON4233273491e-36
Suva_4.2223.164ON4163342805e-27
KAFR0F022103.164ON3572952777e-27
Skud_4.2243.164ON4083312639e-25
Smik_4.2083.164ON4173962584e-24
YDL027C3.164ON4203362232e-19
Kpol_1045.433.164ON3823162091e-17
KLLA0C03872g3.164ON3763041763e-13
TPHA0P006703.164ON3802491122e-05
KNAG0K017303.164ON329228880.019
CAGL0K01639g3.164ON403187741.0
KNAG0A031808.635ON18240721.2
TBLA0C064905.94ON114675731.7
KLLA0F14905g5.172ON28088677.0
KAFR0C00190na 1ON707116679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F06512g
         (370 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {...   723   0.0  
Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {...   298   2e-98
SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {...   192   3e-57
ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly...   166   3e-47
TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.1...   152   6e-42
NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.1...   139   1e-36
Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON...   112   5e-27
KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.1...   111   7e-27
Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON...   105   9e-25
Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON...   103   4e-24
YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON} P...    91   2e-19
Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa] ...    85   1e-17
KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {...    72   3e-13
TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3....    48   2e-05
KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.1...    39   0.019
CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa] ...    33   1.0  
KNAG0A03180 Chr1 (395740..396288) [549 bp, 182 aa] {ON} Anc_8.63...    32   1.2  
TBLA0C06490 Chr3 (1569902..1573342) [3441 bp, 1146 aa] {ON} Anc_...    33   1.7  
KLLA0F14905g Chr6 (1378784..1379626) [843 bp, 280 aa] {ON} conse...    30   7.0  
KAFR0C00190 Chr3 complement(29379..31502) [2124 bp, 707 aa] {ON}...    30   9.2  

>KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {ON}
           weakly similar to uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 370

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/370 (95%), Positives = 354/370 (95%)

Query: 1   MLPSLGIRSGHRPFALRNLNLLTSANWPKNKGICSVIQIAKFPRQANIANFPSLASQQFL 60
           MLPSLGIRSGHRPFALRNLNLLTSANWPKNKGICSVIQIAKFPRQANIANFPSLASQQFL
Sbjct: 1   MLPSLGIRSGHRPFALRNLNLLTSANWPKNKGICSVIQIAKFPRQANIANFPSLASQQFL 60

Query: 61  IQKRSFHRDAILRSPFQNGRFPGEGKSPFKLYTFPPLLGIVALIGTIAXXXXXXXXXXXX 120
           IQKRSFHRDAILRSPFQNGRFPGEGKSPFKLYTFPPLLGIVALIGTIA            
Sbjct: 61  IQKRSFHRDAILRSPFQNGRFPGEGKSPFKLYTFPPLLGIVALIGTIALLLVVLPLVFTF 120

Query: 121 XXXXIIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSDGFA 180
               IIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSDGFA
Sbjct: 121 LFPLIIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSDGFA 180

Query: 181 AGSFRGVMDEIRSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWV 240
           AGSFRGVMDEIRSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWV
Sbjct: 181 AGSFRGVMDEIRSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWV 240

Query: 241 KKGYDLSLATDTPRIRGQSINNSLVMTISYPLYLLSSSQERKLIAYVAIGVLDDSMAGQT 300
           KKGYDLSLATDTPRIRGQSINNSLVMTISYPLYLLSSSQERKLIAYVAIGVLDDSMAGQT
Sbjct: 241 KKGYDLSLATDTPRIRGQSINNSLVMTISYPLYLLSSSQERKLIAYVAIGVLDDSMAGQT 300

Query: 301 GSFKFVEELASQNKECPMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGHRE 360
           GSFKFVEELASQNKECPMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGHRE
Sbjct: 301 GSFKFVEELASQNKECPMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGHRE 360

Query: 361 FTYRDADHNI 370
           FTYRDADHNI
Sbjct: 361 FTYRDADHNI 370

>Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {ON}
           YDL027C - Hypothetical ORF [contig 105] FULL
          Length = 374

 Score =  298 bits (762), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 162/369 (43%), Positives = 229/369 (62%), Gaps = 13/369 (3%)

Query: 1   MLPSLGIRSGHRPFALRNLNLLTSANWPKNKGICSVIQIAKFPRQANIANFPSLASQQFL 60
           ML  +GIR+ +     R    LT  + P+ +   S+I +++ P        PSL S + L
Sbjct: 13  MLHRVGIRTIYSSLHPRVPLTLTRYSRPEFRAFSSLISVSRPP------TCPSLTSPR-L 65

Query: 61  IQKRSFHRDAILR-----SPFQNGRFPGEGKSPFKLYTFPPLLGIVALIGTIAXXXXXXX 115
           I   ++  D +L+      P  N R    G  PFK     P+ GI+A +G+I+       
Sbjct: 66  ITHSNYKHDGVLKILKTPVPRINYRSLHSGPPPFKTVRISPIFGILAFLGSISLVFIVVP 125

