Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F06490g3.161ON39139120100.0
SAKL0C07370g3.161ON39139119350.0
Kpol_479.253.161ON39139118900.0
TDEL0D046103.161ON39139118880.0
KLLA0C03850g3.161ON39139118870.0
Suva_4.2203.161ON39139118710.0
YDL029W (ARP2)3.161ON39139118700.0
Skud_4.2223.161ON39139118670.0
CAGL0K01595g3.161ON39139118620.0
NDAI0G029003.161ON39139118600.0
ADR316W3.161ON39139118560.0
NCAS0C035503.161ON39239118560.0
Smik_4.2063.161ON39139118540.0
TPHA0A009203.161ON39139118510.0
Ecym_52373.161ON39139118500.0
KNAG0K01130na 1ON39339318450.0
ZYRO0B04928g3.161ON39139118340.0
TBLA0F008703.161ON39139118280.0
Kwal_33.141773.161ON33733716890.0
KAFR0C01040na 1ON33733716030.0
NDAI0G030408.23ON3753778501e-111
NCAS0C037008.23ON3753778501e-111
TBLA0C004408.23ON3753778491e-111
Ecym_15208.23ON3763778491e-111
TPHA0D002508.23ON3753778481e-111
TDEL0C004708.23ON3753778471e-111
CAGL0K12694g8.23ON3753778471e-111
Suva_6.188.23ON3753778471e-111
Smik_6.398.23ON3753778471e-111
YFL039C (ACT1)8.23ON3753778471e-111
KNAG0L002508.23ON3753778471e-111
KAFR0D009408.23ON3753778471e-111
ZYRO0F02772g8.23ON3753778451e-110
ABR222W8.23ON3763778441e-110
Kpol_1058.158.23ON3753778431e-110
KLLA0D05357g8.23ON3753778421e-110
KLTH0G18832g8.23ON3753778421e-110
SAKL0B00968g8.23ON3753778411e-110
Skud_6.318.23ON3603688191e-107
Kwal_14.11098.23ON3603688141e-106
SAKL0E11814g2.117ON3793847018e-89
AFR051W2.117ON4053846761e-84
Ecym_63852.117ON3773876705e-84
Kpol_1023.188.23ON3192906645e-84
KLTH0B05940g2.117ON3833866706e-84
KLLA0E22925g2.117ON3803906566e-82
NCAS0B071302.117ON3813766374e-79
ZYRO0G05676g2.117ON3813886313e-78
Kwal_33.146422.117ON3833866297e-78
TBLA0B010702.117ON3833776158e-76
KAFR0F005902.117ON3863766159e-76
YHR129C (ARP1)2.117ON3843765834e-71
Suva_15.3262.117ON3843775783e-70
TDEL0B048102.117ON3733775712e-69
Smik_8.2102.117ON3843765704e-69
Skud_8.1902.117ON3843765696e-69
TPHA0I013002.117ON3793865688e-69
NDAI0B044602.117ON3813845591e-67
KNAG0H036502.117ON3873845296e-63
CAGL0H09042g2.117ON3873804633e-53
Kwal_27.99581.514ON4454384403e-49
KLTH0C02508g1.514ON4514444394e-49
SAKL0D12804g1.514ON4564494386e-49
KNAG0B001701.514ON4534464351e-48
TPHA0O010401.514ON4584504324e-48
YJR065C (ARP3)1.514ON4494424308e-48
Smik_10.3551.514ON4494424308e-48
KAFR0D037001.514ON4494424281e-47
CAGL0F00517g1.514ON4544474272e-47
Skud_10.2891.514ON4494414272e-47
Suva_12.1541.514ON4494424263e-47
KLLA0B13904g1.514ON4564494254e-47
Ecym_31531.514ON4584504248e-47
AFR419C1.514ON4554484231e-46
TDEL0F004701.514ON4614534231e-46
NCAS0A122701.514ON4544474184e-46
Kpol_1056.161.514ON4603574152e-45
NDAI0A039701.514ON4624574124e-45
TBLA0D036801.514ON4583564098e-45
ZYRO0G01936g1.514ON4613564012e-43
SAKL0H17138g8.258ON4193712092e-17
TDEL0F038508.258ON4193852073e-17
Skud_10.1321.287ON4881892084e-17
NDAI0G055801.287ON5151912059e-17
KLTH0G13772g8.258ON4203782031e-16
Suva_6.1541.287ON4892312013e-16
NCAS0B060601.287ON4972932004e-16
YJL081C (ARP4)1.287ON4892311986e-16
KLLA0F19063g8.258ON4153681977e-16
KAFR0B027008.258ON4203721951e-15
Smik_10.1611.287ON4892951952e-15
ZYRO0C01738g8.258ON4143621932e-15
Kwal_56.238328.258ON4193791923e-15
AFR105C1.287ON4792921899e-15
Kpol_543.368.258ON4273741889e-15
KNAG0B019201.287ON5052031862e-14
TPHA0A018308.258ON4213691853e-14
CAGL0M03201g1.287ON4932031827e-14
KLTH0H09702g1.287ON4811981801e-13
TDEL0D015501.287ON4801891773e-13
KAFR0A015601.287ON4851871754e-13
AGR091W8.258ON4103891755e-13
Smik_12.1448.258ON4383861745e-13
Kpol_282.41.287ON5012071739e-13
KLLA0D02288g1.287ON5201891731e-12
CAGL0L12166g8.258ON4213711711e-12
ZYRO0G21428g1.287ON4831981702e-12
TPHA0I010301.287ON5032081684e-12
KNAG0G020108.258ON4243921674e-12
Ecym_43128.258ON4113681674e-12
NDAI0B019608.258ON4392461674e-12
Skud_12.1538.258ON4383861675e-12
NCAS0B049908.258ON4203791641e-11
Kwal_14.23771.287ON4811821632e-11
TBLA0D053601.287ON5961541613e-11
Ecym_63301.287ON4801811552e-10
SAKL0D05874g1.287ON4972741515e-10
YLR085C (ARP6)8.258ON4381801515e-10
Suva_14.2812.248ON7552351482e-09
Suva_10.1698.258ON4381801452e-09
Smik_14.2672.248ON7552411444e-09
Skud_14.2722.248ON7552341427e-09
KAFR0J011602.248ON7512331419e-09
TBLA0H014608.258ON4421881373e-08
KLLA0F03421g2.248ON7471991373e-08
KLTH0G09482g2.248ON7452311373e-08
ZYRO0A01584g2.248ON7481341365e-08
NCAS0G030502.248ON7432351356e-08
YNL059C (ARP5)2.248ON7552391321e-07
NDAI0D010602.248ON7532301268e-07
TPHA0C031602.248ON7551341268e-07
Kwal_23.48482.248ON7452821251e-06
TBLA0E038602.248ON7592351232e-06
TDEL0C041402.248ON7492321151e-05
SAKL0E08602g2.248ON7472311123e-05
KNAG0I018602.248ON7531391062e-04
Kpol_1003.162.248ON7492361034e-04
CAGL0J10054g2.248ON7541381025e-04
Ecym_32852.248ON746134980.002
SAKL0H17358g8.251ON311250950.003
ADL253C2.248ON751139930.008
TBLA0H028002.593ON484423910.010
Kpol_520.117.448ON488358890.018
KAFR0K021507.448ON490185870.033
Kpol_543.105.477ON876242850.059
KLLA0F11913g8.251ON25398820.084
TPHA0N014302.593ON472193830.10
Skud_15.3045.477ON883153810.18
Smik_15.3205.477ON873128780.44
Suva_13.2022.593ON467239770.55
NDAI0A013007.448ON565200770.55
KLTH0D08624g2.593ON432234750.82
Ecym_35058.251ON305223731.5
Ecym_23115.477ON775150731.6
NCAS0A147207.448ON485129731.7
SAKL0F13772g7.448ON42293721.9
YOR141C (ARP8)5.477ON88187731.9
TPHA0N01730na 2ON41075722.0
AAR103C3.473ON87870704.3
Skud_16.3217.448ON479194686.9
Suva_16.3647.448ON480194687.1
CAGL0F05907g2.593ON462190678.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F06490g
         (391 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...   778   0.0  
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...   749   0.0  
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...   732   0.0  
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...   731   0.0  
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...   731   0.0  
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...   725   0.0  
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...   724   0.0  
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...   723   0.0  
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...   721   0.0  
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...   721   0.0  
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...   719   0.0  
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...   719   0.0  
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...   718   0.0  
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...   717   0.0  
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...   717   0.0  
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...   715   0.0  
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...   711   0.0  
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...   708   0.0  
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...   655   0.0  
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...   622   0.0  
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   332   e-111
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   332   e-111
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   331   e-111
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   331   e-111
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   331   e-111
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   330   e-111
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   330   e-111
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   330   e-111
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   330   e-111
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   330   e-111
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   330   e-111
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   330   e-111
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   330   e-110
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   329   e-110
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   329   e-110
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   328   e-110
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   328   e-110
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   328   e-110
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   320   e-107
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...   318   e-106
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...   274   8e-89
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...   265   1e-84
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...   262   5e-84
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...   260   5e-84
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...   262   6e-84
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...   257   6e-82
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...   249   4e-79
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...   247   3e-78
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...   246   7e-78
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...   241   8e-76
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...   241   9e-76
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...   229   4e-71
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...   227   3e-70
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...   224   2e-69
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...   224   4e-69
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...   223   6e-69
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...   223   8e-69
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...   219   1e-67
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...   208   6e-63
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...   182   3e-53
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...   174   3e-49
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...   173   4e-49
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...   173   6e-49
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...   172   1e-48
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....   171   4e-48
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...   170   8e-48
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...   170   8e-48
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...   169   1e-47
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...   169   2e-47
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...   169   2e-47
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...   168   3e-47
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...   168   4e-47
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...   167   8e-47
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...   167   1e-46
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...   167   1e-46
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...   165   4e-46
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....   164   2e-45
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514    163   4e-45
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...   162   8e-45
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...   159   2e-43
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...    85   2e-17
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...    84   3e-17
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    85   4e-17
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    84   9e-17
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...    83   1e-16
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    82   3e-16
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    82   4e-16
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    81   6e-16
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...    80   7e-16
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...    80   1e-15
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    80   2e-15
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...    79   2e-15
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...    79   3e-15
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    77   9e-15
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...    77   9e-15
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    76   2e-14
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...    76   3e-14
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    75   7e-14
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    74   1e-13
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    73   3e-13
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    72   4e-13
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...    72   5e-13
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...    72   5e-13
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    71   9e-13
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    71   1e-12
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...    70   1e-12
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    70   2e-12
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    69   4e-12
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...    69   4e-12
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...    69   4e-12
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...    69   4e-12
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...    69   5e-12
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...    68   1e-11
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    67   2e-11
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    67   3e-11
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    64   2e-10
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    63   5e-10
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...    63   5e-10
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    62   2e-09
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...    60   2e-09
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    60   4e-09
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    59   7e-09
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    59   9e-09
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...    57   3e-08
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    57   3e-08
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    57   3e-08
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    57   5e-08
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    57   6e-08
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    55   1e-07
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    53   8e-07
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    53   8e-07
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    53   1e-06
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    52   2e-06
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    49   1e-05
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    48   3e-05
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    45   2e-04
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    44   4e-04
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    44   5e-04
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    42   0.002
SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa] ...    41   0.003
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    40   0.008
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    40   0.010
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    39   0.018
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    38   0.033
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...    37   0.059
KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa] ...    36   0.084
TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2....    37   0.10 
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...    36   0.18 
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...    35   0.44 
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    34   0.55 
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    34   0.55 
KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} simila...    33   0.82 
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    33   1.5  
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...    33   1.6  
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    33   1.7  
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    32   1.9  
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...    33   1.9  
TPHA0N01730 Chr14 complement(369871..371103) [1233 bp, 410 aa] {...    32   2.0  
AAR103C Chr1 complement(527960..530596) [2637 bp, 878 aa] {ON} S...    32   4.3  
Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034...    31   6.9  
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    31   7.1  
CAGL0F05907g Chr6 (591411..592799) [1389 bp, 462 aa] {ON} simila...    30   8.8  

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/391 (96%), Positives = 379/391 (96%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA
Sbjct: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE
Sbjct: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/391 (91%), Positives = 374/391 (95%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD  TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA++ TPLKDIMIGDEA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAFY+QMKLPSTSGGKV+LTEPPMNPLRNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTKR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL YVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           ENYELPDGRVIKVGSERFEAPECLFQP+LVDVEQPGVGEMLFNT+QAADVDVR+ALYRA+
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           ANIMADKDHMWL+KQEWQEMGP+AMSKFGPR
Sbjct: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/391 (89%), Positives = 367/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD  +PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA++ TPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAFY+QMKLPSTSGGKV+LTEPPMNPL+NRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDT+LARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           E YELPDGR+IKVG ERFEAPECLFQPNLVDVE  GVGE+LFNTIQ+ADVDVRS+LY+AI
Sbjct: 241 EKYELPDGRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL  DPSRL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNKDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           ANIMADKDHMWLSKQEWQE GP+AMSKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/391 (89%), Positives = 366/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD   PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEERANV TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAF+DQMKLP+TS GK++LTEPPMNP++NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEK+ YVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           ENYELPDGRVIKVG ERFEAPECLFQP+LVDVEQ GVGE+LFNTIQ ADVD+RSALYRAI
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL ND SRL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDASRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           ANIMADKDHMWLSKQEWQE GP+AM+KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMAKFGPR 391

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/391 (88%), Positives = 369/391 (94%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD  TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER +  TPLKDIMIGDEA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+I+NW+DMELLWDYAF++QMKLP+TSGGKV+LTEPPMNP++NRE
Sbjct: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           E+YELPDGRVIKVG ERFEAPECLFQP+LVDVEQPGVGE+LFNTIQAADVD+R++LY+AI
Sbjct: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP+RL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           ANIMADKDHMWLSKQEW E+GP+AMSKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/391 (88%), Positives = 366/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA+V TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAF++QMKL STS GK++LTEPPMNPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLQSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNT+Q+ADVD+RS+LY+AI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDPSRL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           A+IMADKDHMWLSKQEWQE GP+AMSKFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/391 (87%), Positives = 366/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA+V TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAF++QMKLPSTS GK++LTEPPMNPL+NRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNT+Q+ADVD+RS+LY+AI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDPSRL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           A+IMADKDHMWLSKQEWQE GPSAM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPSAMTKFGPR 391

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/391 (87%), Positives = 365/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA+V TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAF++QMKLPSTS GK++LTEPPMNPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNT+Q+ADVD+RS+LYRAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF RVL NDPSRL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFNRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           A+IMADKDHMWLSKQEWQE GP+AM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMTKFGPR 391

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/391 (87%), Positives = 366/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA +  PLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAF++QM+LP+TSGGK++LTEPPMNP++NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPTTSGGKILLTEPPMNPVKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL YVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           ENYELPDGR+IKVG ERFEAPECLFQPNLVDVEQ G+GE+LFNTIQ+ADVDVRS+LY+AI
Sbjct: 241 ENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL NDP+RL+KFKVRIEDPPRR+HMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNNDPTRLDKFKVRIEDPPRRRHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           A+IMADKDHMWL+KQEW+E G +AMSKFGPR
Sbjct: 361 ASIMADKDHMWLTKQEWRESGAAAMSKFGPR 391

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/391 (87%), Positives = 366/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD  +PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAN+ TPL+DIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAF++QMKL +TSGGK++LTEPPMNPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLNNTSGGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNTIQ+ADVDVRSALY+AI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLW+TRVL NDPSRL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           A+IMADKDHMWLSKQEW E G +AM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWYEGGAAAMAKFGPR 391

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/391 (87%), Positives = 368/391 (94%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD + PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA+ERANV TPLKDIMIGDEA
Sbjct: 1   MDPQKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+I++W+DMELLWDYAFY+QMKLPSTSGGKV+LTEPPMNPLRNRE
Sbjct: 61  SQVRSYLQISYPMENGIIRDWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGGVYV IQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRD+TR+LIDLLSRRGYAFN++ADFETVRQIKEKL YVSYDLDLDT+LA+ETTTLV
Sbjct: 181 LDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           E YELPDGRVIKVGSERFEAPECLFQP+LVDVEQPG+GEMLFNTIQ+ADVD+ S LY+AI
Sbjct: 241 EQYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDP+RLEKFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPTRLEKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           A+IMADK+HMWL+KQEW+E GP++MSKFGPR
Sbjct: 361 ASIMADKEHMWLTKQEWEESGPASMSKFGPR 391

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/391 (87%), Positives = 365/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD  +PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAN+ TPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAF++QMKLP+TS GK++LTEPPMNP +NRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLGHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPG+GE+LF+T+Q+ADVDVRSALY+AI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP+RL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           A+IMADKDHMWLSKQEWQE G ++M KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/391 (87%), Positives = 365/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA+V TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAF++QMKLPSTS GK++LTEPPMNPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNT+Q+ADVD+RS+LY+AI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDPSRL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           A+IMADKDHMWLSKQEW E GP++M+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/391 (86%), Positives = 366/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD  +PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER N+  PLKD+MIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           SAVRSYLQISYPMENG+IKNW+DMELLWDYAFY+QMKLPSTSGGKV+LTEPP+NPL+NRE
Sbjct: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           ENYELPDGRVIKVG ERFEA ECLFQPNLVDVE  GVGE+LFNTIQ+AD+DVRS+LY+AI
Sbjct: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVL NDP+RL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           A+IMADKDHMWLSKQEW E GP+AM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/391 (87%), Positives = 365/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA ER+N+ TPLKDIMIGDEA
Sbjct: 1   MDPYVPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DME LWDYAFYDQMK+PST+G KV+LTEPPMNPL+NRE
Sbjct: 61  SNVRSYLQISYPMENGIIKNWADMEQLWDYAFYDQMKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTR+LIDLLSRRGYAFN++ADFETVRQIKEKL YVSYDLDLDTKLA ETTTLV
Sbjct: 181 LDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTKLAHETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           E YELPDGRVIKVGSERFEAPECLFQP+LVDVEQ G+GEMLF+TIQ+ADVD+ SALYRAI
Sbjct: 241 ETYELPDGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDP+RL+KFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPARLDKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           ANIMADKDHMWL+K+EW+EMGP+AMSKFGPR
Sbjct: 361 ANIMADKDHMWLTKKEWEEMGPAAMSKFGPR 391