Query: 116 XXXXXXXXXIIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLG 175
                    IIAG+AVFQFK+W++ TL+ QLHR LL +KM I+  T+ GLQ +MFESLLG
Sbjct: 126 FVFTFFFPLIIAGVAVFQFKKWKSATLMQQLHRRLLTSKMRIDRHTILGLQARMFESLLG 185

Query: 176 SDGFAAGSFRGVMDEIRSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSD 235
           S+  +A  FR  MD++ ++++D  + K  AD+ ++FLD R+LEAFK+NE G+RD+FLG+D
Sbjct: 186 SERNSAIFFRRAMDDMSARQMDDTSFKSGADDMISFLDSRILEAFKSNEQGIRDYFLGAD 245

Query: 236 ASTWVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYLLSSSQERKLIAYVAIGVLDDS 295
             TWV+ GY+LSL +D+PR  G+SI  + VMTI+YPLYLLSS+Q +KL+A V + VL DS
Sbjct: 246 VKTWVENGYELSLDSDSPRTIGKSIEGTFVMTITYPLYLLSSNQRKKLLADVTVAVLGDS 305

Query: 296 MAGQTGSFKFVEELASQNKECPMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVRTAD 355
             G+   F  ++E  + NK+CPMVISI+PAR+L   QF+L D  +  G   S Y V+T  
Sbjct: 306 TPGKPSPFFLMQENFADNKDCPMVISIKPARALNTNQFIL-DETDDNGNHPSRYTVKTTS 364

Query: 356 DGHREFTYR 364
           DGHREF YR
Sbjct: 365 DGHREFRYR 373

>SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 361

 Score =  192 bits (487), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 112/305 (36%), Positives = 172/305 (56%), Gaps = 9/305 (2%)

Query: 60  LIQKRSFHRDAILRSPFQNGRFPGEGKSPFKLYTFPPLLGIVALIGTIAXXXXXXXXXXX 119
           ++  R+ H     R+PF+ G  P    +PF+     P +   A +G ++           
Sbjct: 64  MLLSRNLHTHPPRRTPFRPG--PRPTIAPFRTS---PWVMFFAGVGLLSALFVVLPLVFT 118

Query: 120 XXXXXIIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSDGF 179
                ++AG+  +QFKRW++  L   L+R L  TK+ + Y+++ GL +    S+L  D  
Sbjct: 119 LFFPLVVAGVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRA 178

Query: 180 AAGSFRGVMDEIRSQKI-DAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDAST 238
            A  F  V++  + + +    N + R+ + LAFL+ RVLE+ +NNE G+R+FFLG+D  +
Sbjct: 179 GAELFDTVVNGRKMRDMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDS 238

Query: 239 WVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYLLSSSQERKLIAYVAIGVLDDSMAG 298
           W++ GYDL L T      G+SI   L M+++YPLYL+SS+  RKL A V+I  LD+ +A 
Sbjct: 239 WIRDGYDLQLDTRICGTTGRSIGGKLAMSVTYPLYLVSSTNRRKL-ADVSIVFLDERLAA 297

Query: 299 QTGSFKFVEELASQNKECPMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGH 358
            +G F    +LA Q++ CPMVISI P R+L  +QF++   G A G   S    RT  DGH
Sbjct: 298 GSG-FYPPGDLAGQDERCPMVISIVPVRTLVPRQFIISTPG-ASGNNASRLTQRTTRDGH 355

Query: 359 REFTY 363
           RE+TY
Sbjct: 356 REYTY 360

>ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly
           similar to uniprot|Q7LHC7 Saccharomyces cerevisiae
           YDL027C Hypothetical ORF
          Length = 408

 Score =  166 bits (421), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 101/315 (32%), Positives = 162/315 (51%), Gaps = 13/315 (4%)

Query: 61  IQKRSFHRDAILRSPFQNGRFPGEGKSPFKLYTFPPLLGIVALIGTIAXXXXXXXXXXXX 120
           I  R+FH  ++ RS    GR+P   + P +++   PL+  +A IG +             
Sbjct: 99  IFSRNFHFTSVRRS----GRYPFGNRPPLRVFKISPLVIFLASIGALTVFFLILPFMLTF 154

Query: 121 XXXXIIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSD--- 177
                + GI+V+QF++W+N TL  QL   L  ++M +N +T+  +  +       +    
Sbjct: 155 FLPLFVVGISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNP 214

Query: 178 --GFAAGSFRGVMDEIRSQKI-DAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGS 234
             G     F+GV  +++   I   AN+   AD  L+F+  RV+EA K++E G+R +FLG 
Sbjct: 215 NAGVFEEIFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGD 274