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/393 (86%), Positives = 368/393 (93%), Gaps = 2/393 (0%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA--NVVTPLKDIMIGD 58
           MD  +PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER+  +  TP+KDIM+G+
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGE 60

Query: 59  EASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRN 118
           EAS VRSYLQISYPMENG+IK+W+DMELLWD+AF+++MKLPSTSGGK++LTEPPMNPL+N
Sbjct: 61  EASDVRSYLQISYPMENGIIKHWTDMELLWDHAFFEKMKLPSTSGGKILLTEPPMNPLKN 120

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLT 178
           RE MC+VMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLNHLT
Sbjct: 121 REMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLT 180

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTT 238
           RRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLD DTKLARETTT
Sbjct: 181 RRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLARETTT 240

Query: 239 LVENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYR 298
           LVENYELPDGR+IKVG ERFEAPECLFQPNLVDVEQPGVGE+LFNTIQ+ADVD+RS+LY+
Sbjct: 241 LVENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYK 300

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGA 358
           AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDPSRL+KFKVRIEDPPRRKHMVFIGGA
Sbjct: 301 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPSRLDKFKVRIEDPPRRKHMVFIGGA 360

Query: 359 VLANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           VLANIMADKDHMWLSKQEW+E G  AM+KFGPR
Sbjct: 361 VLANIMADKDHMWLSKQEWEESGAQAMAKFGPR 393

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/391 (85%), Positives = 364/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD  +PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER ++ TPLKDIMIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+I+NW DME LWDYAFY+QMK PSTSGGK++LTEPPMNPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPSTSGGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
            MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 LMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDL+LDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           ENYELPDGRVIKVG ERFEAPECLFQP+LVDVEQPG+GE+LFNTIQ+ADVD+RS+LYRAI
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLW+TR+LR D +RL+KFKV+IEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRILRGDAARLDKFKVKIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           A+IMA+KDHMWL+K+EW E GP+AM+KFGPR
Sbjct: 361 ASIMAEKDHMWLTKEEWHESGPAAMAKFGPR 391

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/391 (85%), Positives = 364/391 (93%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           MD  +PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER  + TPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAF++QMKLP+TSGGKV+LTEPPMNP++NRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLPTTSGGKVLLTEPPMNPVKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +MCEVMFE+YDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLNHLTRR
Sbjct: 121 RMCEVMFERYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGY+FNR+ADFETVRQIKEK+ YVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300
           + YELPDGR+IKVG ERFEAPECLFQP+LVDVE PGVGE+LFNTIQ+AD+DVRS+LY+AI
Sbjct: 241 QEYELPDGRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLE+ELKQLWFTR+L+ D  RL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLERELKQLWFTRILKGDAERLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           ANIMADKDHMWLSKQEWQE G +A++KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQENGAAALAKFGPR 391

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/337 (93%), Positives = 323/337 (95%)

Query: 55  MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMN 114
           MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQM+LPSTSGGKVMLTEPPMN
Sbjct: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60

Query: 115 PLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P++NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 234
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180

Query: 235 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRS 294
           ETTTLVENYELPDGRVIKVGSERFEAPECLFQP+LVDVEQPGVGEMLFNTIQ+ADVDVRS
Sbjct: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240

Query: 295 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVF 354
           ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDPSRL+KFKVRIEDPPRRKHMVF
Sbjct: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           IGGAVLANIMADKDHMWLSKQEWQEMG +AMSKFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/337 (87%), Positives = 316/337 (93%)

Query: 55  MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMN 114
           MIG EAS VRSYLQISYPMENG+IKNW+DMELLWDYAFY+QMKLP TS GK++LTEPPMN
Sbjct: 1   MIGGEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPDTSNGKILLTEPPMN 60

Query: 115 PLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P++NRE+MCEVMFEKY+FGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PIKNREKMCEVMFEKYNFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 234
           NHLTRRLDVAGRDVTR+LIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 180

Query: 235 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRS 294
           ETTTLVE+YELPDGRVIKVGSERFEAPECLFQPNLVDVEQ GVGE+LFNTIQ+ADVD+RS
Sbjct: 181 ETTTLVESYELPDGRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRS 240

Query: 295 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVF 354
            L++AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDP+RL+KFKVRIEDPPRRKHMVF
Sbjct: 241 TLFKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPTRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391
           IGGAVLANIMADKDHMWLSKQEW+E GP+AM+KFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWEESGPAAMAKFGPR 337

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  332 bits (850), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGGS
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGS 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  332 bits (850), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +E   V+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSME---VKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDCYVGDEAQSKRGI 65

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 124

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 125 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 184

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D D + + A +++ + ++YELP
Sbjct: 185 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDYDQEMQTAAQSSAIEKSYELP 244

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 245 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 304

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 305 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 353

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 354 Q-QMWISKQEYDESGPS 369

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   D+DVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  330 bits (845), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSVEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  GV +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  329 bits (844), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 65

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 124

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 125 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 184

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++ + ++YELP
Sbjct: 185 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 244

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 245 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 304

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 305 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 353

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 354 Q-QMWISKQEYDESGPS 369

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  329 bits (843), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 246/377 (65%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  328 bits (842), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKNNREKMTQIL 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +L+ RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++ + ++YELP
Sbjct: 184 DITDYLMKILAERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSAVEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  328 bits (842), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIL 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++ + ++YELP
Sbjct: 184 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+L+ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  328 bits (841), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIL 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++ + ++YELP
Sbjct: 184 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGS 306
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWQEMGPS 383
           +  MW+SKQE+ E GPS
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  320 bits (819), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 239/368 (64%), Gaps = 16/368 (4%)

Query: 16  VKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSYLQISYPMEN 75
            K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  L + YP+E+
Sbjct: 2   CKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEH 58

Query: 76  GVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGV 135
           G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++MFE ++    
Sbjct: 59  GIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAF 117

Query: 136 YVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDL 195
           YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGRD+T +L+ +
Sbjct: 118 YVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 177

Query: 196 LSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGS 255
           LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELPDG+VI +G+
Sbjct: 178 LSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGN 237

Query: 256 ERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSR 315
           ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  LY  IV+SGG++M+PG+  R
Sbjct: 238 ERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER 297

Query: 316 LEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQ 375
           ++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   +  MW+SKQ
Sbjct: 298 MQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISKQ 345

Query: 376 EWQEMGPS 383
           E+ E GPS
Sbjct: 346 EYDESGPS 353

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score =  318 bits (814), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 238/368 (64%), Gaps = 16/368 (4%)

Query: 16  VKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSYLQISYPMEN 75
            K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  L + YP+E+
Sbjct: 2   CKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEH 58

Query: 76  GVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGV 135
           G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M +++FE ++    
Sbjct: 59  GIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQILFETFNVPAF 117

Query: 136 YVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDL 195
           YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGRD+T +L+ +
Sbjct: 118 YVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKI 177

Query: 196 LSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGS 255
           LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++ + ++YELPDG+VI +G+
Sbjct: 178 LSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPDGQVITIGN 237

Query: 256 ERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSR 315
           ERF APE LF P+L+ +E  G+ +  +N+I   DVDVR  LY  IV+SGG++M+PG+  R
Sbjct: 238 ERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER 297

Query: 316 LEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQ 375
           ++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   +  MW+SKQ
Sbjct: 298 MQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISKQ 345

Query: 376 EWQEMGPS 383
           E+ E GPS
Sbjct: 346 EYDESGPS 353

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score =  274 bits (701), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 17/384 (4%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PIVLD G+G +K G +GE  P     S++G P         +     +  IG++A  +R 
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLE---GEQFIGNQAQELRG 67

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEV 125
            L++ YP+E+G++KNWSDMEL+W++ F+  ++L +     V+ TE P+NPL+NRE MCE+
Sbjct: 68  LLKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLNNIEEHPVLATEAPLNPLKNREAMCEM 127

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
           +FE ++   VYV+IQAVL+LYA G              H VPV++   L    RR+DVAG
Sbjct: 128 LFETFNVPAVYVSIQAVLSLYASGRTTGCVLDCGDGCCHSVPVFDGFSLPSSIRRIDVAG 187

Query: 186 RDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYE 244
           RDVT  L  LL +  G +   S++ E VR IKEK  YV+ D  L  +     T     ++
Sbjct: 188 RDVTEFLQLLLRKTTGVSLLSSSEREIVRIIKEKACYVARD-PLTEEQTYHLTPTSTIFK 246

Query: 245 LPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSG 304
           LPDG+V+ + +E+F APE LFQP L+  E   + EM   +I   D+D+R AL   IVLSG
Sbjct: 247 LPDGKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSG 306

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIM 364
           G++M+PG   RL  EL+ L       ++P    + K++I  PP RK+  +IGG++L+ + 
Sbjct: 307 GTTMFPGFGDRLLTELRNL-------SEP----QTKIKIFAPPERKYSTWIGGSILSGLS 355

Query: 365 ADKDHMWLSKQEWQEMGPSAMSKF 388
             K  +W++K EWQE      S+F
Sbjct: 356 TFKK-IWVTKSEWQENPDCVHSRF 378

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score =  265 bits (676), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 141/384 (36%), Positives = 220/384 (57%), Gaps = 17/384 (4%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           P+VLD G+G +K G +GE  P     S++G           +     D  IG++A  +R 
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEG---DTFIGNQAQELRG 93

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEV 125
            L++ YP+++G++ NW+DME +W Y F   ++L +      ++TE P+NP +NRE+MCE+
Sbjct: 94  LLKLRYPLQHGIVTNWADMEQVWGYVFNKSLQLQNVEDHPNLVTEAPLNPHKNREKMCEL 153

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
           +FE ++   +YV++QAVL+LYA G              H VPV++   +    RR+D+AG
Sbjct: 154 LFESFNVPALYVSVQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSVPSSIRRIDIAG 213

Query: 186 RDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYE 244
           RD+T  L  LL +  G +   S++ E VR IKEK  +V+ D  L+ +      +    ++
Sbjct: 214 RDITEFLQLLLRKTTGVSLLSSSEREIVRTIKEKACFVTKDPKLEEQNFPMNPSF-SKFK 272

Query: 245 LPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSG 304
           LPDG+ I++G ER+ APE LFQP L+  E   + +M + +I   D+D+RS LY  I+LSG
Sbjct: 273 LPDGKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSG 332

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIM 364
           G+SM PG   RL KELK L  +R            K++I  PP RK+  +IGG++L+ + 
Sbjct: 333 GTSMLPGFGDRLLKELKSLSGSRT-----------KIKIFAPPERKYSTWIGGSILSGLS 381

Query: 365 ADKDHMWLSKQEWQEMGPSAMSKF 388
             K  +W++K EW+E      S+F
Sbjct: 382 TFKK-LWVTKSEWEEFPDCIHSRF 404

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score =  262 bits (670), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 141/387 (36%), Positives = 222/387 (57%), Gaps = 23/387 (5%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PIVLD G+G +K G +GE  P     S++G           +     D  IG++A  +R 
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEG---DTFIGNQAQELRG 65

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEV 125
            L++ +P+E+G++KNWSDME +W Y F   ++L +     +++TE P+NP  NRE+MCE+
Sbjct: 66  LLKLRHPVEHGIVKNWSDMEHIWSYVFNKSLQLQNVEDHPILITEAPLNPRNNRERMCEL 125

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
           +FE ++   +YV+IQAVL+LYA G              H VPV++   +    RR+D+AG
Sbjct: 126 LFESFNVPALYVSIQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSIPSSIRRIDIAG 185

Query: 186 RDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENY- 243
           RD+T  L  LL +  G +   S++ E VR IKEK  YV+ D  ++     +  ++  NY 
Sbjct: 186 RDITEFLQLLLRKTTGVSLLSSSEREVVRIIKEKACYVAKDPHIE----EQNFSINPNYT 241

Query: 244 --ELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIV 301
             +LPDG+ I +G E+F APE LFQP L+  E   + +M + +I+  D+D+RS L+  ++
Sbjct: 242 KFKLPDGKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVL 301

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG+S+ PG   RL  ELK L  ++            K++I  PP RK+  +IGG++L+
Sbjct: 302 LSGGTSILPGFGDRLLSELKSLSDSQT-----------KIKIFAPPERKYSTWIGGSILS 350

Query: 362 NIMADKDHMWLSKQEWQEMGPSAMSKF 388
            +   K  +W+++ EW+E      S+F
Sbjct: 351 GLSTFK-KLWVTRAEWEEAADCIHSRF 376

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score =  260 bits (664), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 124/290 (42%), Positives = 189/290 (65%), Gaps = 4/290 (1%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA + R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVM 126
           L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSAL 296
           DG+VI +G+ERF APE LF P+++ +E  G+ +  +N+I   DVDVR  L
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKEL 293

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score =  262 bits (670), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 142/386 (36%), Positives = 229/386 (59%), Gaps = 17/386 (4%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           P+VLD G+G +K G +GE  P     S++G P         + +  +  +IG+EA  +R 
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQ--LIGNEAQKMRG 68

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEV 125
            L++ YP+E+GV+++W  +E LW + FY+ +KL +     +++TE P+NP++NR +MCE+
Sbjct: 69  LLKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLANIEEHPMLITEAPLNPMKNRNKMCEM 128

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
           +FE +    VYV+IQAVLALYA G                VPVY+   L    +R+DVAG
Sbjct: 129 LFETFGSPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAG 188

Query: 186 RDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTK--LARETTTLVEN 242
           RD+T  L  LL +  G   + S++ E VR IKEK  +V+ D+  + +      +  L   
Sbjct: 189 RDITEFLQLLLRKSSGVTLSSSSEREIVRMIKEKACFVATDVGNEEQNYEGANSAELETR 248

Query: 243 YELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVL 302
           ++LPDG+++ +G+E+F APE LFQP+L+  E   + EM   +I   D+D+RS+LY +IVL
Sbjct: 249 FKLPDGKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVL 308

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLAN 362
           SGGS+M+ G   RL  E+++        ++P+     K++I  PP RK+  +IGG++LA 
Sbjct: 309 SGGSTMFSGFGDRLLSEIRK-------TSEPNT----KIKIFAPPERKYSTWIGGSILAG 357

Query: 363 IMADKDHMWLSKQEWQEMGPSAMSKF 388
            ++  + +W+++ EWQE      S+F
Sbjct: 358 -LSTFEKLWVTRAEWQENPQCIHSRF 382

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score =  257 bits (656), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 145/390 (37%), Positives = 229/390 (58%), Gaps = 29/390 (7%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKD--IMIGDEASAV 63
           PIVLD G+G +K G  GE+ P     S+VG P     + + V+    D    +G++A  +
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIP-----KYSKVMAGRFDGNTFVGNQAQEI 66

Query: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMC 123
           R  L++ +P+E+GV+ +W+ +E LW + F   ++L S     V++TE P+NP +NREQMC
Sbjct: 67  RGLLKLRHPLEHGVVTDWNALEQLWGHVFEKGLQLSSLQDHPVLVTEAPLNPKKNREQMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           E++FE +    VYV+IQAVL+LYA G             +H VPVY+   L    RR+D+
Sbjct: 127 ELLFETFSVPAVYVSIQAVLSLYASGRTTGCVLDSGDGCSHAVPVYDGYTLPSAIRRIDI 186

Query: 184 AGRDVTRHLIDLLSRR--GYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVE 241
           AGRD++  L+ +L R+  G +   S++ E VR IKEK  Y++    LD K   +  T+  
Sbjct: 187 AGRDIS-ELLQVLIRKSTGVSLLSSSEREIVRIIKEKACYIA----LDPKEEEKNYTMHG 241

Query: 242 N---YELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYR 298
               + LPDG+ I++ +E+F APE LF P L+  E   + E+L+ +IQ  D+D+R++L+ 
Sbjct: 242 KQTMFRLPDGKQIELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFS 301

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGA 358
            IV SGG++M PG   R+ KELK       L  +P    + K++I  PP RK+  +IGG+
Sbjct: 302 NIVFSGGTTMIPGFGDRVLKELK-------LSCEP----QTKIKIFAPPERKYSTWIGGS 350

Query: 359 VLANIMADKDHMWLSKQEWQEMGPSAMSKF 388
           +L+ +   K  +W++K+EW+E      ++F
Sbjct: 351 ILSGLSTFKK-IWVTKKEWEENPRCVHARF 379

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  249 bits (637), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 132/376 (35%), Positives = 206/376 (54%), Gaps = 14/376 (3%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           P+VLD G+  +K G +G+N P     +++G P        N ++      IG+ A   R 
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEV 125
            L++ +PM  G+++NW DME LW + F D +K+       +++TE P+NP +NR++MCEV
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFDEHPLLITEAPLNPEKNRDKMCEV 129

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
            FEK+DF  VY+A  + L+LYA G                VP+YE   L    RR+DV G
Sbjct: 130 FFEKFDFAAVYIANPSTLSLYASGRTTGCVLDCGDGYCSSVPIYEGFALPSSIRRIDVGG 189

Query: 186 RDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVE-NY 243
           RDVT  L   +    G +   S++ E V+ +KEK  YVS D   D  ++      +   +
Sbjct: 190 RDVTEQLQFQIRKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRCQF 249

Query: 244 ELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLS 303
           +LPDG+ + +   RF APE LF+P ++ +E   V +M F +I   D+++R  L+ +I+L+
Sbjct: 250 KLPDGKDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILN 309

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GGS+M+ G   RL KEL+       +R     L    ++I  PP RK+  +IGG++L  +
Sbjct: 310 GGSTMFRGFGDRLLKELQ-------IRTGNKNL----IKIIAPPERKYTSWIGGSILTGL 358

Query: 364 MADKDHMWLSKQEWQE 379
              K  +W++K EWQE
Sbjct: 359 STFK-QLWMTKAEWQE 373

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score =  247 bits (631), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 139/388 (35%), Positives = 221/388 (56%), Gaps = 22/388 (5%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVV--TPLKDIMIGDEASAV 63
           P+VLD G+  +K G +GE+ P +   SIVG P      R   V  +   D  +G+ A   
Sbjct: 12  PVVLDNGSAILKAGYSGEDRPKFLEHSIVGSP------RHGYVNDSSKDDTFVGNLAQER 65

Query: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMC 123
           RS LQ+ +P+++GV+KNW+DMEL+WDY F D++KL       V++TE P+NP+ NR++MC
Sbjct: 66  RSILQLRHPVDHGVVKNWNDMELIWDYMFKDKLKLKDVDEHPVLITEAPLNPVSNRDEMC 125

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           +++FE +    +YVA  AVL+LYA G             +  VPVY+   L    +R+D+
Sbjct: 126 DLLFESFGVQALYVANPAVLSLYASGKISGCVLDCGDGYSCSVPVYQGYTLKSAIKRIDL 185

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDL-DTKLARETTTLVE 241
            GRD+T  L + L    G +   S + E VR IKEK  YV+ DLD+ + K   E   +  
Sbjct: 186 GGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKCNYEGDQVGL 245

Query: 242 NYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIV 301
            ++LPDG+ I +  +RF+ PE LFQP+++  E   + E+++ ++   D D+R  ++  I+
Sbjct: 246 KFKLPDGKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDIL 305

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++M  G  +RL +EL +L              + +V+I  PP RK+  +IGG++LA
Sbjct: 306 LSGGTTMLKGFGNRLVQELDKL-----------NQAQSRVKIWAPPERKYTSWIGGSILA 354

Query: 362 NIMADKDHMWLSKQEWQEMGPSAMSKFG 389
             ++    + ++K +WQE      +K G
Sbjct: 355 E-LSTFQKIIVTKSQWQEDPSIIHTKCG 381

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score =  246 bits (629), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 142/386 (36%), Positives = 229/386 (59%), Gaps = 17/386 (4%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           P+VLD G+G +K G +GE  P     S++G P         + +  +  ++G+EA   R 
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSS--RGQLVGNEAQKQRG 68

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEV 125
            L++ YP+E+G++++WS +E LW + FY  +KL +     +++TE P+NPL NR++MCE+
Sbjct: 69  LLRLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNIGDHPMLVTEAPLNPLENRDKMCEM 128

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
           ++E ++   VYV+IQAVLALYA G                VPVY+   +    RR+DVAG
Sbjct: 129 LYETFNVPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAG 188

Query: 186 RDVTRHLIDLLSRR-GYAFNRSADFETVRQIKEKLSYVSYDLDLDTK--LARETTTLVEN 242
           RDVT  L  LL +  G     S++ E VR IKEK  YV+ ++  + +   +   +  +  
Sbjct: 189 RDVTEFLQLLLRKSIGVTLLSSSEREIVRMIKEKACYVAPEVAAEEQKYASSRGSEELTK 248

Query: 243 YELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVL 302
           ++LPDG+++ +G+E+F APE LFQP L+  E   + +M F +I   D+D+RS+LY ++VL
Sbjct: 249 FKLPDGKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVL 308

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLAN 362
           SGGS+++ G   RL  EL+        R +P+     K++I  PP RK+ V+IGG++LA 
Sbjct: 309 SGGSTLFAGFGDRLLNELRS-------RCEPN----VKIKIFAPPERKYSVWIGGSILAG 357

Query: 363 IMADKDHMWLSKQEWQEMGPSAMSKF 388
            ++  + +W+++ EWQE      S+F
Sbjct: 358 -LSTFEKIWVTRSEWQENPQCVHSRF 382

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score =  241 bits (615), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 136/377 (36%), Positives = 209/377 (55%), Gaps = 21/377 (5%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PIVLD G+  +K G  G++ P     S++G P     ++  V    K   +G+ A   R 
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTP---KYDKVMVGGVEKGKFVGNLAQEYRG 69

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEV 125
            L++ YPM++G+I+NW  ME +WD+ F D +K+ +     +++TE P+NP  NRE+MCE 
Sbjct: 70  LLKLRYPMDHGIIENWEHMETVWDHIFKDCLKVSNLGEHPLVVTEAPLNPKPNREKMCET 129

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
           +FE ++   +Y+A  AVL+LYA G                VP+YE   L    RR+D+ G
Sbjct: 130 LFESFNIPALYIANPAVLSLYASGRTTGCVVEAGDGYCSSVPIYEGFALTPSIRRIDIGG 189

Query: 186 RDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTK---LARETTTLVE 241
           RD+T+HL + L    G     S++ E VR IKE   Y+  +   + +   L +E  ++  
Sbjct: 190 RDITKHLQLQLRKSTGMWLYSSSEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKKSI-- 247

Query: 242 NYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIV 301
           +++LPDG+ + +G  RF APE LF P L+  E   + +M+  +I   D+D+RS L   I 
Sbjct: 248 SFKLPDGKNLVIGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNIT 307

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGGS+M+ G   RL  EL           D S  +  KVRI  PP RK+  FIGG++LA
Sbjct: 308 LSGGSTMFQGFCDRLITEL-----------DFSVDKTTKVRILAPPERKYSAFIGGSILA 356

Query: 362 NIMADKDHMWLSKQEWQ 378
           N+   ++ MW++K +W+
Sbjct: 357 NLSTFRN-MWVTKDQWE 372

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score =  241 bits (615), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 130/376 (34%), Positives = 206/376 (54%), Gaps = 16/376 (4%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PIV+D GT  +K G  GE  P     SIVG P      ++N +    D  IG++A   R 
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIE--SDSFIGNKAQKYRG 71

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEV 125
            L++ +PM  GV++NW DME +W Y F D + L + +   +++TEPP+N + NR++MCE 
Sbjct: 72  ILKLRHPMLRGVVQNWDDMETIWQYVFDDTLYLENLNEHPILITEPPLNNMANRQKMCEA 131

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
           +FE + F  VY+++  VL+LYA G                +PVY    L    +++D+ G
Sbjct: 132 LFEIFGFPAVYISVSPVLSLYASGQTTGCAVDCGDGYCTSIPVYNGFSLASSVKKIDIGG 191

Query: 186 RDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDT-KLARETTTLVENY 243
            D+T  L   +L   G     S++ E VR IKEK+ Y++ D +L+T K       +   +
Sbjct: 192 CDITEQLQFSILKNTGLFMYSSSEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMASQF 251

Query: 244 ELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLS 303
           +LPDG+++ +   ++ + E LF+P L+  E   + E+ + +I+  D D+R  LY  IVLS
Sbjct: 252 KLPDGKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLS 311

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++M PG  SRL KEL+ L                K+RI  PP RK+  +IGG++L+  
Sbjct: 312 GGTTMCPGFGSRLLKELQTLTGYDT-----------KIRIIAPPERKYTSWIGGSILSG- 359

Query: 364 MADKDHMWLSKQEWQE 379
           ++    +W++K  W+E
Sbjct: 360 LSTFSKIWVTKSMWEE 375

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score =  229 bits (583), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 123/376 (32%), Positives = 203/376 (53%), Gaps = 17/376 (4%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           P+V+D G+G +K G +GE  P      +VG       ++  +     D  IG+ A  +R 
Sbjct: 14  PVVIDNGSGIIKAGFSGEERPKALEYCLVGNT---KYDKVMLEGLQGDTFIGNNAQKLRG 70

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEV 125
            L++ YP+++GV+++W  MEL+W Y   + ++L +     +++TE PMNPL+NREQM +V
Sbjct: 71  LLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQV 130

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
           +FE +D   +YV+  AVL+LYA G                VP+Y+   L     R+D+ G
Sbjct: 131 LFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGG 190

Query: 186 RDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDL-DTKLARETTTLVENY 243
            D+T  L   L    G +   S++ E VR +KEK+ Y++ ++   + K  + T  L+  +
Sbjct: 191 ADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTF 250

Query: 244 ELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLS 303
           +LPDGR I+VG++R+ APE LF P ++ +   G+ +M   +I   D+D+R  L  +I+LS
Sbjct: 251 KLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILS 310

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++   G   R+      LW    L    S     K++I  P  RK+  +IGG++L   
Sbjct: 311 GGTTTLKGFGDRM------LWDLEALTKGTS-----KIKIIAPSERKYTTWIGGSILTG- 358

Query: 364 MADKDHMWLSKQEWQE 379
           ++    +W  K +W E
Sbjct: 359 LSTFQRLWTKKSDWLE 374

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  227 bits (578), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 123/377 (32%), Positives = 211/377 (55%), Gaps = 19/377 (5%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLK-DIMIGDEASAVR 64
           PIV+D G+G +K G +GE  P     S+VG     A+    ++  L+ D  +G++A  +R
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGH----AKYDKVMLEGLQGDTFVGNKAQRLR 69

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCE 124
             L++ YP+E+GV+++W  MEL+W +   + ++L +     +++TE PMNPL+NRE M +
Sbjct: 70  GLLRLQYPIEHGVVEDWDSMELIWAHILNEVLQLQNIEEHPLLITEAPMNPLKNREVMAQ 129

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVA 184
           V+FE ++   +YV+  AVL+LYA G                VP+Y+   L     R+D+ 
Sbjct: 130 VLFETFNLPALYVSNPAVLSLYASGRTTGCVIDCGEGYCSTVPIYDGFALPASMMRMDIG 189

Query: 185 GRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDL-DTKLARETTTLVEN 242
           GRD+T+ L   L    G +   S++ E VR IKEK+ Y++ D+   +    +E+  L   
Sbjct: 190 GRDITKQLQFQLRKSAGVSLFSSSEREIVRTIKEKVCYLATDIKKEENTYMQESQDLTSV 249

Query: 243 YELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVL 302
           ++LPDG+ I++G++R+ APE LF P ++     G+ +M   +I   D+D+R+ L  +I+L
Sbjct: 250 FKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIIL 309

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLAN 362
           SGG++   G   R+  +L+   FT+            K++I  PP RK+  ++GG++L  
Sbjct: 310 SGGTTTLRGFGDRMLHDLEA--FTK---------GTSKIKIIAPPERKYTTWVGGSILTG 358

Query: 363 IMADKDHMWLSKQEWQE 379
            ++    +W  K +W E
Sbjct: 359 -LSTFQRLWTKKSDWLE 374

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score =  224 bits (571), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/377 (34%), Positives = 201/377 (53%), Gaps = 19/377 (5%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLK-DIMIGDEASAVR 64
           P+V+D G+  VK G  GE  P     S++G     A     +V  L+ D  +G++A  +R
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGD----ANYNKIMVGGLECDSFVGNKAQRLR 66

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCE 124
             L++ +PME GV+ +W DMELLW +  +D ++L S     +++TE P+NP  N+E+M E
Sbjct: 67  GLLKLKHPMERGVVSDWDDMELLWSHILFDSLQLTSGMEHPLLITEAPLNPESNKEKMLE 126

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVA 184
           V FE ++   + V+I  VL+LYA G                VPV E   L    +R+++ 
Sbjct: 127 VFFETFNIPAICVSIPGVLSLYASGRTTGCVVDCGEGYCSSVPVCEGYTLASSIKRINLG 186

Query: 185 GRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD-LDLDTKLARETTTLVEN 242
           G DVT+ L   L    G     S + E VR +KEK  YVS + L  + K   E   +  N
Sbjct: 187 GIDVTKQLQFQLRKESGVWLFSSGERELVRTMKEKSCYVSLNQLKDEEKFTFEPGKMNTN 246

Query: 243 YELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVL 302
           ++LPDG ++ +   RF APE LFQP ++  E+P + EM   +I + DV++R  L   I L
Sbjct: 247 FKLPDGNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITL 306

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLAN 362
           SGG++M+ G   R  +EL+            S  +K  +RI  PP RK+  +IGG++LA 
Sbjct: 307 SGGTTMFRGFGDRFLQELQI-----------STCKKSNIRILAPPERKYTAWIGGSMLAG 355

Query: 363 IMADKDHMWLSKQEWQE 379
           +   +  M  +K +W+E
Sbjct: 356 LTTFR-KMLTTKSDWRE 371

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  224 bits (570), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 122/376 (32%), Positives = 204/376 (54%), Gaps = 17/376 (4%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PIV+D G+G +K G +GE  P     S+VG       ++  +     D  +G++A  +R 
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHT---KYDKVMLEGLQGDTFVGNKAQKLRG 70

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEV 125
            L++ YPM++GV+++W  MEL+W Y   + ++L +     +++TE PMNPL+NRE + +V
Sbjct: 71  LLRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQNIEEHPLLITEAPMNPLKNREMIAQV 130

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
           MFE ++   +YV+  AVL+LYA G                VP+Y+   L     R+D+ G
Sbjct: 131 MFETFNLSAIYVSDPAVLSLYASGRTTGCVVDCGEGYCSSVPIYDGFALPASIMRMDIGG 190

Query: 186 RDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDT-KLARETTTLVENY 243
            D+T  L   +    G +   S++ E VR IKEK+ Y++ D   +  K  + T  L+  +
Sbjct: 191 GDITEQLQFQIRKSAGVSLFSSSEREIVRTIKEKVCYLAKDAKKEEDKYLQGTQDLISAF 250

Query: 244 ELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLS 303
           +LPDG+ I+VG++R+ APE LF P ++     G+  M   +I   D+D+R  L  +++LS
Sbjct: 251 KLPDGKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILS 310

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++   G   R+  +L+ L  T+            K++I  PP RK+  +IGG++L   
Sbjct: 311 GGTTTLKGFGDRMLHDLEAL--TKGTS---------KIKIIAPPERKYTAWIGGSILTG- 358

Query: 364 MADKDHMWLSKQEWQE 379
           ++    +W  K +W E
Sbjct: 359 LSTFQKLWTKKSDWLE 374

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  223 bits (569), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 119/376 (31%), Positives = 203/376 (53%), Gaps = 17/376 (4%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PIV+D G+G +K+G +GE  P     S+VG       E+  +     D  +G++A  +R 
Sbjct: 14  PIVIDNGSGIIKVGFSGEERPKALEYSLVGHV---KYEKVMLEGLQGDTFVGNKAQKLRG 70

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEV 125
            L++ YPM +GV+++W  MEL+W Y   + ++L +     +++TE PMNPL+NRE M +V
Sbjct: 71  LLRLRYPMTHGVVEDWDSMELIWSYMLNEVLQLQNIEEHPLLITEAPMNPLKNREVMAQV 130

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 185
           +FE ++   +Y++  AVL+LYA G                VP+Y+   L     R+D+ G
Sbjct: 131 LFETFNLPALYISNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASIMRMDIGG 190

Query: 186 RDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDT-KLARETTTLVENY 243
           RD+T  L   L    G +   S++ E VR IKEK+ Y++ ++  +  +  +    L   +
Sbjct: 191 RDITEQLQFQLRKSAGISLFSSSELEVVRMIKEKVCYLAKNIKKEEDRYLQGHHDLGSVF 250

Query: 244 ELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLS 303
           +LPDG+ I++G++R+ APE LF P ++     G+ +M   +I   D+D+R  L  +I+LS
Sbjct: 251 KLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILS 310

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++   G   R+  +L+ L                K++I  PP RK+  ++GG++L   
Sbjct: 311 GGTTTLRGFGERMLHDLEAL-----------SKGTCKIKIIAPPERKYTTWVGGSILTG- 358

Query: 364 MADKDHMWLSKQEWQE 379
           ++    +W  K +W E
Sbjct: 359 LSTFQKLWTKKSDWLE 374

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score =  223 bits (568), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 125/386 (32%), Positives = 207/386 (53%), Gaps = 19/386 (4%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIM-IGDEASAVR 64
           P+V+D GTG +K+G  G++ P     +IVG P         ++  L D M IG++A   R
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKV----MIGGLDDNMYIGNKAQENR 65

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCE 124
             L++ +PME+G +K+W +ME +W +     + +       +++TE P+N  +NRE MCE
Sbjct: 66  GLLRLRHPMEHGEVKHWDEMEAVWKHTLLHDLNIQHIEEHPILITEAPLNSSKNREHMCE 125

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVA 184
           ++FE ++   ++V   AVLALY+ G                VP+YE   L    RR+D+ 
Sbjct: 126 ILFESFNIPAIHVENPAVLALYSGGRTTGCVIDCGEGYCSAVPIYEGFALTPSIRRIDIG 185

Query: 185 GRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDT-KLARETTTLVEN 242
           GR++T  L   +    G +   S + E VR IKE+  YV+ D+  +  K   ++ +    
Sbjct: 186 GREITEQLQFQIRKSVGMSLFSSNEKEIVRTIKERACYVADDISKEEHKYILDSESNSSK 245

Query: 243 YELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVL 302
           ++LPDG+ + +G+ RF A E LF P L+  E   V E++F T+   D+D+R  LY+++VL
Sbjct: 246 FKLPDGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVL 305

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLAN 362
           +GG+++ PG  +R+ KEL+ L             +  K+RI   P RK+  +IGG++LA 
Sbjct: 306 NGGTTVLPGFGNRILKELQIL-----------TKQDTKLRIIASPERKYTTWIGGSILAG 354