Query: 235 DASTWVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYLLSSSQERKLIAYVAIGVLDD 294
           D S W+K+GYD  L +   R   +   N ++  I YP+YL SS+  ++ +A V++ VL  
Sbjct: 275 DVSNWIKEGYDFELGSSDCRSFVRGFKNEIIFWIVYPIYLKSSTHPKRHLADVSVAVLQG 334

Query: 295 SMAGQTG-SFKFVE-ELASQNKECPMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVR 352
             A +    F  V+  L  QN +C M IS++   S+  KQFV+ D GE+ G   + Y V 
Sbjct: 335 HHAERNNYDFFLVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGES-GDFWTKYDVH 393

Query: 353 TADDGHREFTYRDAD 367
              DGH E+T R+ D
Sbjct: 394 ENSDGHTEYTIRNTD 408

>TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.164
           YDL027C
          Length = 376

 Score =  152 bits (383), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 145/288 (50%), Gaps = 7/288 (2%)

Query: 82  PGEGKSPFKLYTFPPLLGIVALIGTIAXXXXXXXXXXXXXXXXIIAGIAVFQFKRWQNTT 141
           P   + PFK+Y   P++ ++  IG +                 IIAGI  +QF +W+   
Sbjct: 88  PYPNQPPFKVYRISPIVAVLTGIGFLMLLFAVLPFIFTFFFPLIIAGICAYQFSKWKRKV 147

Query: 142 LLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSDGFAAGSFRGVMDEIRSQ---KIDA 198
           L   + R L  + M +NY TV  L  +  + ++  +   A  F  ++    +    ++D 
Sbjct: 148 LFQDILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLDK 207

Query: 199 ANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWVKKGYDLSLATDTPRIRGQ 258
            +S + AD+ L F+D R+LEA + NE G+R++FLG D   WV+  Y L L T   +   Q
Sbjct: 208 FSSAK-ADKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKTNAQ 266

Query: 259 SINNSLVMTISYPLYLLSSSQERKLIAYVAIGVLDDSMAGQTGS--FKFVEELASQNKEC 316
             +  L+M + +PLYL S+S  RK +A V++ +L     G  G+   +F+  ++  + EC
Sbjct: 267 VGDGELIMLLVFPLYLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETDAEC 326

Query: 317 PMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGHREFTYR 364
            MVI+++P  +   K FV+   G + G   S Y  +   DGH E+T +
Sbjct: 327 QMVIAVQPVTNFSTKLFVISTDGRS-GDWYSKYDSKEDSDGHTEYTVK 373

>NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.164
           YDL027C
          Length = 423

 Score =  139 bits (349), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 105/327 (32%), Positives = 161/327 (49%), Gaps = 31/327 (9%)

Query: 60  LIQKRSFHRDAILRSPFQNG---RFPGEGKSP---FKLYTFPPLLGIVALIGTIAXXXXX 113
           +I KR      IL   F +    +F G    P    K+   P +L I + +G +      
Sbjct: 107 IINKRLLCDRHILIRKFHSTPQKKFNGNEGPPNRRIKIIRIPSILLIFSSLGILIITLMI 166

Query: 114 XXXXXXXXXXXIIAGIAVFQFKRWQNTTLLGQLHRCLLAT---KMSINYKTVWGLQTQMF 170
                      +I GIA+FQF++W+  TL  QL   L       MSI Y T+  LQ ++ 
Sbjct: 167 LPLLISAFFPFLILGIALFQFRKWKQNTLYKQLLAHLKNKSKGHMSIKYSTLNSLQYKIL 226

Query: 171 ESLLGSDGFAAGSFRGVMDEIRSQKI-DAANSKRRADEALA-FLDRRVLEAFKNNELGLR 228
             +     F   S +G   +I + K+ D  NS  R  EAL   L  R++EA + +ELG+R
Sbjct: 227 NDI----SFMKNS-QGFKPDILNMKMNDFINSNARDSEALLNLLQSRIMEAIETDELGIR 281

Query: 229 DFFLGS-----DASTWVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYLLSSSQERKL 283
            +FLG+     + + WV +G D  L T     +G+ +N  ++++++Y LYL S    ++ 
Sbjct: 282 TYFLGAADNINNVTHWVNEGLDFELDTKNSISKGKLVNGEMILSVTYALYLKSLKSPKRR 341

Query: 284 IAYVAIGVLDDSMAGQTGSFKFVEELASQNKECPMVISIRPAR---SLYAK--QFVLKDY 338
           IA V+I VLD+S+  +   F  + +LA  NK CPMV +I+P +   SL  +  QF+L DY
Sbjct: 342 IAEVSIVVLDESVE-KNHVFISINDLAKTNKSCPMVFAIKPVKIDLSLLLQPFQFILDDY 400