Query: 363 IMADKDHMWLSKQEWQEMGPSAMSKF 388
            ++    + ++K  W E      S F
Sbjct: 355 -LSTFQKILVTKSNWNEDRSRVYSSF 379

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  219 bits (559), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 207/384 (53%), Gaps = 31/384 (8%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRP----ILRAEERANVVTPLKDIMIGDEAS 61
           PIV+D G+  +K G + ++ P     ++ G P    I+   +  N+     D  IG+ A 
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENL-----DKYIGNRAQ 65

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQ 121
           ++R  L++ +PM  GV+ NW DMELLW + F D + + +     +++TE P+   + R  
Sbjct: 66  SIRGLLRLQHPMNRGVVDNWDDMELLWWHIFNDTLNVQNIEEHPLLITEAPLTIEKQRHI 125

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
           MCE +FE ++   +YVA  +VL+LYA G                 P+YE  VL    R++
Sbjct: 126 MCERLFETFNIPSLYVANPSVLSLYASGNTTGCVVDCGDGYCSSTPIYEGFVLPASIRKM 185

Query: 182 DVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240
           +V GRD+T HL   +    G +   S + E VR IKEK+ Y+S D +     + E+  L 
Sbjct: 186 EVGGRDITEHLQFQIRKSSGISLYSSNEKEIVRTIKEKVCYISEDFN----KSEESYYLR 241

Query: 241 EN-----YELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSA 295
           ++     ++LPDG+ + +  ERF +PE LF P L+ +E   V  M F +I   D+++R  
Sbjct: 242 QDEMSCKFKLPDGKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPK 301

Query: 296 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFI 355
           L+  I+L+GGS+++ G  SRL  +L++L   R            K++I  PP RK+  +I
Sbjct: 302 LFSNILLTGGSTLFKGFGSRLLGDLQELTNNRA-----------KIKILAPPERKYTSWI 350

Query: 356 GGAVLANIMADKDHMWLSKQEWQE 379
           GG++L  +   K+ +W++K +W+E
Sbjct: 351 GGSILTGLSTFKN-LWVTKSDWEE 373

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score =  208 bits (529), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 206/384 (53%), Gaps = 29/384 (7%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKD-IMIGDEASAVR 64
           P+VLD G+  +K G +G+  P     ++ G+P      +  + T L+D   +G+EA  +R
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKP----RYKKVMTTGLEDRTFVGNEAQRLR 68

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSG----GKVMLTEPPMNPLRNRE 120
             L +  P+  G + NW DMELLW + FY +++L   +       +++TE P+N  +NRE
Sbjct: 69  GLLALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGDHPLLITEAPLNSTKNRE 128

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
            MCE+++E ++F  +YVA  AVL+LYA G             +   PVY+   L    RR
Sbjct: 129 TMCEILYETFNFDALYVAHPAVLSLYATGQTTGCVLECGEGYSASTPVYQGFALPSSIRR 188

Query: 181 LDVAGRDVTRHLIDLLSRR-GYAFNRSADFETVRQIKEKLSYVSYDLDLDTK----LARE 235
           +D+ GRD+T+ L   + +  G +   +++ E VR IKEK +YV+ D   + +      RE
Sbjct: 189 IDIGGRDITQELQFYIRKSTGLSLFSNSEQEIVRTIKEKANYVALDYKFEEEKFFIHERE 248

Query: 236 TTTLVENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSA 295
            T+ V+   LPDG+ +  G  ++   E LFQP L+  E   V EML  +I   D+D+R+ 
Sbjct: 249 NTSTVK---LPDGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQ 305

Query: 296 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFI 355
           L   IVLSGG++M  G   R   E K++         P      KV+I     R ++ +I
Sbjct: 306 LLENIVLSGGTTMLKGFDQRTMSETKKML--------PKHT---KVKIRSLAERSYIAWI 354

Query: 356 GGAVLANIMADKDHMWLSKQEWQE 379
           GG++L+ +   ++ +WL+++ ++E
Sbjct: 355 GGSILSGLYGFRN-LWLTREMYEE 377

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score =  182 bits (463), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 114/380 (30%), Positives = 185/380 (48%), Gaps = 18/380 (4%)

Query: 3   LRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASA 62
           L  P++LD G+  +K G AG   PD    + +G P+    ER+ V    K+  IG+ A  
Sbjct: 9   LNQPVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPL---AERSMVTVSNKETYIGNSAYE 65

Query: 63  VRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQM 122
            R+ L +  P     I +W  +E LWDY   +++++       V+LT       +  E+M
Sbjct: 66  RRATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEKM 125

Query: 123 CEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLD 182
           CEV+FEK+    +Y +   +++LY  G               I  V + +++   ++  +
Sbjct: 126 CEVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCSVSCGHRGIGITTVIDGMIVGGSSQISN 185

Query: 183 VAGRDVTRHLIDLLSRRGYAF-NRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVE 241
             G  VT  ++DLL        N     E +R IKE+   +S D   + +     T+   
Sbjct: 186 TGGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIKERCCVLSKDFYNEIRAYELITSKTS 245

Query: 242 N--YELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRA 299
           N  Y LPDG +I++GSERFEAPE +F P      +  + +M+ N+I  A +  RS L  +
Sbjct: 246 NNKYRLPDGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLES 305

Query: 300 IVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAV 359
           IVLSGGSS+  G   RL KE+++     +  N        K+ +  P  R+ + +IGG+V
Sbjct: 306 IVLSGGSSLIKGFGERLTKEIRK----EIDGNQ-------KIMLNAPHERRFLPWIGGSV 354

Query: 360 LANIMADKDHMWLSKQEWQE 379
           L+ +   K  +W SK  ++E
Sbjct: 355 LSGLSTMK-LLWKSKSAYRE 373

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score =  174 bits (440), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 133/438 (30%), Positives = 208/438 (47%), Gaps = 63/438 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG--RPILRAEERANVV---------------- 48
           IV+D GTG  K+G AG + P + FP+ +   +P    ++  +                  
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQPSTTTKQSGSSGGVGPGSGSIQTQGVGS 68

Query: 49  -----------------TPLKDIMIGDEASAVR---SYLQISYPMENGVIKNWSDMELLW 88
                            T   D  IGDEA A     SY  +SYP+ +G ++NW  ME  W
Sbjct: 69  SSLSAALLSNNLAGKRGTEDLDFYIGDEAIAASQGPSY-SLSYPIRHGQVENWDHMERFW 127

Query: 89  DYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQ 148
           + + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLAL A 
Sbjct: 128 ENSIFKYLRT-EPEDHYFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAAS 186

Query: 149 GLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRG 200
                                 TH++PV E  V+    + + +AGRD+T  +  LL  RG
Sbjct: 187 WTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG 246

Query: 201 YAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYELPDGRVIKVGS 255
                     T  +IK++  YV  D+       D    +    +VEN E    +VI VG 
Sbjct: 247 ---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSEKTRRKVIDVGY 303

Query: 256 ERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLP 313
           ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IVLSGGS+M+    
Sbjct: 304 ERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 362

Query: 314 SRLEKELKQLWFTRVLRNDP---SRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHM 370
            RL+++LK +   R+  ++    ++     V++    R+++ V+ GG++LA     + + 
Sbjct: 363 RRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAETAEFRGYC 422

Query: 371 WLSKQEWQEMGPSAMSKF 388
             SKQ+++E+GP  +  F
Sbjct: 423 H-SKQDYEEIGPEIVRNF 439

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score =  173 bits (439), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 133/444 (29%), Positives = 205/444 (46%), Gaps = 69/444 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG-----------------------RPILRAEE 43
           IV+D GTG  K+G AG + P + FP+ +                         P      
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQRSTTKQGGSGSGAGQSQGSGNPYFGNST 68

Query: 44  RANVVTPLK------------------DIMIGDEASAVR---SYLQISYPMENGVIKNWS 82
            A     L                   D  IG+EA A     SY  +SYP+ +G ++NW 
Sbjct: 69  SATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSY-SLSYPIRHGQVENWD 127

Query: 83  DMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAV 142
            ME  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAV
Sbjct: 128 HMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAV 186

Query: 143 LALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194
           LAL A                       TH++PV E  V+    + + +AGRD+T  +  
Sbjct: 187 LALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQS 246

Query: 195 LLSRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYELPDGR 249
           LL  RG          T  +IK++  YV  D+       D    +    +VEN E    +
Sbjct: 247 LLRERG---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKTKRK 303

Query: 250 VIKVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSS 307
           VI VG ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IVLSGGS+
Sbjct: 304 VIDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGST 362

Query: 308 MYPGLPSRLEKELKQLWFTRVLRNDP---SRLEKFKVRIEDPPRRKHMVFIGGAVLANIM 364
           M+     RL+++LK +   R+  ++    ++     V++    R+++ V+ GG++LA   
Sbjct: 363 MFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTA 422

Query: 365 ADKDHMWLSKQEWQEMGPSAMSKF 388
             K +   +KQ+++E+GP  +  F
Sbjct: 423 EFKSYCH-TKQDYEEIGPEIVRNF 445

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  173 bits (438), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 131/449 (29%), Positives = 206/449 (45%), Gaps = 74/449 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV----------------------------GRPI 38
           +V+D GTG  K+G AG + P + FP+ +                            G P 
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSNTKKSSAVATMGGSGAQPGGSAGNPY 68

Query: 39  LRAEERANVVTPLK------------------DIMIGDEASAVR---SYLQISYPMENGV 77
                 A     L                   D  IG+EA A     SY  +SYP+ +G 
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSY-SLSYPIRHGQ 127

Query: 78  IKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYV 137
           ++NW  ME  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+
Sbjct: 128 VENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYI 186

Query: 138 AIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVT 189
           A+QAVLAL A                       TH++PV E  V+    + + +AGRD+T
Sbjct: 187 AVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT 246

Query: 190 RHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYE 244
             +  LL  RG          T  +IK++  YV  D+       D    +    +VEN E
Sbjct: 247 LFIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSE 303

Query: 245 LPDGRVIKVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVL 302
               +++ VG ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IVL
Sbjct: 304 STKKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVL 362

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRND---PSRLEKFKVRIEDPPRRKHMVFIGGAV 359
           SGGS+M+     RL+++LK +   R+ +++    ++     V++    R+++ V+ GG++
Sbjct: 363 SGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSL 422

Query: 360 LANIMADKDHMWLSKQEWQEMGPSAMSKF 388
           LA     K +   +KQ+++E GP  +  F
Sbjct: 423 LAQTAEFKSYCH-TKQDYEEYGPEIVRNF 450

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score =  172 bits (435), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/446 (29%), Positives = 206/446 (46%), Gaps = 71/446 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG-------------------------RPILRA 41
           +V+D GTG  K+G AG + P + FP+ +                           P    
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGTATGSNKNKAQATGGSNAGGSNPYFGN 68

Query: 42  EERANVVTPLK------------------DIMIGDEA---SAVRSYLQISYPMENGVIKN 80
              A     L                   D  IG+EA   S   SY  +SYP+ +G ++N
Sbjct: 69  STSATSFNNLSSQMLMSNNLAGKRGTEDLDFYIGNEALIASQGASY-SLSYPIRHGQVEN 127

Query: 81  WSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQ 140
           W  ME  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+A+Q
Sbjct: 128 WDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAVQ 186

Query: 141 AVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHL 192
           AVLAL A                       TH++PV E  V+    + + +AGRD+T+ +
Sbjct: 187 AVLALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFI 246

Query: 193 IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYELPD 247
             LL  RG A        T  +IK++  YV  D+       D    +    +VEN E   
Sbjct: 247 QTLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVENQEKTQ 303

Query: 248 GRVIKVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGG 305
            +V+ VG ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IVLSGG
Sbjct: 304 KKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGG 362

Query: 306 SSMYPGLPSRLEKELKQLWFTRVLRND---PSRLEKFKVRIEDPPRRKHMVFIGGAVLAN 362
           S+M+     RL+++LK +   R+ +N+    ++     V +    ++++ V+ GG++LA 
Sbjct: 363 STMFKDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ 422

Query: 363 IMADKDHMWLSKQEWQEMGPSAMSKF 388
               K +   +K++++E GP  +  F
Sbjct: 423 TAEFKSYCH-TKKDYEEYGPEIVRNF 447

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  171 bits (432), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 127/450 (28%), Positives = 210/450 (46%), Gaps = 74/450 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGR------------PILRAEERANVVTPLK-- 52
           IV+D GTG  K+G AG + P + FP+ +              P      +A V  P    
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQSSNAKSSANAPQGLGNAKAGVSNPATSN 68

Query: 53  ----------------------------------DIMIGDEA--SAVRSYLQISYPMENG 76
                                             D  IG+EA  ++      +SYP+ +G
Sbjct: 69  PYFGNSTSATSFASNSNAFLLSNNLAGKRGTEDLDFYIGNEALVASQGPAYSLSYPIRHG 128

Query: 77  VIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVY 136
            ++NW  ME  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y
Sbjct: 129 QVENWDHMERFWENSIFKYLRA-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLY 187

Query: 137 VAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDV 188
           +A+QAVLAL A                       TH++PV E  V+    + + +AGRD+
Sbjct: 188 IAVQAVLALAASWTSAQVTDRSLTGTVIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDI 247

Query: 189 TRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENY 243
           T  +  LL  RG A    +  +T  +IK++  YV  D+       D +  +    ++EN 
Sbjct: 248 TLFIQSLLRERGEA---DSSLKTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIENQ 304

Query: 244 ELPDGRVIKVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIV 301
           +    +VI +G ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IV
Sbjct: 305 DKTTKKVIDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIV 363

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---SRLEKFKVRIEDPPRRKHMVFIGGA 358
           LSGGS+M+     RL++++K +   R+ +N+    ++     V++    ++++ V+ GG+
Sbjct: 364 LSGGSTMFKDFSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGS 423

Query: 359 VLANIMADKDHMWLSKQEWQEMGPSAMSKF 388
           +LA     K +   +K++++E GP  +  F
Sbjct: 424 LLAQTAEFKGYCH-TKKDYEEHGPEIVRNF 452

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score =  170 bits (430), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 132/442 (29%), Positives = 210/442 (47%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFP--------------SIVGRPILRAEERA---NVVT 49
           +V+D GTG  K+G AG + P + FP              S VG P   + E +   N  +
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTS 68

Query: 50  PLK----------------------DIMIGDEA---SAVRSYLQISYPMENGVIKNWSDM 84
                                    D  IG+EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++  YV  D+       D   ++    +VEN E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IVLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL+++LK +   R+ +++    ++     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWQEMGPSAMSKF 388
           K +   +K++++E GP  +  F
Sbjct: 423 KGYCH-TKKDYEEYGPEIVRNF 443

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  170 bits (430), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 129/442 (29%), Positives = 209/442 (47%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVV------------------ 48
           +V+D GTG  K+G AG + P + FP+ +        ++A+ V                  
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGTSSAAGNEASYFGNSTS 68

Query: 49  ---------------------TPLKDIMIGDEA---SAVRSYLQISYPMENGVIKNWSDM 84
                                T   D  IG+EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++  YV  D+       D   ++    +VEN E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IVLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL+++LK +   R+ +++    ++     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWQEMGPSAMSKF 388
           K +   +K++++E GP  +  F
Sbjct: 423 KGYCH-TKKDYEEYGPEIVRNF 443

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score =  169 bits (428), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 129/442 (29%), Positives = 206/442 (46%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG---------------------------RPIL 39
           IV+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQNHTKKTSSMSSTSNTTSSNQYFGNSTSA 68

Query: 40  RAEERANVVTPLK------------DIMIGDEASAVR---SYLQISYPMENGVIKNWSDM 84
            +    N   PL             D  IG+EA A     SY  +SYP+ +G I+NW  M
Sbjct: 69  TSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSY-SLSYPIRHGQIENWDHM 127

Query: 85  ELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYELPDGRVI 251
             RG          T  +IK++  YV  D+       D    +    +VEN E    +++
Sbjct: 247 RERG---ETDTSLRTAERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQEKTQKKIV 303

Query: 252 KVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMY 309
            VG ERF APE  F P +   D   P +  ++ +TIQA  +DVR  LY  IVLSGGS+M+
Sbjct: 304 DVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL++++K +   R+ +++    ++     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWQEMGPSAMSKF 388
           K +   +K++++E GP  +  F
Sbjct: 423 KSYCH-TKKDYEEYGPEIVRNF 443

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score =  169 bits (427), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 126/447 (28%), Positives = 211/447 (47%), Gaps = 72/447 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVV------------------ 48
           +V+D GTG  K+G AG + P + FP+ +        +++ VV                  
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQASNTKKSTVVNKSSAGGADSSGSGYFGN 68

Query: 49  --------------------------TPLKDIMIGDEASAV---RSYLQISYPMENGVIK 79
                                     T   D  IG+EA A    +SY  +SYP+ +G ++
Sbjct: 69  STSATSFNSGDMSSLLLSNNLAGKRGTEDLDFYIGNEALAAAQGQSY-SLSYPIRHGQVE 127

Query: 80  NWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAI 139
           NW  ME  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+A+
Sbjct: 128 NWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAV 186

Query: 140 QAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRH 191
           QAVLAL A                       TH++PV E  V+    + + +AGRD+T  
Sbjct: 187 QAVLALAASWTSPKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLF 246

Query: 192 LIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYELP 246
           +  LL  RG    +    +T  +IK++  YV  D+       D   ++    +VE+ E  
Sbjct: 247 IQQLLRERG---EQDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVVESQEKT 303

Query: 247 DGRVIKVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSG 304
             +++ VG ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IVLSG
Sbjct: 304 RKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSG 362

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDP---SRLEKFKVRIEDPPRRKHMVFIGGAVLA 361
           GS+M+     RL++++K +   R+ +++    ++     V++    ++++ V+ GG++LA
Sbjct: 363 GSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGGSLLA 422

Query: 362 NIMADKDHMWLSKQEWQEMGPSAMSKF 388
                K +   +K+++ E GP  +  F
Sbjct: 423 QTAEFKSYCH-TKKDYDEYGPEIVRNF 448

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  169 bits (427), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 126/441 (28%), Positives = 208/441 (47%), Gaps = 65/441 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLK-------------- 52
           +V+D GTG  K+G AG + P + FP+ +        ++++ V                  
Sbjct: 9   VVMDNGTGLTKLGFAGNDAPSWVFPTAIATAAPSNTKKSSGVGATSATGSEASYFGNATS 68

Query: 53  -------------------------DIMIGDEA---SAVRSYLQISYPMENGVIKNWSDM 84
                                    D  IG+EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++  YV  D+       D   ++    +VEN E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGSERFEAPECLFQPNLVDVEQPGVGEMLFN-TIQAADVDVRSALYRAIVLSGGSSMYP 310
            +G ERF APE  F P +   +      M+ + TIQA  +DVR  LY  IVLSGGS+M+ 
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTPLPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 363

Query: 311 GLPSRLEKELKQLWFTRVLRND---PSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADK 367
               RL+++LK +  +R+ +++    ++     V +    ++++ V+ GG++LA     K
Sbjct: 364 DFGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFK 423

Query: 368 DHMWLSKQEWQEMGPSAMSKF 388
            +   +K++++E GP  +  F
Sbjct: 424 GYCH-TKKDYEEYGPEIVRNF 443

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  168 bits (426), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 128/442 (28%), Positives = 208/442 (47%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVV------------------ 48
           +V+D GTG  K+G AG + P + FP+ +        ++A+ V                  
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGASSAAGSDTSYFGNSTS 68

Query: 49  ---------------------TPLKDIMIGDEA---SAVRSYLQISYPMENGVIKNWSDM 84
                                T   D  IG+EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGVTGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++  YV  D+       D   ++    +VEN E    + +
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKAV 303

Query: 252 KVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IVLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL+++LK +   R+ +++    ++     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWQEMGPSAMSKF 388
           K +   +K++++E GP  +  F
Sbjct: 423 KGYCH-TKKDYEEYGPEIVRNF 443

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  168 bits (425), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 131/449 (29%), Positives = 209/449 (46%), Gaps = 74/449 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPIL-RAEERANVVTPLK------------- 52
           +V+D GTG  K+G AG + P + FP+ +      +++  +N  T                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQSGKSQSSSNKSTGFGSSSANAQSSYLSG 68

Query: 53  --------------------------------DIMIGDEA---SAVRSYLQISYPMENGV 77
                                           D  IG+EA   S   SY  +SYP+ +G 
Sbjct: 69  GGNSTSATDFNSLASSTLISNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQ 127

Query: 78  IKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYV 137
           ++NW  ME  W+ + +  ++         +LTEPP+NP  NR+Q+ E+ FE ++  G+Y+
Sbjct: 128 VENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENRQQVAEIFFESFNCAGLYI 186

Query: 138 AIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVT 189
           A+QAVLAL A                       TH++PV E  V+    + + +AGRD+T
Sbjct: 187 AVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT 246

Query: 190 RHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYE 244
             +  LL  RG    + A   T  +IK++  YV  D+       D    +    +VEN E
Sbjct: 247 LFIQSLLRERG---EQDASLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKE 303

Query: 245 LPDGRVIKVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVL 302
               +V+ VG ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IVL
Sbjct: 304 RTTKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLYNNIVL 362

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---SRLEKFKVRIEDPPRRKHMVFIGGAV 359
           SGGS+M+     RL+++LK +   R+ +++    +R     V +    R+++ V+ GG++
Sbjct: 363 SGGSTMFKDFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWFGGSL 422

Query: 360 LANIMADKDHMWLSKQEWQEMGPSAMSKF 388
           LA     K +   +KQ+++E GP  +  F
Sbjct: 423 LAQTGEFKSYCH-TKQDYEEYGPDIVRNF 450

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score =  167 bits (424), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 124/450 (27%), Positives = 214/450 (47%), Gaps = 74/450 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------GRPILRAEERANVVTPL-- 51
           +V+D GTG  K+G AG + P + FP+ +             G     ++ +AN  + +  
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQPSNSSGKSTGGGNTSSQSQANTSSGVIG 68

Query: 52  ---------------------------------KDIMIGDEA--SAVRSYLQISYPMENG 76
                                             D  IG+EA  +A      +SYP+++G
Sbjct: 69  SYFGNSTSATSFNNFASSLLLSNNLAGKRGTEDLDFYIGNEALTAAQGPAYSLSYPIKHG 128

Query: 77  VIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVY 136
            ++NW+ ME  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y
Sbjct: 129 QVENWNHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLY 187

Query: 137 VAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDV 188
           +A+QAVLAL A                       TH++PV E  V+    + + +AGRD+
Sbjct: 188 IAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDI 247

Query: 189 TRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENY 243
           T  +  LL  RG         +T  +IK++  YV  D+       D  + + +  ++EN 
Sbjct: 248 TLFIQSLLRERGEV---DTSLKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFIIENQ 304

Query: 244 ELPDGRVIKVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIV 301
                +++ VG ERF APE  F P +   D   P +  ++ +TIQA  +DVR  LY  IV
Sbjct: 305 GKTQKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYSNIV 363

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRND---PSRLEKFKVRIEDPPRRKHMVFIGGA 358
           LSGGS+M+     RL+++L+ +   R+ +++    ++     V++    R+++ V+ GG+
Sbjct: 364 LSGGSTMFKDFGRRLQRDLRSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGS 423

Query: 359 VLANIMADKDHMWLSKQEWQEMGPSAMSKF 388
           +LA     K +   +K++++E GP  +  F
Sbjct: 424 LLAQTAEFKSYCH-TKRDYEEYGPEIVRNF 452

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score =  167 bits (423), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 130/448 (29%), Positives = 213/448 (47%), Gaps = 73/448 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV--GRPILRAEER-------------------- 44
           +V+D GTG  K+G AG + P + FP+ +   +P   A+                      
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSKTAKSSSMSGMGQSGSGMGAGGSAFF 68

Query: 45  ANVVTPLK-----------------------DIMIGDEASAVR---SYLQISYPMENGVI 78
            N  +                          D  IG+EA A     SY  +SYP+ +G +
Sbjct: 69  GNTTSATSFTGFTSSSLMSNNLAGKRGTEDLDFYIGNEALAAAQGPSY-SLSYPIRHGQV 127

Query: 79  KNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVA 138
           ++W+ ME  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+A
Sbjct: 128 EDWNHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIA 186

Query: 139 IQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTR 190
           +QAVLAL A                       TH++PV E  V+    + + +AGRD+T 
Sbjct: 187 VQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITL 246

Query: 191 HLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLD-TKLARETTT----LVENYEL 245
            +  LL  RG          T  +IK++  YV  D+  +  K  R+ T     +VEN E 
Sbjct: 247 FIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDATKFAQFIVENKEK 303

Query: 246 PDGRVIKVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVLS 303
              +V+ VG ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IVLS
Sbjct: 304 TQKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLS 362

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRND---PSRLEKFKVRIEDPPRRKHMVFIGGAVL 360
           GGS+M+     RL+++L+ +   R+ +++    ++    +V++    R+++ V+ GG++L
Sbjct: 363 GGSTMFKDFGRRLQRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVWFGGSLL 422

Query: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKF 388
           A     K +   +K++++E GP  +  F
Sbjct: 423 AQTAEFKSYCH-TKKDYEEYGPQIVRNF 449

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score =  167 bits (423), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 127/453 (28%), Positives = 208/453 (45%), Gaps = 77/453 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------------- 34
           +V+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSNAKQTSSNAVSAGASSVANTGQSSGS 68

Query: 35  GRPILRAEERANVVTPLK-------------------DIMIGDEA--SAVRSYLQISYPM 73
           GR        A     L                    D  IG+EA  +A      +SYP+
Sbjct: 69  GRQYFGNSTSATAFNSLSSGSALMSNNLAGKRGTEDLDFYIGNEALIAAQGPSYGLSYPI 128

Query: 74  ENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFG 133
            +G ++NW  ME  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  
Sbjct: 129 RHGQVENWDHMERFWENSIFKYLRTEPEDHC-FLLTEPPLNPPENREQVAEIFFESFNCA 187

Query: 134 GVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAG 185
           G+Y+A+QAVLAL A                       TH++PV E  V+    + + +AG
Sbjct: 188 GLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAG 247

Query: 186 RDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLV 240
           RD+T  +  LL  RG          T  +IK++  YV  D+       D    +    +V
Sbjct: 248 RDITLFIQQLLRERG---EEDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFVV 304

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYR 298
           E+ E    +V+ VG ERF APE  F P +   D   P +  ++ +TIQA  +DVR  LY 
Sbjct: 305 ESQEKTRRKVVDVGCERFMAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYN 363

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND---PSRLEKFKVRIEDPPRRKHMVFI 355
            IVLSGGS+M+     RL+++LK +   R+++++    ++     V++    ++++ V+ 
Sbjct: 364 NIVLSGGSTMFKDFGRRLQRDLKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQRNAVWF 423

Query: 356 GGAVLANIMADKDHMWLSKQEWQEMGPSAMSKF 388
           GG++LA     K +   +K++++E+GP  +  F
Sbjct: 424 GGSLLAQTAEFKSYCH-TKKDYEEIGPEIVRNF 455

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score =  165 bits (418), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 130/447 (29%), Positives = 206/447 (46%), Gaps = 72/447 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------GRPILRA 41
           +V+D GTG  K+G AG + P + FP+ +                         G P    
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGGSSSNAKKSMSSSAASSATAGNPYYGN 68

Query: 42  EERANVV-------------------TPLKDIMIGDEA---SAVRSYLQISYPMENGVIK 79
              A                      T   D  IG+EA   S   SY  +SYP+ +G ++
Sbjct: 69  STSATSFNDNNLSSMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVE 127

Query: 80  NWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAI 139
           NW  ME  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++  G+Y+A+
Sbjct: 128 NWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAV 186

Query: 140 QAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDVAGRDVTRH 191
           QAVLAL A                       TH++PV E  V+    + + +AGRD+T  
Sbjct: 187 QAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLF 246

Query: 192 LIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTTLVENYELP 246
           +  LL  RG A        T  +IK++  YV  D+       D    +    +VEN E  
Sbjct: 247 IQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST 303

Query: 247 DGRVIKVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSG 304
             +++ VG ERF APE  F P +   D   P +  ++  TIQA  +DVR  LY  IVLSG
Sbjct: 304 RKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSG 362

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRND---PSRLEKFKVRIEDPPRRKHMVFIGGAVLA 361
           GS+M+     RL+++LK +   R+ +++    ++     V++    ++++ V+ GG++LA
Sbjct: 363 GSTMFKDFGRRLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLA 422

Query: 362 NIMADKDHMWLSKQEWQEMGPSAMSKF 388
                K +   +K+++ E GP  +  F
Sbjct: 423 QTAEFKGYCH-TKKDYDEYGPEIVRNF 448

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score =  164 bits (415), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/357 (31%), Positives = 187/357 (52%), Gaps = 28/357 (7%)

Query: 53  DIMIGDEA---SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLT 109
           D  IG+EA   S   SY  +SYP+ +G I+NW  ME  W+ + +  ++         +LT
Sbjct: 105 DFYIGNEALIASQGPSY-SLSYPIRHGQIENWDHMERFWENSIFKYLR-AEPEDHFFLLT 162

Query: 110 EPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX------- 162
           EPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLAL A                      
Sbjct: 163 EPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQVTDRSLTGTVIDSGDG 222

Query: 163 -THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSY 221
            TH++PV E  V+    + + +AGRD+T  +  LL  RG A        T  +IK++  Y
Sbjct: 223 VTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAERIKQEYCY 279

Query: 222 VSYDL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPNLV--DVEQ 274
           V  D+       D +  +    ++EN +    +V+ +G ERF APE  F P +   D   
Sbjct: 280 VCPDIVKEFNKFDRQPEKFAQFIIENQDKTKQKVVDIGYERFLAPEIFFNPEIASSDFLT 339

Query: 275 PGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP- 333
           P +  ++ +TIQA  +DVR  LY  IVLSGGS+M+     RL++++K +  +R+++N+  
Sbjct: 340 P-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEAV 398

Query: 334 --SRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGPSAMSKF 388
              +     V++    ++++ V+ GG++LA     K +   +K++++E GP  +  F
Sbjct: 399 TGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 454

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 7  IVLDQGTGFVKIGRAGENFPDYTFPSIVG 35
          IV+D GTG  K+G AG + P + FP+ + 
Sbjct: 9  IVMDNGTGLTKLGYAGNDSPSWIFPTSIA 37

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score =  163 bits (412), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 134/457 (29%), Positives = 209/457 (45%), Gaps = 84/457 (18%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTF---------------------------PSIVGR--- 36
           +V+D GTG  K+G AG + P + F                           PS  G    
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQSSNTKKASSSSSSSAAALGPSNTGTSAN 68

Query: 37  ----PILRAEERANVVTPLK------------------DIMIGDEA---SAVRSYLQISY 71
               P       A     L                   D  IG+EA   S   SY  +SY
Sbjct: 69  SSATPYFGNSTSATSFNNLNKNMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSY 127

Query: 72  PMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYD 131
           P+ +G ++NW  ME  W+ + +  ++         +LTEPP+NP  NREQ+ E+ FE ++
Sbjct: 128 PIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQIAEIFFESFN 186

Query: 132 FGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLNHLTRRLDV 183
             G+Y+A+QAVLAL A                       TH++PV E  V+    + + +
Sbjct: 187 CAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPI 246

Query: 184 AGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDL-----DLDTKLARETTT 238
           AGRD+T  +  LL  RG         +T  +IK++  YV  D+       D   ++    
Sbjct: 247 AGRDITLFIQSLLRERGEV---DTSLKTAERIKQEYCYVCPDIVKEFNKFDRDGSKFAQF 303

Query: 239 LVENYELPDGRVIKVGSERFEAPECLFQPNLV--DVEQPGVGEMLFNTIQAADVDVRSAL 296
           +VEN E    +V+ VG ERF APE  F P +   D   P +  ++ +TIQA  +DVR  L
Sbjct: 304 IVENQEQTRKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGL 362

Query: 297 YRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFK-----VRIEDPPRRKH 351
           Y  IVLSGGS+M+     RL+++LK +   R+ +++  RL   K     V++    ++++
Sbjct: 363 YNNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSE--RLSGTKSTGVDVQVISHRKQRN 420

Query: 352 MVFIGGAVLANIMADKDHMWLSKQEWQEMGPSAMSKF 388
            V+ GG++LA     K +   +K++++E GP  +  F
Sbjct: 421 AVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 456

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  162 bits (409), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 184/356 (51%), Gaps = 26/356 (7%)

Query: 53  DIMIGDEA--SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTE 110
           D  IG+EA  +A      +SYP+ +G ++NW  ME  W+ + +  ++         +LTE
Sbjct: 103 DFYIGNEALVAAQSPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHYFLLTE 161

Query: 111 PPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX-------- 162
           PP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       
Sbjct: 162 PPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGV 221

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV 222
           TH++PV E  V+    + + +AGRD+T  +  LL  RG A        T  +IK++  YV
Sbjct: 222 THVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLLRERGEA---DTSLRTAERIKQEYCYV 278

Query: 223 SYDL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPNLV--DVEQP 275
             D+       D +  +    +VE+ E    +V+ VG ERF APE  F P +   D   P
Sbjct: 279 CPDIVKEFNKFDRQPEKFAQFIVESQEKTKQKVVDVGYERFLAPEIFFNPEIASSDYLTP 338

Query: 276 GVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP-- 333
            +  ++  TIQA  +DVR  LY  IVLSGGS+M+     RL++++K +   R+ +N+   
Sbjct: 339 -LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDMKSIVNARISQNEKMT 397

Query: 334 -SRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGPSAMSKF 388
             +     V++    ++++ V+ GG++LA     + +   +K++++E+GP  +  F
Sbjct: 398 GVKSSGVDVQVISHRKQRNAVWFGGSLLAQTAEFRGYCH-TKRDYEEIGPEIVRNF 452

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 1  MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVG 35
          M+L   +V+D GTG  K+G AG + P + FP+ + 
Sbjct: 1  MNLNPAVVMDNGTGLTKLGFAGNDSPSWIFPTAIA 35

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score =  159 bits (401), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 182/356 (51%), Gaps = 26/356 (7%)

Query: 53  DIMIGDEA--SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTE 110
           D  IG+EA  ++  +   ++YP+ +G ++NW  ME  W+ + +  ++         +LTE
Sbjct: 106 DFYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTE 164

Query: 111 PPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX-------- 162
           PP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       
Sbjct: 165 PPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGV 224

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV 222
           TH++PV E  V+    + + +AGRD+T+ +  LL  RG          T  +IK++  YV
Sbjct: 225 THVIPVAEGYVIGSALKNIPIAGRDITQFIQSLLRERGEV---DTSLRTAERIKQEYCYV 281

Query: 223 SYDL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPNLV--DVEQP 275
             D+       D    +    +VEN +    +V+ +G ERF APE  F P +   D   P
Sbjct: 282 CPDIVKEFNKFDRDAEKFAQYVVENQDKTRQKVVDIGYERFLAPEIFFNPEIASSDFLTP 341

Query: 276 GVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVL---RND 332
            +  +L  TIQA  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+    R  
Sbjct: 342 -LPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLS 400