Query: 339 GEARGKPTSAYYVRTADDGHREFTYRD 365
           G +     S Y V     G+REF  R+
Sbjct: 401 GRS----GSNYDVYNTKSGNREFRLRE 423

>Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON}
           YDL027C (REAL)
          Length = 416

 Score =  112 bits (280), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 88/334 (26%), Positives = 145/334 (43%), Gaps = 34/334 (10%)

Query: 60  LIQKRSFHRDAILRSPFQNGRFPGEGKSPF-KLYTFPPLLGIVALIGTIAXXXXXXXXXX 118
           L  KR+FH     +  F   R P  G  P  K+Y   PLL +   +              
Sbjct: 89  LTNKRAFHSSPHAQIKFMFSRSPKNGDKPIVKIYKVSPLLILFTTVSLFTFILTSTMIVI 148

Query: 119 XXXXXXIIAGIAVF----QFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQ-MFESL 173
                     + +F    QFKRWQ       +   L  T++ I   T+  LQ Q M +S 
Sbjct: 149 PFIFHFFFPFLIMFIFFKQFKRWQKNVFYKDILNSLPRTELKITVPTMRSLQMQPMIQSW 208

Query: 174 LGSDGFAAGSFRGVMDEI-RSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFL 232
                    S  G+ +E  +   +D         + L+FL++RVLE+F  NE+G+R +FL
Sbjct: 209 KD-----ISSRMGIPNEFAKGLNVDLVKQDETRKQFLSFLEKRVLESFTKNEMGIRSYFL 263

Query: 233 GSDASTWVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYL-------LSSSQE---RK 282
           G +   W+K+ YDL L  +  R   +   +S+  ++ Y LYL       L+ S++   +K
Sbjct: 264 GDNVEKWIKESYDLELDIENCRSELRKFQDSIFASVQYKLYLDSMKDLPLNPSKKFEGKK 323

Query: 283 LIAYVAIGVLDDSMA---------GQTGSFKFVE--ELASQNKECPMVISIRPARSLYAK 331
            +A V + +LD S            +   FK ++  E A+ NK    +I+++   +  + 
Sbjct: 324 HLADVYVIILDKSFPEIMFNGGGYSKADFFKILQESETANSNKMHNTIIAVKSVNTPLSH 383

Query: 332 QFVLKDYGEARGKPTSAYYVRTADDGHREFTYRD 365
            F++   G++ G   S Y+V   D  H E+T R+
Sbjct: 384 HFIITAKGDS-GDFFSKYHVSKVDGKHTEYTLRE 416

>KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.164
           YDL027C
          Length = 357

 Score =  111 bits (277), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 96/295 (32%), Positives = 142/295 (48%), Gaps = 42/295 (14%)

Query: 82  PGEGKSP----FKLYTFPPLLG--IVALIGTIAXXXXXXXXXXXXXXXXIIAGIAVFQFK 135
           P E K P    +++ T   LLG  +V L+ T+                 II GI ++Q++
Sbjct: 93  PFEDKEPRVRIYRITTLNLLLGSAVVLLLSTMILPILLKLIFPM-----IILGIFIYQYR 147

Query: 136 RWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSDGFAAGSFRGVMDEIRSQK 195
            W+ T L  Q+ R L  T +SI YKT+  LQ      +L          + V     + +
Sbjct: 148 IWKRTKLFDQIFRGLGRTNLSIKYKTLNSLQYNYVPKILK---------KSVPKSWYTNE 198

Query: 196 IDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWVKKGY---DLSLATD- 251
            D ++    A+  L+F+  RV+EAFK NE+G+ D+FL        ++G    DLSL  D 
Sbjct: 199 -DISD----AEILLSFIKLRVIEAFKKNEMGISDYFL--------RRGQNFDDLSLLIDK 245

Query: 252 -TPRIRGQSINNSLVMTISYPLYLLSSSQERKLIAYVAIGVLDDSMAGQTGSFKFVEELA 310
              +   + +  + ++T+ + L LL +      +A V I VLDDS   QTG F  ++ELA
Sbjct: 246 ENSQFLIRRLAGNFIVTMRHQL-LLKNENVDIYLADVMISVLDDS--SQTGIFMPLKELA 302

Query: 311 SQNKECPMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGHREFTYRD 365
             NK C MVIS+     +  +QFV+ D GE  GK    + V    DGHREF   D
Sbjct: 303 KSNKSCKMVISVVSNSDILPRQFVITDEGET-GKFYGKFTVSHGKDGHREFRIDD 356

>Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON}
           YDL027C (REAL)
          Length = 408

 Score =  105 bits (263), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 90/331 (27%), Positives = 141/331 (42%), Gaps = 35/331 (10%)