Query: 333 PSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGPSAMSKF 388
            +R     V++    ++++ V+ GG++LA     K +   +K++++E GP  +  F
Sbjct: 401 GARSTGVDVQVISHRKQRNAVWFGGSLLAQTPEFKGYCH-TKKDYEEYGPEIVRNF 455

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 7  IVLDQGTGFVKIGRAGENFPDYTFPS 32
          +V+D GTG  K+G AG + P + FP+
Sbjct: 9  VVMDNGTGLTKLGFAGNDSPSWIFPT 34

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 88/371 (23%), Positives = 146/371 (39%), Gaps = 72/371 (19%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERANVVTPLKDIMIGDEA 60
           TPI++D G+  VK G A  + P     ++     G P L     +N V+ LKDI      
Sbjct: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------ 52

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYD----QMKLPSTSGGKVMLTEPPMNPL 116
               S +Q   P E G + +W     +WDY  Y+      ++ +T G  ++L+E  M+  
Sbjct: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108

Query: 117 RNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXXXX-------------- 161
              +   +V+FE+Y+FG  +   +   +    Q L                         
Sbjct: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168

Query: 162 -----------XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 210
                       T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226

Query: 211 TVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD-------------------GRVI 251
            V  IKEK  ++S     ++   +E TT    Y LPD                    + I
Sbjct: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284

Query: 252 KVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPG 311
           K+  E F  PE  F P +  + +PG+ E +  +I      +R  +    V++GG+     
Sbjct: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344

Query: 312 LPSRLEKELKQ 322
              RL  EL++
Sbjct: 345 FARRLATELQR 355

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 90/385 (23%), Positives = 150/385 (38%), Gaps = 68/385 (17%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           P+V+D G+  VK G +  + P +   + + R    A   +N +  +KDI          S
Sbjct: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRNRE 120
            +    P E G + +W     +WDY F+     D   L  + G  ++ +E  M      +
Sbjct: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113

Query: 121 QMCEVMFEKYDFGGVYVA-----------IQAVLALYAQGLXXXXXXXXXXX-------- 161
            M +V+FE+Y+F  +  A            +    +  +G                    
Sbjct: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMV 173

Query: 162 ------XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQI 215
                  T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231

Query: 216 KEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG-------------------SE 256
           KEK  ++S     D+  A++  T VE Y LPD +   +G                    E
Sbjct: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289

Query: 257 RFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRL 316
            F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349

Query: 317 EKEL-KQL---WFTRVLRNDPSRLE 337
             EL +QL   W  ++    P   E
Sbjct: 350 ATELQRQLPTDWSAKIYLPQPKSCE 374

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 91/189 (48%), Gaps = 9/189 (4%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64
           + +V+D G+    IG +G +FP    PS+ G+  L A+E +  +   + I I       R
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--LTADENSKKMFSEQSIGIP------R 66

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCE 124
              ++   +ENG++ +W   +  W +A  +++ L S SG   +LTEP  N + NR++  E
Sbjct: 67  KDYELKPIIENGLVIDWDTAQEQWQWALRNELYLDSNSGIPALLTEPVWNSMENRKKSLE 126

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVA 184
           V+ E   F   Y+A  +    +A G               + P+ + + L+  TRR  +A
Sbjct: 127 VLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIA 186

Query: 185 GRDVTRHLI 193
           G+ +  HLI
Sbjct: 187 GKFIN-HLI 194

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 65/110 (59%), Gaps = 12/110 (10%)

Query: 273 EQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+  +++++I ++DVD+R+ L   +VL+GG+S  PGL  RL  EL ++         
Sbjct: 380 ELAGLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKIL-------- 431

Query: 333 PSRLEKFKVRIEDPPR-RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
           PS   KF++      R R++  ++GG++L + +     +W+ KQE++E+G
Sbjct: 432 PSL--KFRILTTGHIRERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 478

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 83.6 bits (205), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 91/191 (47%), Gaps = 6/191 (3%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPL-KDIMIGDEASAV 63
           T IV+D G+    IG +G + P+   PS  G+    A+E     T +  +  IG      
Sbjct: 13  TSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIG----LA 68

Query: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMC 123
           R   +I   +ENG I +W   +  WD+   +++ L S SG  V+LTEP  N + NR++  
Sbjct: 69  RPDYEIKRIVENGEIADWDTAQEQWDWVLKNELFLKSNSGIPVLLTEPIWNSVENRKKSL 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           EV+ E  DF   Y++  +    +A G             T + PV + + L+  + R  +
Sbjct: 129 EVLLEGMDFEACYLSPVSTCVSFAAGRPNCLVVDIGHDTTSVSPVIDGMTLSKSSTRNFI 188

Query: 184 AGRDVTRHLID 194
           AGR +  HLI+
Sbjct: 189 AGRYI-NHLIE 198

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 77/159 (48%), Gaps = 21/159 (13%)

Query: 229 DTKLARETTTLVENYELPDGRVIK---VGSERFEAPECLFQPNLVDVEQPGVGEMLFNTI 285
           +T  + E+T   E       R I+     + + E  E     N VD+   G+ +++  +I
Sbjct: 362 ETAASGESTNTSETVNENGKRPIEDTTTSTAKNEDSEVSSNGNGVDI--IGIADLVQRSI 419

Query: 286 QAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIED 345
             +DVD+R++L   +V++GG+S  P L  RL  EL +            RL   K RI  
Sbjct: 420 LDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSK------------RLPALKFRILT 467

Query: 346 PPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
                 +++  ++GG++L + +     +W+ K+E++E+G
Sbjct: 468 TGHLREKQYQAWLGGSILTS-LGTFHQLWVGKEEYKEVG 505

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 89/378 (23%), Positives = 148/378 (39%), Gaps = 70/378 (18%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PIV+D G+  +K G A  N P +T  + + +        +N V  +KDI          S
Sbjct: 5   PIVIDNGSYEIKFGTASSNEP-FTALNSIAKDKYGNYHLSNQVRSIKDI----------S 53

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRNRE 120
            +  + P + G + +W     +WDY  +     D   L +T    ++ +E  M      +
Sbjct: 54  SVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSK 113

Query: 121 QMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXXXX------------------ 161
            M +V+FE+Y++  ++ A +   +   A+G                              
Sbjct: 114 NMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYE 173

Query: 162 --------XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVR 213
                    T +VPV + V      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 174 LVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILVN 231

Query: 214 QIKEKLSYVSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKVG 254
            IKEK  ++S +   D+  +R  T   + Y LPD                    + I + 
Sbjct: 232 SIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQ 289

Query: 255 SERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPS 314
            E F  PE  F P +  +  PG+ E +  +I      +R  L   +V++GG+   P   S
Sbjct: 290 DELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFAS 349

Query: 315 RLEKELKQL----WFTRV 328
           RL  EL++     W  RV
Sbjct: 350 RLATELQRQCPTDWSCRV 367

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 101/231 (43%), Gaps = 13/231 (5%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G +FP    PS+ G+     + +    T   +  IG    
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSK----TIFSEQSIG---- 63

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQ 121
             R   ++   +ENG++ +W   +  W +A  +++ L S SG   +LTEP  N   NR++
Sbjct: 64  IPRKDYELKPIIENGLVIDWDTAQEQWQWALKNELYLDSNSGIPALLTEPVWNSTENRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + L+  TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKL 232
            +AG+      I+ L ++            ++Q K KL    +D ++D  L
Sbjct: 184 FIAGK-----FINHLIKKAIEPKEIIPLFAIKQRKPKLIKKIFDYEIDQSL 229

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 66/110 (60%), Gaps = 12/110 (10%)

Query: 273 EQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ ++++++I ++DVD+R+ L   +VL+GG+S  PGL  RL  EL ++         
Sbjct: 381 EITGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKIL-------- 432

Query: 333 PSRLEKFKVRIEDPPR-RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
           PS   KF++      R R++  ++GG++L + +     +W+ KQE++E+G
Sbjct: 433 PSL--KFRILTTGHTRERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 479

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 117/293 (39%), Gaps = 27/293 (9%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D  T +++D G+    IG +G ++P    PS  G       E     T  K I       
Sbjct: 12  DEITAVIIDPGSFSTNIGYSGTDYPQSILPSSYGT-YKETTEGQESTTKRKRIFSESSIQ 70

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQ 121
             R   +I   +ENG I +W   +  W +A   Q+ L STSG   +LTEP  N + NR++
Sbjct: 71  IPRPDYEIKRIVENGSIMDWDAAQEQWSWALKSQLHLQSTSGIPALLTEPIWNSVENRKK 130

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             E++ E  +F   Y++       +A G             T + PV + + L+  + R 
Sbjct: 131 SLEILLEGMNFEACYLSSVPTCVSFAAGRPNCLVVDIGHDTTSVSPVVDGMTLSKSSMRN 190

Query: 182 DVAGRDVT---------RHLIDLLS---RRGYAFNRSADF-------------ETVRQIK 216
            +AG+ +          R +I L S   RR     R+ D+             E  ++ K
Sbjct: 191 FIAGKYINTLIEKYLQPREIIPLFSIKQRRPEFIKRTFDYTVDSSLYQYANEHEFFQECK 250

Query: 217 EKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSE-RFEAPECLFQPN 268
           E L  ++    L+    +  T    + E P    +   +E RF   E LF PN
Sbjct: 251 ETLCQITSTGSLEKNKDQLKTISSRSIEAPWAEELVFENETRFGFGEELFVPN 303

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 63/120 (52%), Gaps = 22/120 (18%)

Query: 271 DVEQP------GVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLW 324
           D+ +P      G+ +++++ I  +DVD+R++L   +VL+GGSS  PGL  RL  EL +  
Sbjct: 381 DISEPTKNDIAGLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNR-- 438

Query: 325 FTRVLRNDPSRLEKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
                     RL   K RI        R++  ++GG++L + +     +W+ K E+ E+G
Sbjct: 439 ----------RLPALKFRILSTGHTKERQYQAWLGGSILTS-LGTFHQLWVGKNEYNEVG 487

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 102/231 (44%), Gaps = 13/231 (5%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G +FP    PS+ G+    A+E    +   + I I     
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--YTADEGNKKIFSEQSIGIP---- 65

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQ 121
             R   ++   +ENG++ +W   +  W +A  +++ L S SG   +LTEP  N   NR++
Sbjct: 66  --RKDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + L+  TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKL 232
            +AG+      I+ L ++            ++Q K +    ++D ++D  L
Sbjct: 184 FIAGK-----FINHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSL 229

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 62/109 (56%), Gaps = 16/109 (14%)

Query: 276 GVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           G+ ++++++I ++DVD+R+ L   +VL+GG+S  PGL  RL  EL ++            
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKI------------ 431

Query: 336 LEKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
           L   K RI        R++  ++GG++L + +     +W+ K+E++E+G
Sbjct: 432 LPSLKFRILTTGHTIERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score = 80.5 bits (197), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 93/368 (25%), Positives = 144/368 (39%), Gaps = 74/368 (20%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLK--DIMIGDEASAVR 64
           +V+D G+  +K G +G + P            LRA    N +T  K     + ++   +R
Sbjct: 6   LVIDNGSYEIKFGESGWDQP------------LRA---LNCLTKDKYSRFHLSNQTKKMR 50

Query: 65  SYLQ--ISYPMENGVIKNWSDMELLWDYAFYDQMKLP-------STSGGKVMLTEPPMNP 115
              Q  I  P E G + +W     +WDY FY++            T    ++++E  M  
Sbjct: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110

Query: 116 LRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX--------------- 160
               + M +V+FE+YDF  ++    A    + QG                          
Sbjct: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170

Query: 161 ---XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKE 217
                T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE
Sbjct: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKE 228

Query: 218 KLSYV---SYDLDLDTKLARETTTLVENYELPD------GRVIKVGSER----------- 257
           + ++V   SY      K+     T VE Y LPD      G V K G E+           
Sbjct: 229 QCTFVPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLT 283

Query: 258 ---FEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPS 314
              F  PE  F P +  + +PG+ E +   I      VR  L   IV +GG+   P    
Sbjct: 284 DEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHE 343

Query: 315 RLEKELKQ 322
           RL+ EL++
Sbjct: 344 RLQTELQR 351

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 86/372 (23%), Positives = 143/372 (38%), Gaps = 72/372 (19%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64
           TP+V+D G+  VK G A    P Y   + +      A   +N +  +KDI          
Sbjct: 4   TPVVIDNGSYRVKFGPASLEAP-YCALNAIANDKYDASYLSNQIKSIKDI---------- 52

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MKLPSTSGGKVMLTEPPMNPLRNR 119
           S + I  P   G + +W    L+WDY  Y+        +  T    ++ +E  M      
Sbjct: 53  SSVSIKRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX---------------------- 157
           + M +V+FE+Y+FG +   +++ +A Y   L                             
Sbjct: 113 KNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169

Query: 158 -----XXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 212
                     T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227

Query: 213 RQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD----------------------GRV 250
             IKEK  +VS     D+   ++ T+    Y LPD                       + 
Sbjct: 228 NNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYP 310
           I +  E F  PE  F P +  + +PG+ E +  ++      +R  +   I+  GG+   P
Sbjct: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345

Query: 311 GLPSRLEKELKQ 322
              SR+ KEL++
Sbjct: 346 HFASRVAKELQR 357

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 122/295 (41%), Gaps = 36/295 (12%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64
           + +V+D G+    IG +G +FP    PS+ G+    A+E        K+I         R
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--YTADEGK------KNIFSEQSIGIPR 66

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCE 124
              ++   +++G++ +W   +  W +A  +++ L S SG   +LTEP  N   NR++  E
Sbjct: 67  KDYELKPIVKDGLVIDWDTAQEQWQWALKNELYLNSNSGTPALLTEPVWNSTENRKKSLE 126

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVA 184
           V+ E   F   Y+A  +    +A G               + P+ + + L+  TRR  +A
Sbjct: 127 VLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFLA 186

Query: 185 GRDVTRHLID-------------LLSRRGYAFNRSADFETVRQI-------------KEK 218
           G+ +  HLI              +  R+     +S ++E  + I             KE 
Sbjct: 187 GKFI-NHLIKKALEPKEIIPLFAIKQRKPELIKKSFNYEVDKSIYDYANNRGFFQECKET 245

Query: 219 LSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSE-RFEAPECLFQPNLVDV 272
           L ++     L+   A  +TT   + E P    I   +E R+   E LF P   DV
Sbjct: 246 LCHICPTKTLEETKADLSTTTKRSIESPWNEEIVFDNETRYGFAEKLFLPKEDDV 300

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 64/114 (56%), Gaps = 16/114 (14%)

Query: 271 DVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLR 330
           D E  G+  +++++I ++DVD+R+ L   +VL+GG+S+ PGL  RL  EL ++       
Sbjct: 379 DNELIGLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKI------- 431

Query: 331 NDPSRLEKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
                L   K RI        R++  ++GG++L + +     +W+ K+E++E+G
Sbjct: 432 -----LPSLKFRILTTGHTMERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/362 (22%), Positives = 142/362 (39%), Gaps = 60/362 (16%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PIV+D G+  +K G      P   F + + R    +   +N +  +KDI          S
Sbjct: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MKLPSTSGGKVMLTEPPMNPLRNRE 120
            +    P E G + +W     +WDY F++        L  + G  ++++E  M      +
Sbjct: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX---------------------XXXXX 159
            M +V+FE+Y+F  ++ +  A  A + +                                
Sbjct: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173

Query: 160 XXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 219
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231

Query: 220 SYVSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKVGSERFEA 260
            +VS     ++   +E T +   Y LPD                    + +++  E F  
Sbjct: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289

Query: 261 PECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E +  ++      +R  +   IV +GG+   P   +RL  EL
Sbjct: 290 PETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349

Query: 321 KQ 322
           ++
Sbjct: 350 QR 351

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 87/379 (22%), Positives = 145/379 (38%), Gaps = 69/379 (18%)

Query: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63
            +P+++D G+  +K G   E  P     SI  +        +N V  +KDI         
Sbjct: 3   ESPLIIDNGSYEIKFGSGSEKEPHRALNSI-AKDKYGNYHLSNQVRSIKDI--------- 52

Query: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYD-----QMKLPSTSGGKVMLTEPPMNPLRN 118
            S +  + P E G + +W     +WDY  ++        + +T G  ++ +E  M     
Sbjct: 53  -SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPEL 111

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX------------------ 160
            + M +V+FE+Y+F  ++ A   V   +  G                             
Sbjct: 112 SKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDF 171

Query: 161 --------XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 212
                     + IVPV + V      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 172 QLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILV 229

Query: 213 RQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD------------GRVIKVGS----- 255
             IKE   ++S +   ++  +R  T   + Y LPD            G+V+   S     
Sbjct: 230 NSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVL 287

Query: 256 --ERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLP 313
             E F  PE  F P +  +   G+ E +  +I      +R  +   IV++GG+   P   
Sbjct: 288 QDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFA 347

Query: 314 SRLEKELKQL----WFTRV 328
           SRL  EL++     W  RV
Sbjct: 348 SRLATELQRQCPTDWSCRV 366

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 118/292 (40%), Gaps = 38/292 (13%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV- 63
           T +V+D G+    IG +G + P    PS  G+               KD +  +++  + 
Sbjct: 15  TAVVIDPGSFTTNIGYSGTDCPQAILPSCYGK----------YTEGEKDELFSEQSIGLP 64

Query: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMC 123
           R   +I   ++NG + +W   E  WD+A   +++  + SG   +LTEP  N   NR++  
Sbjct: 65  RKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETNSGMPALLTEPIWNSEENRKKSL 124

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           EV+ E  DF   Y+   A    +A G             T + PV + + L+  + R  +
Sbjct: 125 EVLLESMDFSACYLVPTATAVSFAMGRPTCLVVDIGHDVTSVCPVVDGMTLSKSSMRSYI 184