Query: 63  KRSFHRDAILRSPFQ-NGRFPGEGKSPF-KLYTFPPLLGIVALIGTIAXXXXXXXXXXXX 120
           KR+FH  A     F  + R P  G  P  K+Y   P   I A                  
Sbjct: 83  KRTFHSSARAEIKFMFSSRSPKNGDKPLVKIYKVSPFFIIFATASLFTFILTSTIIVIPF 142

Query: 121 XXXXIIAGIAVF----QFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQ-MFESLLG 175
                   + +F    QFK+WQ       +   L  T++ I   T+  LQ Q M +S   
Sbjct: 143 VLHFFFPLLIIFIFFKQFKKWQKNIFYKDILSSLPRTELKIAVPTMRSLQLQPMVQSWKD 202

Query: 176 SDGFAAGSFRGVMDEI-RSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGS 234
                  S  G+ +E  +   +D         + L+FL +RVLE+F  NE+G+R +FLG 
Sbjct: 203 -----ISSRMGIPNEFAKGLNVDLVKQNETRKQFLSFLQKRVLESFTKNEMGVRSYFLGD 257

Query: 235 DASTWVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYL-------LSSSQE---RKLI 284
           +   W++  YDL L  D+ R   +    S+  ++ Y LYL       LS S+    ++ I
Sbjct: 258 NVEKWIENSYDLELDIDSCRSELRKFQESIFSSVRYKLYLDSMKNSPLSPSKNLEGKRHI 317

Query: 285 AYVAIGVLDDSMA---------GQTGSFKFVE--ELASQNKECPMVISIRPARSLYAKQF 333
           A V + +LD+S            +   FK ++  E A+ +K   M+I+I+   +  +K F
Sbjct: 318 ADVYVIILDESFPEIMFNGGGYSKADFFKILQESETANSSKTHNMIIAIKSVNTPLSKHF 377

Query: 334 VLKDYGEARGKPTSAYYVRTADDGHREFTYR 364
           V+   G++ G   S Y +   D  H E+T R
Sbjct: 378 VITAKGDS-GDFFSKYQISNVDGSHTEYTLR 407

>Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON}
           YDL027C (REAL)
          Length = 417

 Score =  103 bits (258), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 113/396 (28%), Positives = 179/396 (45%), Gaps = 56/396 (14%)

Query: 1   MLPSLG--IRSGHRPFALRNLNLLTSANWPKNKGICSVIQIAKFPRQANIANFPSLASQQ 58
           + PS+    R G +P   R +  L S+N+      CS       P Q  ++N  SL+S+ 
Sbjct: 47  IFPSISKYAREGFQP---RRIFSLMSSNY------CSC------PHQF-LSNSMSLSSK- 89

Query: 59  FLIQKRSFH--RDAILRSPFQNGRFPGEGKSPFKLYTFPP--LLGIVALIGTIAXXXXXX 114
            LI KR+FH  R A ++  F +       K   K+Y   P  +L   A I T        
Sbjct: 90  -LISKRAFHSTRHAEIKFSFFSRSHRNNNKPFVKVYKVSPFFILFATASIFTFILTSTII 148

Query: 115 XXXXXXXXXXIIAGIAVF--QFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQ-MFE 171
                      +  + VF  QFK+WQN T    +   L  T++ I   T+  LQ Q M +
Sbjct: 149 VIPFIFHFFFPLLIMLVFFKQFKKWQNNTFYKDILISLPKTELKITVPTMRSLQLQPMIQ 208

Query: 172 SLLGSDGFAAGSFRGVMDEI-RSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDF 230
           S          S  G+ +E  +   +D         + L+FL +RVLE+F  NE+G+R +
Sbjct: 209 SWR-----EISSRMGIPNEFAKGLNVDLEKQDETRKQFLSFLQKRVLESFTKNEMGIRSY 263

Query: 231 FLGSDASTWVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYL-------LSSSQE--- 280
           FLG     W+++ YDL L  D  R   +   N +  ++ Y LYL       L+ S++   
Sbjct: 264 FLGDRVEKWIEESYDLELDIDNCRSELRKFQNFVFSSVRYRLYLDSIKKLPLNPSKKFEG 323

Query: 281 RKLIAYVAIGVLDDS-----MAGQTGS----FKFV--EELASQNKECPMVISIRPARSLY 329
           +K IA V + +LD+S      +G+  S    FK +   E A+ +K   M+I+I+    L 
Sbjct: 324 KKHIADVYVIILDESFPEIMFSGEGYSKADFFKILRESETANSSKMLNMIIAIKSVNPL- 382

Query: 330 AKQFVLKDYGEARGKPTSAYYVRTADDGHREFTYRD 365
           +  FV+   G++ G   S Y++   D  + E+T R+
Sbjct: 383 SSHFVITANGDS-GNFFSKYHITKIDGKNTEYTLRE 417

>YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON}
           Putative protein of unknown function; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies; YDL027C is not
           an essential gene
          Length = 420

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 88/336 (26%), Positives = 147/336 (43%), Gaps = 37/336 (11%)

Query: 60  LIQKRSFH--RDAILRSPFQNGRFPGEGKSPF-KLYTFPPLLGIVALIGTIAXXXXXXXX 116
           L+ KR+FH  R A ++  F + + P  G  PF K+Y   P   I A              
Sbjct: 92  LVGKRAFHSSRRAEIKFIF-SSKSPKNGNKPFVKVYKVSPFFIIFATASIFTFILTSTIV 150

Query: 117 XXXXXXXXIIAGIAVFQFKRWQNTTLLGQLHRCLLA----TKMSINYKTVWGLQTQ-MFE 171
                       + +F F +          ++ +L     TK+ I   T+  LQ Q M +
Sbjct: 151 VIPLIFHFFFPLLIMFFFFKQFKKWQKNIFYKDVLTSLPKTKLKITLPTMRSLQLQPMVQ 210

Query: 172 SLLGSDGFAAGSFRGVMDEI-RSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDF 230
           S          S  G+ +E  +   +D    +    + L+FL +RVLE+F  NELG+R +
Sbjct: 211 SWK-----EISSRMGIPNEFAKGLNVDLVKQEETRKQFLSFLQKRVLESFTKNELGIRSY 265

Query: 231 FLGSDASTWVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYL-------LSSSQE--- 280
           FLG     W+K+ YDL L  D  R   +     +  ++ Y LYL       L+ S++   
Sbjct: 266 FLGDSVEKWIKESYDLELDIDNCRSELRKFQTFIFSSVRYKLYLDSMKNLPLNPSKKLEG 325

Query: 281 RKLIAYVAIGVLDDSMAG---------QTGSFKFVEELASQN--KECPMVISIRPARSLY 329
           +K IA V + +LD+S            +   FK ++E  + N  K    +I+I+   +L 
Sbjct: 326 KKHIADVYVIILDESFPAIMFNGGAYSKADFFKILQESETSNSSKTLNTIIAIKSVNTLL 385

Query: 330 AKQFVLKDYGEARGKPTSAYYVRTADDGHREFTYRD 365
           +K FV+   G++ G+  S Y +   +D + E+T ++
Sbjct: 386 SKHFVITTNGDS-GEFFSKYNISKINDKNTEYTLKE 420

>Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa]
           {ON} complement(101544..102692) [1149 nt, 383 aa]
          Length = 382

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/316 (25%), Positives = 140/316 (44%), Gaps = 36/316 (11%)

Query: 71  ILRSPFQNGR-----FPGEGKSP-FKLYTFPPLLGIVALIGTIAXXXXXXXXXXXXXXXX 124
           ILR+ F  GR     F   GK P F+++  P L+ +  +  T A                
Sbjct: 76  ILRNNFHQGRPLSNMFNDFGKPPKFRVFVVPNLIILAGMTLTFALFLMVIPILFSFFFPL 135

Query: 125 IIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSDGFAAGSF 184
           +I  I   QFKRW+   ++ +    L  + +     T++ + T+  E +L ++    GS+
Sbjct: 136 LILFIGFHQFKRWRANRMINKWFDGLKNSHLRTRMSTMYAIHTKNLEEMLHNEAKQFGSY 195

Query: 185 RGVMDE-IRSQKIDAA--NS---KRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDAST 238
            G+ +E + + K++    NS       ++   F++ RV+EA   NE G+R         T
Sbjct: 196 GGIFNETLNAMKMNPMYKNSIEFNESGEKLRNFIEYRVIEAIYKNEEGIR---------T 246

Query: 239 WVKKGYDLSL--ATDTP-RIRGQSINN--------SLVMTISYPLYLLSSSQERKLIAYV 287
            +   Y+ +L    D P R+   ++N+        SL+ +++YPLY     +   ++ YV
Sbjct: 247 TLFHNYEKALDPNIDKPFRLDFNNVNSFQRFEKDGSLISSVTYPLYTNLKDKPAVVVGYV 306

Query: 288 AIGVLDDS-MAGQTGSFKFVEELASQNKECPMVISIRPARSLYAKQFVLKDYGEARGKPT 346
           +I  ++D  +    GS    +     +K+   +ISIR    +    F++   GE  GK  
Sbjct: 307 SIVTMNDHPLRINLGSGDIPK--VDLSKKLKFIISIRSPSEMIPNYFIIDTVGET-GKIF 363

Query: 347 SAYYVRTADDGHREFT 362
           S Y V    DGH E+T
Sbjct: 364 SHYSVGKTTDGHNEYT 379

>KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 376

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 82/304 (26%), Positives = 123/304 (40%), Gaps = 28/304 (9%)