Query: 184 AG---RDVTRH---------LIDLLSRRGYAFNRSADFET-------------VRQIKEK 218
           AG    ++ R          L  +  RR     R  D+E               ++ KE 
Sbjct: 185 AGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIHPSLQKFVNERQFFQEFKET 244

Query: 219 LSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGS-ERFEAPECLFQPNL 269
           +  V+       K   ETT+   + E P G  +   S +R E  E LF P+L
Sbjct: 245 MLQVAPTSISKFKSEIETTS-KRSIEAPWGEELVYDSLQRLEFAEQLFTPDL 295

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 67/116 (57%), Gaps = 12/116 (10%)

Query: 273 EQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ ++++++I + DVD+R+ L   +V++GG+S  PGL  R+  EL         R+ 
Sbjct: 371 EVSGLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELN--------RSL 422

Query: 333 PSRLEKFKVRIEDPPR-RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGPSAMSK 387
           P+   KF++      R R++  ++GG++LA+ +     +W+ KQE+ E+G   + K
Sbjct: 423 PAL--KFRMLTSGQLRERQYQGWLGGSILAS-LGTFHQLWVGKQEYAEVGADRLLK 475

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 83/374 (22%), Positives = 148/374 (39%), Gaps = 68/374 (18%)

Query: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63
           + PIV+D G+  VK G +    P+    ++  +    A   +N +  +KDI         
Sbjct: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52

Query: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPS-----TSGGKVMLTEPPMNPLRN 118
            S + I  P E G + +W     +WDY F++  + P+     T G  ++++E  M     
Sbjct: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111

Query: 119 REQMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLXX 152
              M +VMFE+Y+F  ++ +  A                          +  + +Q +  
Sbjct: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171

Query: 153 -----XXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSA 207
                          T I+P+ + V      +++++ GR +     + +S R Y  + + 
Sbjct: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229

Query: 208 DFETVRQIKEKLSYVS-----------------YDL-DLDTKLARETTTLVENYELP-DG 248
           +   V  IKEK  ++S                 Y L D  T           N +LP + 
Sbjct: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS 289

Query: 249 RVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSM 308
           +VI +  E F  PE +F P +  + +PG+ E +  ++      +R  L   IV  GG+  
Sbjct: 290 QVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFN 349

Query: 309 YPGLPSRLEKELKQ 322
            P   SRL  EL++
Sbjct: 350 MPNFGSRLATELQR 363

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 93/203 (45%), Gaps = 20/203 (9%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64
           + +V+D G+    IG +G + P    PS  G     + ++ N  +  +D    DE++  R
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDCPHSILPSRYG-----SFKKTNKDSGDEDTK-SDESATKR 68

Query: 65  SYL-------------QISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEP 111
           +++             +I   +ENG + +W   +  W++A  +++ L ST G   +LTEP
Sbjct: 69  AHIFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNELFLESTKGIPALLTEP 128

Query: 112 PMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYES 171
             N  +NR++  E + E  +F   Y+A  +    +A G               + PV + 
Sbjct: 129 VWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRANCLVVDIGHDTCSVSPVVDG 188

Query: 172 VVLNHLTRRLDVAGRDVTRHLID 194
           + L+  TRR   AG+ +  HLI+
Sbjct: 189 MTLSKSTRRSFFAGKYIN-HLIE 210

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 62/109 (56%), Gaps = 16/109 (14%)

Query: 276 GVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           G+ +++ ++I A+DVD+R++L   + L+GG+S+ PGL  RL  EL             +R
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELN------------AR 447

Query: 336 LEKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
           L   K RI        R++  ++GG+VL + +     +W+ +QE++E+G
Sbjct: 448 LPALKFRILTTGHKKEREYQSWLGGSVLTS-LGTFHQLWVGRQEYEEVG 495

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/369 (21%), Positives = 142/369 (38%), Gaps = 65/369 (17%)

Query: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63
             P+++D G+  +K G + +  P +   + + +        +N +  +KDI         
Sbjct: 3   EAPLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI--------- 52

Query: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MKLPSTSGGKVMLTEPPMNPLRN 118
            S + I  P + G + +W     +WDY FY+       ++   S   ++LTE PM     
Sbjct: 53  -SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPEL 111

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH-------------- 164
                +V+FE+Y F  +Y A  A    + +              T+              
Sbjct: 112 SRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNL 171

Query: 165 ----------IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQ 214
                     I+P+ + V      +++D+ GR +   L + +S R Y     +    V  
Sbjct: 172 VIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESML--VNN 229

Query: 215 IKEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG-------------------- 254
           IKE   ++S  +       ++  T VE Y LPD +   +G                    
Sbjct: 230 IKENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIIL 287

Query: 255 -SERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLP 313
             E F  PE  F P + +V +PG+ E +  ++      +RS +   IV +GG+   P   
Sbjct: 288 EDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFG 347

Query: 314 SRLEKELKQ 322
           SR+  EL++
Sbjct: 348 SRIYTELQK 356

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 84/203 (41%), Gaps = 6/203 (2%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA---NVVTPLKDIMIGD 58
           D  T +++D G+    IG AG + P    PS  G  I  AEE     N     K   +  
Sbjct: 12  DEITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGE-IHEAEESTSEDNTEKTRKTRKVFS 70

Query: 59  EASAV--RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPL 116
           E S    R   ++   +ENG + +W      W +A  +++ + S  G   MLTEP  N  
Sbjct: 71  EQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNELHIESNRGIPAMLTEPLWNSK 130

Query: 117 RNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNH 176
            NR +  E++ E  +F   Y+   +    +A G               + PV + + L+ 
Sbjct: 131 ENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPNSLIVDIGHDIASVTPVIDGMSLSK 190

Query: 177 LTRRLDVAGRDVTRHLIDLLSRR 199
            TR    AGR + + L D L  R
Sbjct: 191 STRCNHFAGRFLNKLLTDYLKPR 213

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 66/113 (58%), Gaps = 18/113 (15%)

Query: 273 EQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELK----QLWFTRV 328
           E PG+ +++ ++I + DVD+R++L   +V++GGSS  PGL  R+  EL      L F RV
Sbjct: 385 ELPGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKF-RV 443

Query: 329 LRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
           L    S        IE    R++  ++GG++L++ +     +W+ K+E++E+G
Sbjct: 444 LATGQS--------IE----RQYQSWLGGSILSS-LGTFHQLWIGKKEYEEVG 483

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 83/198 (41%), Gaps = 7/198 (3%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G+     +E          IM      
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFMIM------ 65

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQ 121
             R   +I   +ENG + +W   +  W +A  D++K  S  G    LTE   NP  NR++
Sbjct: 66  -PRPDFEIKRILENGCVVDWEAAQEQWAWAIRDELKFESFKGTPAFLTEAIWNPEENRKK 124

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             EV+ E  +F   Y+A  A    +A G               + PV + + L+  + R 
Sbjct: 125 SLEVLLEGMEFEACYIAPTATCTSFAMGRPTCLVLDIGHDVASVCPVVDGMTLSKSSTRN 184

Query: 182 DVAGRDVTRHLIDLLSRR 199
            +AG+ + + + + L  R
Sbjct: 185 FLAGKLLNKLIENHLKPR 202

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 16/109 (14%)

Query: 276 GVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           G+ +++   I A DVD+R+ L   +V++GGSS  PGL  RL  EL +            +
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNK------------K 423

Query: 336 LEKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
           L   K RI        R+   ++GG++L++ +     +W+ +QE++E+G
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVG 471

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 77/189 (40%), Gaps = 5/189 (2%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D  T +V+D G+    IG +G + P    PS  G      E+ A      K I       
Sbjct: 12  DEITAVVIDPGSFSTNIGFSGTDCPQAILPSCYGEQKAETEDNAP-----KKIFAEQSIG 66

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQ 121
             R   +I   ++N ++ +W   E  W +A  D + L S SG   +LTEP  N L N+ +
Sbjct: 67  IPRPDYEIKPIVQNSMVVDWDAAEEQWSWALKDILYLNSNSGIPALLTEPIWNTLENKTK 126

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             E++ E   F   Y++       +A G             T + PV + + L+  T R 
Sbjct: 127 SLEILLESLQFEACYLSSTPTCVSFASGRPNCLVVDLGHDTTSVSPVVDGMTLSKSTMRN 186

Query: 182 DVAGRDVTR 190
            +AG  +  
Sbjct: 187 FLAGNCINE 195

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 59/110 (53%), Gaps = 16/110 (14%)

Query: 276 GVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           G  +++  +I A+DVD+R+ L   IVL+GG+S  PG   RL  EL +            +
Sbjct: 375 GAADLVNASILASDVDLRATLAHNIVLTGGTSSIPGFSDRLMSELNK------------K 422

Query: 336 LEKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGP 382
           L   K RI        R++  ++GG++L + +     +W+ KQE++E+GP
Sbjct: 423 LPALKFRILTTGHLRERQYQAWLGGSILTS-LGSFHQLWVGKQEYEEVGP 471

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 82/187 (43%), Gaps = 10/187 (5%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTP--LKDIMIGDE 59
           D  + +V+D G+    IG +G + P    PS  G       +  N   P   K  +  ++
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDCPQAILPSCYG-------DYTNTDDPEGKKKKVFSEQ 64

Query: 60  ASAV-RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRN 118
           +  + R   +I   +ENGV+ +W   +  W +A  +Q+ L S SG   +LTEP  N + N
Sbjct: 65  SICIPRKDYEIKPIVENGVVIDWDAAQEQWSWALENQLYLRSNSGIPALLTEPIWNTVEN 124

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLT 178
           R++  E++ E  DF   Y+A       +  G               + PV + + L+  T
Sbjct: 125 RKKSLELLLEGMDFEACYLASTPTCVSFGTGRSSCLVVDLGHDTCSVSPVVDGMTLSKST 184

Query: 179 RRLDVAG 185
           +R   AG
Sbjct: 185 KRNFFAG 191

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 16/109 (14%)

Query: 276 GVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           GV +++ ++I A+DVD+R+ L   +VL+GG+S  PGL  RL  EL             SR
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELN------------SR 427

Query: 336 LEKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
           L   K R+        R++  ++GG+VL + +     +W+ K+E+Q++G
Sbjct: 428 LPALKFRMITTGHTRERQYQSWLGGSVLTS-LGTFHQLWVGKEEYQDVG 475

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 87/389 (22%), Positives = 153/389 (39%), Gaps = 74/389 (19%)

Query: 3   LRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASA 62
           +R P++++ G+  +K G A    P Y   + + R        +N +  ++DI        
Sbjct: 1   MRVPLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI-------- 51

Query: 63  VRSYLQISYPMENGVIKNWSDMELLWDYAFYDQ----MKLPSTSGGKVMLTEPPMNPLRN 118
             S+  I  P E G + +W   E +WDY  ++      +L  +    ++ +E  M     
Sbjct: 52  --SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEI 109

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------XXXXXXXXX 159
            + M +V+FE+Y+FG +     A    + +                              
Sbjct: 110 SKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSG 169

Query: 160 XXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 219
              T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ 
Sbjct: 170 FNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQC 227

Query: 220 SY---VSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKVGSER 257
            +   VSY    D+   R+  T VE Y LPD                    +++++  E 
Sbjct: 228 CFMPPVSY---FDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDEL 282

Query: 258 FEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLE 317
           F  PE  F P + ++ +PG+ E +   +      +R  L   IV  GG+       +RL 
Sbjct: 283 FTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLA 342

Query: 318 KELKQLWFTRVLRNDPSRLEKFKVRIEDP 346
            EL+        R  P+    +KVR+  P
Sbjct: 343 TELQ--------RQCPT---DWKVRVHQP 360

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 82/386 (21%), Positives = 136/386 (35%), Gaps = 84/386 (21%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PIV+D G+  +K G +    P +   + + +        +N +  +KDI          S
Sbjct: 5   PIVIDNGSYEIKFGPSTNEKP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRNRE 120
            +    P E G +  W     +WDY F+     D   L    G  ++ +E  M      +
Sbjct: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX-------------------- 160
              +V+FE+Y+F  ++ +  A    + +                                
Sbjct: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173

Query: 161 ----------------------XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198
                                   T I+PV + +      ++LDV GR +T  L + LS 
Sbjct: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233

Query: 199 RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD----------- 247
           R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD           
Sbjct: 234 RHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYVRN 289

Query: 248 -----------GRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSAL 296
                       + I +  E F  PE  F P +  + +PG+ E +  ++      VR  +
Sbjct: 290 RRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLM 349

Query: 297 YRAIVLSGGSSMYPGLPSRLEKELKQ 322
              IV +GG+   P    RL  EL++
Sbjct: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 9/207 (4%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA---------EERANVVTPLK 52
           D  + +V+D G+    IG +G + P    PS  G   L+          EE +      K
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASNNKSK 71

Query: 53  DIMIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPP 112
            I      +  R+  +I   ++NG + +W   +  WD+A  + + L S SG    LTEP 
Sbjct: 72  KIFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPI 131

Query: 113 MNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESV 172
            N + NR++  EV+ E   F   Y++       +A G               + PV + +
Sbjct: 132 WNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFASGRPNCLVVDIGHDVASVSPVIDGM 191

Query: 173 VLNHLTRRLDVAGRDVTRHLIDLLSRR 199
            L+  + R  ++GR +   + + L  R
Sbjct: 192 TLSKSSMRNFISGRFINEKIKEFLKPR 218

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 18/111 (16%)

Query: 275 PGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSR----LEKELKQLWFTRVLR 330
           PG+ +++ ++I A DVD+R++L   IVL+GG+S  PG   R    L K+L  L F RVL 
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKF-RVLT 453

Query: 331 NDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
              +R             R++  ++GG++L++ +     +W+ KQE++E G
Sbjct: 454 TGQTR------------ERQYQAWLGGSILSS-LGTFHQLWVGKQEYEESG 491

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 84/189 (44%), Gaps = 13/189 (6%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV--R 64
           IV+D G+    IG +G + P    PS  G          NV T      I +E   +  R
Sbjct: 17  IVIDPGSFVTNIGYSGTDCPQSIMPSSYG----------NVETDGDTKRIFNEQPLLFPR 66

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCE 124
           + ++I   +EN  I +W   +  W+YA    +K  S  G  V+LTEP  N   +R++  E
Sbjct: 67  AGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKKSLE 126

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVA 184
           ++ E  +F   Y+A  +    +A G             + + PV + + L+  + R  VA
Sbjct: 127 ILLESMEFEACYLAANSSAVSFAMGRPTCLVVDIGHDVSTVSPVIDGMTLSKSSTRNYVA 186

Query: 185 GRDVTRHLI 193
           G+ +  HLI
Sbjct: 187 GKYLN-HLI 194

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 65/119 (54%), Gaps = 18/119 (15%)

Query: 273 EQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSR----LEKELKQLWFTRV 328
           E  G+ +++  ++  ADVD+R+ L   +VL+GG+S  PGL  R    L K L  L F R+
Sbjct: 412 EVAGIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKF-RM 470

Query: 329 LRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGPSAMSK 387
           L +   R             R++  ++GG++LA+ +     +W+ ++E++E+GP  + K
Sbjct: 471 LSSGHLR------------ERQYQGWLGGSILAS-LGTFHQLWVGREEYEEVGPERLLK 516

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 85/371 (22%), Positives = 138/371 (37%), Gaps = 62/371 (16%)

Query: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60
           M     IV+D G+  VK G A E  P     ++  +        +N V  +KDI      
Sbjct: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-AKDKYGVTHLSNQVQNIKDI------ 53

Query: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYD----QMKLPSTSGGKVMLTEPPMNPL 116
               S +    P E G + +W     +WDY  Y+     +   S     V+L+E  M   
Sbjct: 54  ----SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109

Query: 117 RNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXX---------------- 159
              +   +V+FE+Y+   +Y A   A +  Y                             
Sbjct: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169

Query: 160 -----------XXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSAD 208
                         T ++P+ + V      ++LDV GR +   L + +S R Y  N   +
Sbjct: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDE 227

Query: 209 FETVRQIKEKLSYV---SYDLDLDTKLARETTTLVENYE-------------LPD-GRVI 251
              V  IKE+  YV   SY      K   +   ++ +++             LPD  +++
Sbjct: 228 SILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287

Query: 252 KVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPG 311
            +  ERF  PE  F P +    +PG+ E +  +I      +R  +   IV  GG+   PG
Sbjct: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347

Query: 312 LPSRLEKELKQ 322
              RL  EL++
Sbjct: 348 FTDRLVSELQR 358

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 80/198 (40%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D  T +V+D G+    IG +G + P    PS  G          +       +      +
Sbjct: 12  DEITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLT 71

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQ 121
             R   +I   +ENG++ +W   +  WD+A  + + L S  G   ++TE   N + N+ +
Sbjct: 72  FPRPDYEIKPIVENGLVVDWDAAQEQWDWALRNVLHLESNKGVPALMTESIWNTMENKTK 131

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
             EV+ E  DF   Y++       +A G                 PV + + L+  TRR 
Sbjct: 132 SLEVLLETLDFEACYISSTPTCVSFATGRPNCLVVDVGHDTASSSPVVDGMTLSRSTRRN 191

Query: 182 DVAGRDVTRHLIDLLSRR 199
            ++G+ V + +   L  R
Sbjct: 192 FISGKFVDQLIGKYLQPR 209

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 61/112 (54%), Gaps = 16/112 (14%)

Query: 273 EQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +++ ++I +ADVD+R+ L   IVL+GGSS  PG   RL  EL +          
Sbjct: 375 ELAGISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTK---------- 424

Query: 333 PSRLEKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
             +L   K R+        R++  ++GG++L + +     +W+ K+E++E+G
Sbjct: 425 --KLPALKFRVLTTGHLRERQYQSWLGGSILTS-LGSFHQLWVGKREYEEVG 473