Query: 68  RDAILRSPFQNGRFPGEGKSPFKLYTFPPLLGIVALIGTIAXXXXXXXXXXXXXXXXIIA 127
           RD   +SPF N RF       F +  F  +L  +   G I                 +I 
Sbjct: 92  RDPFRKSPFNNPRFI------FSISPFSFILSTLLFAGFITMIVFVLPFLLALLFPMVIF 145

Query: 128 GIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGL-QTQM------FESLLGSDGFA 180
           GI  +QFK ++   L+  L      TKM ++  T   L   QM      F  L    GF 
Sbjct: 146 GIGWYQFKAFRTRKLMQLLDHAFNQTKMKLSSTTRRELIMKQMVPKFKSFTQLKDFSGFP 205

Query: 181 AGSFRGVMDEIRSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWV 240
               +   D+ +S +         AD  L+F+  R+ E+F  NE  ++   LGSD  T  
Sbjct: 206 FKLSQAFTDKFQSGEFP------NADRFLSFVKSRLDESFYKNEHNIKSIVLGSD--TAY 257

Query: 241 KKGYDLSLATDTPRIRGQSINNSLVMTISYPLYLLSSSQERKLIAYVAIGVLDDSMAGQT 300
             G+ + L T++        NN  +   S+ L  + S   RK +A V I  +  +  G  
Sbjct: 258 VPGH-MELVTNSYSFVSSVRNNENIQAFSFMLLNMGSEGVRKPVALVYI--VTKANPGDE 314

Query: 301 GSFKFVEELASQNKECPMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGHRE 360
               F  +    +K  PMVI +R A S ++K   + D GE      + Y V+   DG +E
Sbjct: 315 -LLMFTGDYIDDSKLSPMVIYVR-ALSPFSKCCFITDVGETGA--NAQYSVKRKKDGSKE 370

Query: 361 FTYR 364
           +TY 
Sbjct: 371 YTYE 374

>TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3.164
           YDL027C
          Length = 380

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 98/249 (39%), Gaps = 23/249 (9%)

Query: 63  KRSFHRDAILRSPFQNGRFPG-EGKSPFKLYTFPPLLGIVALIGTIAXXXXXXXXXXXXX 121
           KR FH+       +  G+ P  EG++P  ++   P+   +  +                 
Sbjct: 86  KRHFHQSHY--KLYSMGKRPFFEGRTPVTIFRLTPMKIFLFALTFYVMIFLLVPFILSIL 143

Query: 122 XXXIIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFES--------L 173
               I G A FQ+++W+    L      L+ T+M   + T  GL+  +  S        +
Sbjct: 144 LPAAILGYAFFQYRKWRLNCALKLWVNSLMKTQMHTKFSTFNGLRYSIINSVEKDARSQV 203

Query: 174 LGSDGFAAGS-FRGVMDEIRSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFL 232
            G      G  FR + D  R    +A      +D+   F++ RVLEAF ++E G+R   L
Sbjct: 204 FGFTNTPNGPIFRAMNDMTRDLSTEA------SDKFKKFIEARVLEAFVSDEDGVRS-AL 256

Query: 233 GSDASTW---VKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYLLSSSQERKLIAYVAI 289
            SD  TW   +K    L +       R     +   MT ++PL + S S  +  +  V+I
Sbjct: 257 ASD-HTWKQAIKTSRPLGIEFGRMVERSFVARDKKYMTYAFPLSINSPSGSQSHLGRVSI 315

Query: 290 GVLDDSMAG 298
                  AG
Sbjct: 316 VACHPLSAG 324

>KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.164
           YDL027C
          Length = 329

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 45/228 (19%), Positives = 96/228 (42%), Gaps = 44/228 (19%)

Query: 125 IIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSDGFAAGSF 184
           I+  I V+QFK+WQ   L  +L + L  + +       +  ++Q F SL  S G  +   
Sbjct: 124 ILVAIIVYQFKKWQRNQLYSRLMKYLPKSDL-------YTTKSQ-FMSLRRSFGLLSN-- 173

Query: 185 RGVMDEIRSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWVKKG- 243
               + +  + ++  N          F+  R++EA   + + +R   +     +W+ K  
Sbjct: 174 ----EAVVGKSVEFTN----------FVKTRIMEALAKDTMKIRSTLIK---PSWIPKNA 216

Query: 244 ----YDLSLATDTPRIRGQSI--NNSLVMTISYPLYLLSSSQER----KLIAYVAIGVLD 293
               Y L++  +  ++  +++   +  V ++ YPL+ ++  ++R     L+  V +  L 
Sbjct: 217 AVEEYQLTIGLNRVKMFAKALQGQSKAVFSVEYPLFFVTKLEDRTKQSHLMGKVCLHFLY 276

Query: 294 DSMAGQTGSFK------FVEELASQNKECPMVISIRPARSLYAKQFVL 335
           D  +    S K        +++     +   VIS+    +L  K F+L
Sbjct: 277 DYSSILKNSAKSFDPETLFKQMNDTESKVQYVISVIQTGTLSPKPFIL 324

>CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa]
           {ON} weakly similar to uniprot|Q07349 Saccharomyces
           cerevisiae YDL027c
          Length = 403

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 35/187 (18%), Positives = 75/187 (40%), Gaps = 21/187 (11%)

Query: 61  IQKRSFHRDAILRSPFQNGRFPGEGKSPFKLYTFPPLLGIVALIGTIAXXXXXXXXXXXX 120
           + KR F+  +     F   +   +  +  K Y+ P  + I++ IG               
Sbjct: 97  VLKRGFYTTSKKSIKFIFSKGDKDNHNKMKYYSIPTPVVILSTIGGFVLLFTILPFLFTF 156

Query: 121 XXXXIIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSDGFA 180
               +I  I  FQF+RW+   L  ++   L  +++++    +  L+ ++ E  L      
Sbjct: 157 GFPFLIGMIVFFQFRRWKTHQLYKKMAEVLQDSQINMKNNQLMSLKYRLIEQGL------ 210

Query: 181 AGSFRGVMDEIRSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWV 240
                 ++    ++     +S  R +  +  L +R+ E+F NN+         + A+ +V
Sbjct: 211 -----PMLTNFSNKTTKQLSS--RGETLINQLQQRIKESFANND--------NNIANVFV 255

Query: 241 KKGYDLS 247
            +G+ LS
Sbjct: 256 PQGHKLS 262

>KNAG0A03180 Chr1 (395740..396288) [549 bp, 182 aa] {ON} Anc_8.635
           YOR215C
          Length = 182

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 25/40 (62%)

Query: 161 TVWGLQTQMFESLLGSDGFAAGSFRGVMDEIRSQKIDAAN 200
           TV GL+T + ++++  D     + RG++  I+++ IDA +
Sbjct: 27  TVAGLKTDLKQAMINKDDVRKTTIRGILSSIKNKTIDAKD 66

>TBLA0C06490 Chr3 (1569902..1573342) [3441 bp, 1146 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1146

 Score = 32.7 bits (73), Expect = 1.7,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 209 LAFLDRRVLEAFKNNELGLRDFFLGSDASTWVKKGYDLSLATDTPRIRGQS-INNSLVMT 267
           L+F D++ LE F N E   ++  L SD S +V +     +  D+ R    S +NNS V+ 
Sbjct: 461 LSFSDQKNLEDFFNTEDRFKNSALPSDESEFVVENKLDPIMDDSIRYNFDSKLNNSDVLN 520

Query: 268 ISYPLYLLSSSQERK 282
           +S  +Y  S+  E +
Sbjct: 521 LSDSIYEFSTDDEEQ 535

>KLLA0F14905g Chr6 (1378784..1379626) [843 bp, 280 aa] {ON}
           conserved hypothetical protein
          Length = 280

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 11/88 (12%)

Query: 195 KIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWVKKGYDLSLATDTPR 254
           KI+  + K    +    +++ V E  K   L L  F LG D   W+++           R
Sbjct: 199 KIEIFSDKENEQDYKEHIEKSVKEVSK---LDLNKFVLGKDGENWIEEA--------NSR 247

Query: 255 IRGQSINNSLVMTISYPLYLLSSSQERK 282
           ++  ++NN L   +++  Y    +QE+K
Sbjct: 248 VKINTVNNLLRSEMAHFRYERVPAQEKK 275

>KAFR0C00190 Chr3 complement(29379..31502) [2124 bp, 707 aa] {ON}
           YLL051C
          Length = 707

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 53/116 (45%), Gaps = 6/116 (5%)

Query: 129 IAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFES----LLGSDGFAAGSF 184
           I V + K+   + L  +L     A +M ++ +  +G    ++ S    LL       G  
Sbjct: 490 IIVLRVKKGATSHLFKKLIANNGAIEMRVSLEGPYGSSAPVYHSDDILLLAGGSGVPGPL 549

Query: 185 RGVMDEIRSQKIDAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWV 240
             +++ +   K+D   SK+     +A   +++L+A++N  + L+D  +G D   +V
Sbjct: 550 AHLINLVNENKLDLVQSKKSIKFVIATRGKKILQAYQNEIMKLKD--VGLDIELYV 603

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,123,626
Number of extensions: 1336827
Number of successful extensions: 2753
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2783
Number of HSP's successfully gapped: 25
Length of query: 370
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 259
Effective length of database: 40,753,473
Effective search space: 10555149507
Effective search space used: 10555149507
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)