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 87/208 (41%), Gaps = 15/208 (7%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG-------------RPILRAEERANVVTPLKD 53
           +V+D G+    IG +G ++P    PS  G             +P   A       + +K 
Sbjct: 17  VVIDPGSFTTNIGFSGSDYPQSILPSCYGAITEIEDQQADHNKPDESAANNTENASKIKI 76

Query: 54  IMIGDEASA--VRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEP 111
             + +E S    R+  +I   ++NG + +W   +  W +A  +++ L S  G   +LTEP
Sbjct: 77  RKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALENELFLKSNEGVPALLTEP 136

Query: 112 PMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYES 171
             N + NR++  EV+ E   F   Y++       +A G               + PV + 
Sbjct: 137 IWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSFAAGRSNCLVVDIGHDIISVSPVVDG 196

Query: 172 VVLNHLTRRLDVAGRDVTRHLIDLLSRR 199
           +  +  TRR  ++G+ +   + D L  R
Sbjct: 197 MTFSKSTRRNVISGKYLNVLINDFLKPR 224

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 66/111 (59%), Gaps = 18/111 (16%)

Query: 275 PGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSR----LEKELKQLWFTRVLR 330
           PG+ +++ ++I AADVD+R++L   +VL+GG+S  PGL  R    L K L  L F RVL 
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKF-RVLA 455

Query: 331 NDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
           N  +R             R++  ++GG++L++ +     +W+ KQE++E+G
Sbjct: 456 NGQTR------------ERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEIG 493

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 89/392 (22%), Positives = 146/392 (37%), Gaps = 75/392 (19%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           P V+D G+  +K G A    P +   + + +    A   +N +  ++DI          S
Sbjct: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLP------STSGGKVMLTEPPMNPLRNR 119
              I  P E G + +W     +WDY  Y+  +        +T    ++LTE         
Sbjct: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-------------------- 159
           +   +V+FE+Y+F  ++ +  +    +A  +                             
Sbjct: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRD 171

Query: 160 --------XXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFET 211
                      T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229

Query: 212 VRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD--------------------GRV- 250
           +  IKEK  +VS     D+   ++   +   Y LPD                    G V 
Sbjct: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287

Query: 251 -IKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMY 309
            I +  ERF  PE  F P + ++ +PG+ E +   I      +R  L   IV  GG+   
Sbjct: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347

Query: 310 PGLPSRLEKEL-KQL---WFTRVLRNDPSRLE 337
           P + SRL  EL +QL   W  RV     S  E
Sbjct: 348 PHMSSRLTSELQRQLPTDWTCRVTVPSSSDCE 379

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 82/368 (22%), Positives = 148/368 (40%), Gaps = 58/368 (15%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PI++D G+  +K G +    P Y   + + R        +N +  ++++          S
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLARDKYGRYHLSNQMKQIREV----------S 52

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQ----MKLPSTSGGKVMLTEPPMNPLRNREQ 121
              +  P E G + +W   E +WDY  ++       L  +    ++++E  M+     + 
Sbjct: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112

Query: 122 MCEVMFEKYDFGGV-------YVAIQ--AVLALY-AQGL----------XXXXXXXXXXX 161
           M +V+FE+Y+FG +       Y+     A   +Y + GL                     
Sbjct: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFN 172

Query: 162 XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSY 221
            T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+  +
Sbjct: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCCF 230

Query: 222 ---VSY--------DLDLDTKLARETTTLVENYELP------DGRVIKVGSERFEAPECL 264
              VSY        +  +D  L    T+L+     P      D + + +  E F  PE  
Sbjct: 231 MPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETF 290

Query: 265 FQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQL- 323
           F P + ++ +PG+ E +  +I      +R  +   I + GG+       SRL  EL++  
Sbjct: 291 FHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQC 350

Query: 324 ---WFTRV 328
              W  RV
Sbjct: 351 PTDWSVRV 358

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 105/246 (42%), Gaps = 37/246 (15%)

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV 222
           T I+P+ + V      ++LD+ GR +T  L + LS R Y          V  IKEK  +V
Sbjct: 201 TWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETLL--VNNIKEKCLFV 258

Query: 223 SYDLDLDTKLARETTTLVENYELPD--------------------GRVIKVGSERFEAPE 262
           S     D+  A+E T++   Y LPD                     +V+K+  E F  PE
Sbjct: 259 SPTSYFDSFKAKEETSV--EYILPDISSSYLGYTRENKSKPLPEGSQVVKLYDELFSVPE 316

Query: 263 CLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 322
             F P +  + +PG+ E +  ++      +R  L   IV +GG+   P   +RL  EL+ 
Sbjct: 317 TFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFAARLAAELQ- 375

Query: 323 LWFTRVLRNDPSRLEKFKVRIEDPPRRKHMV-FIGGAVLANIMADKDHMWLSKQEWQEMG 381
               R L  D      +  RI  P +   +  +      AN  + K    +SK+E+ E G
Sbjct: 376 ----RQLPTD------WTCRISVPKKECELFSWKSMCQFANTDSYKKTR-ISKEEYYEHG 424

Query: 382 PSAMSK 387
           P  ++K
Sbjct: 425 PDWLTK 430

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 64/142 (45%), Gaps = 16/142 (11%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64
           TP+VLD G+  +K G +    P   + ++ G  + +    A +   +K I    E +  R
Sbjct: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQEVSEVTLRR 59

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRNR 119
                  P E G + +W     +WDY  Y     D  +L  +    ++++EP M      
Sbjct: 60  -------PHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112

Query: 120 EQMCEVMFEKYDFGGVYVAIQA 141
           + M +V+FE+Y+F  ++ A  A
Sbjct: 113 KNMDQVIFEEYEFDSLFKAPTA 134

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 81/386 (20%), Positives = 137/386 (35%), Gaps = 80/386 (20%)

Query: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63
           R+PIV+D G+  +K   +    P +   + + +        +N +  +KDI         
Sbjct: 3   RSPIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI--------- 52

Query: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MKLPSTSGGKVMLTEPPMNPLRN 118
            S +    P E G +  W     +WDY F++        L    G  ++ +E  M     
Sbjct: 53  -SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLT 178
            +   +V+FE+Y+F  ++ +  AV   + +                 V    S +    +
Sbjct: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171

Query: 179 R------------------------------------------RLDVAGRDVTRHLIDLL 196
           R                                          +LD+ GR +T  L + L
Sbjct: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231

Query: 197 SRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTL----------------- 239
           S R Y  N   +   V  +KEK  +VS     D+  A++   L                 
Sbjct: 232 SFRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289

Query: 240 --VENYELP-DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSAL 296
              EN  LP D + I +  E F  PE  F P +  + +PG+ E +  ++      VR  +
Sbjct: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349

Query: 297 YRAIVLSGGSSMYPGLPSRLEKELKQ 322
              IV +GG+   P    RL  EL++
Sbjct: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 85/379 (22%), Positives = 138/379 (36%), Gaps = 70/379 (18%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64
           +PI +D G+  +K G    + P Y   +            +N +  +KDI          
Sbjct: 4   SPIAIDNGSYEIKFGTTDLSSP-YRAINAFAIDKYHTTYLSNQIKNIKDI---------- 52

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLP-----STSGGKVMLTEPPMNPLRNR 119
           + +    P E G + +W     +WDYA ++  + P        G  ++ +E  M      
Sbjct: 53  TSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX------------------- 160
           + M +V+FE+Y+F   Y +  A    +A                                
Sbjct: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172

Query: 161 --------XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 212
                     T I+PV + V      ++LD+ GR +   L + LS R Y          V
Sbjct: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETIL--V 230

Query: 213 RQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKV 253
             IKE   +VS     D+    +  T VE Y LP+                    + IK+
Sbjct: 231 NNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTIKL 288

Query: 254 GSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLP 313
             E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P   
Sbjct: 289 YDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFA 348

Query: 314 SRLEKEL-KQL---WFTRV 328
           +RL  EL +QL   W  R 
Sbjct: 349 TRLTSELQRQLPTDWICRT 367

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 76/182 (41%), Gaps = 7/182 (3%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64
           + +V+D G+    IG +G + P    PS  G+     +E         D  +G      R
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKK---SFNDQFMG----MAR 67

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCE 124
              +I   +E+G + +W   +  W +A  D++K  S  G    LTE   N   NR++  E
Sbjct: 68  PDFEIKRILEDGCVVDWEAAQEQWTWAIRDELKFGSFKGTPAFLTEAIWNSEENRKKSLE 127

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVA 184
           V+ E  +F   Y+A  A    +A G               + PV + + L+  + R  +A
Sbjct: 128 VLLEGMEFEACYIAPTATCVSFAMGRPTCLVVDIGHDVASVCPVVDGMTLSKSSTRNFLA 187

Query: 185 GR 186
           G+
Sbjct: 188 GK 189

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 57/115 (49%), Gaps = 16/115 (13%)

Query: 276 GVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           G+  ++   I   DVD+R+ L   +V++GGSS   GL  RL  EL +            +
Sbjct: 376 GLANLVNTAIMETDVDLRATLAHNLVVTGGSSSILGLADRLMTELNK------------K 423

Query: 336 LEKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGPSAMSK 387
           L   K RI        R+   ++GG++L++ +     +W+ +QE++E+G   + K
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVGAERLLK 477

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 77/154 (50%), Gaps = 21/154 (13%)

Query: 242 NYELPDGRVIKVGSERFEAPECLFQPNLVDVEQ-----PGVGEMLFNTIQAADVDVRSAL 296
           N + P   + + G    E  E +  P   D +      PG+ +++  T+ ++DVD+R+ L
Sbjct: 452 NADTPSENINENGKRSIEDGENVDVPKKSDKKDIDNIIPGIADLVEATVNSSDVDLRATL 511

Query: 297 YRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPR---RKHMV 353
              ++L+GG+S+ PGL  RL  EL +            +L   K RI        RK+  
Sbjct: 512 AHNVILTGGTSLIPGLADRLMYELNK------------KLPALKFRILSSGHRRERKYQA 559

Query: 354 FIGGAVLANIMADKDHMWLSKQEWQEMGPSAMSK 387
           ++GG++L + +     +W+ K+E++E+GP  + K
Sbjct: 560 WLGGSILTS-LGTFHQLWVGKREYEEVGPDRLLK 592

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 63/136 (46%)

Query: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMC 123
           RS  Q+   +ENG++ +W   E  W +A  +++ + S  G   +LTEP  N ++NR++  
Sbjct: 156 RSDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSFKGIPALLTEPVWNTVQNRKKSL 215

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           EV+ EK +F   Y+        +A G               + PV + + L    RR   
Sbjct: 216 EVLLEKMEFEACYLTTIPTNVSFAAGKPNCLVVDVGHDTCSVSPVIDGMTLTKSVRRNFF 275

Query: 184 AGRDVTRHLIDLLSRR 199
           AGR + R L + +  R
Sbjct: 276 AGRYLNRLLENYIKPR 291

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 78/181 (43%), Gaps = 8/181 (4%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64
           T I++D G+    IG +G + P    PS  G+ I   EE+ ++     +  IG      R
Sbjct: 15  TAIIIDPGSFNTNIGYSGTDCPQAILPSCYGQYI-NDEEKPSL---FNEQSIG----LPR 66

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCE 124
              +I   + +G + +W   +  W++A    +   S  G   +LTEP  N   NR++  E
Sbjct: 67  KDYEIKEIVRSGEVVDWDKAQEQWEWAIKSVLLFESNKGLPALLTEPIWNSEDNRKKSLE 126

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVA 184
           V+ E  DF   Y+   A    +A G             T + PV + + L+  + R  +A
Sbjct: 127 VLLEGMDFEACYLTPTATAVSFAMGRPTCLVVDIGHDITSVSPVIDGMTLSKSSMRSFIA 186

Query: 185 G 185
           G
Sbjct: 187 G 187

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 65/119 (54%), Gaps = 18/119 (15%)

Query: 273 EQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSR----LEKELKQLWFTRV 328
           E  G+ +++ ++I + DVD+R+ L   +V++GGSS  PGL  R    L K L  L F R+
Sbjct: 372 EISGLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKF-RM 430

Query: 329 LRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGPSAMSK 387
           L +  +R             +++  ++GG++LA+ +     +W+ KQE+ E+G   + K
Sbjct: 431 LTSGQAR------------EKQYQSWLGGSILAS-LGTFHQLWVGKQEYAEVGADRLLK 476

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 107/274 (39%), Gaps = 32/274 (11%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVT-----PLKDIMI 56
           D  + +V+D G+    IG +G + P  T PS  G+ I   EE+           LK  + 
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGTDCPQVTLPSRYGQYISEEEEKDEQEQQEDDRKLKQKVF 71

Query: 57  GDEASAV-RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNP 115
            +++  + R+  QI   + NG + +W   +  W +A   ++   ST G    LTEP  N 
Sbjct: 72  SEQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHELHFESTKGMPAFLTEPIWNT 131

Query: 116 LRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 175
             NR++  EV+ E  +F   +++       +A G               + PV + + L+
Sbjct: 132 EENRKKSLEVLLENMEFEACFLSPTPTCVSFAMGRPTCLVVDIGHDVCSVSPVVDGMTLS 191

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 235
             +    +AG      L++ L  +     ++     + Q         +D ++D  L   
Sbjct: 192 KSSTSNFIAGS-----LLNALLSKQLDPKKTVPLFQIAQRHPNFIPKKFDFEVDPSL--- 243

Query: 236 TTTLVENYELPDGRVIKVGSERF---EAPECLFQ 266
                           K G+ER+   E  E LFQ
Sbjct: 244 ---------------FKFGNERWFFQECKETLFQ 262

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 64/115 (55%), Gaps = 16/115 (13%)

Query: 276 GVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           G+ ++++++I A DVD+R+ L   +V++GG+S  PGL  R+  EL +             
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNK------------S 439

Query: 336 LEKFKVRIEDP---PRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGPSAMSK 387
           L   K R+        R++  ++GG++L++ +     +W+ KQE++E+G S + K
Sbjct: 440 LPALKFRMLTSGHLKERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEVGASRLLK 493

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 22/180 (12%)

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV 222
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  IKE+  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEQCLFV 255

Query: 223 SYDLDLDTKLARETTTL-------------------VENYELP-DGRVIKVGSERFEAPE 262
           S     D+   ++   L                    EN  LP D ++I +  E F  PE
Sbjct: 256 SPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTIPE 315

Query: 263 CLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 322
             F P +  + +PG+ E +  ++      VR  +   IV +GG+   P    RL  EL++
Sbjct: 316 TFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 60/149 (40%), Gaps = 16/149 (10%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PIV+D G+  +K G +    P +   + + +        +N +  +KDI          S
Sbjct: 5   PIVIDNGSYEIKFGPSTNKKP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRNRE 120
            +    P E G +  W     +WDY  +     D   L    G  ++ +E  M      +
Sbjct: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQG 149
              +V+FE+Y+F  ++ +  AV   + + 
Sbjct: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKS 142

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 102/235 (43%), Gaps = 12/235 (5%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D   PI +D G+  ++ G   +  P + FP+++ +   R  +     T + +  + D+A 
Sbjct: 35  DPHVPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGK--VMLTEPPMNPLRNR 119
            VRS  Q   P +   + NW+  E + DY F+  + +   +G +  ++LTE        R
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNFTEEIMDYTFH-HLGVSPNNGVRNPILLTERMATVQSQR 147

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLNH 176
               ++MFE Y+  GV   I ++   Y Q   G             T+++PV +   +  
Sbjct: 148 ANWYQIMFETYNVPGVTFGIDSLYGFYNQNTSGNKTGLVIDCGHEDTNVIPVVDGTGVLT 207

Query: 177 LTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTK 231
             +R++  GR    +L DL++ +   F     +     + +   YVS + D D K
Sbjct: 208 DAKRINWGGRQAVDYLSDLMALKYPYFPTKLSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 63/144 (43%), Gaps = 28/144 (19%)

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEM----LFNTIQAADVDVRSA---LYRAIVLS 303
           + +  ER   PE +FQP L   +Q G+ E+    L     +    + S    +   + ++
Sbjct: 612 MHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTSLDMVNNVFIT 671

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGA 358
           GG+S  PGL  R+ +E  +       F+  + +DPS L+ +K               G A
Sbjct: 672 GGNSKVPGLRERIVREFTEFLPVGTNFSVNMSSDPS-LDAWK---------------GMA 715

Query: 359 VLANIMADKDHMWLSKQEWQEMGP 382
            LA    +     +SK+E++E GP
Sbjct: 716 ALAQNKEEYKKTVISKKEYEEYGP 739

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 22/180 (12%)

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV 222
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  IKEK  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEKCLFV 255

Query: 223 SYDLDLDTKLARETTTLV-------------------ENYELP-DGRVIKVGSERFEAPE 262
           S     D+  ++    L                    E+  LP D + I +  E F  PE
Sbjct: 256 SPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITLTDELFTIPE 315

Query: 263 CLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 322
             F P +  + +PG+ E +  ++      VR  +   IV +GG+   P    RL +EL++
Sbjct: 316 TFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQR 375

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 102/241 (42%), Gaps = 12/241 (4%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D + PI +D G+  ++ G   ++ P + FP+++ +   R  +     T + +  + D+  
Sbjct: 35  DPQLPIAIDFGSSKLRAGFVNQSAPTHVFPNVLTK--FRDRKLNKNFTFVGNDTLLDQ-- 90

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTS-GGKVMLTEPPMNPLRNRE 120
           AVRS  Q   P +   + NW+  E + DY F+    +P       ++LTE        R 
Sbjct: 91  AVRS--QSKSPFDGPFVTNWNFTEEILDYTFHHLGIVPENGISNPILLTERMATVQSQRA 148

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYA---QGLXXXXXXXXXXXXTHIVPVYESVVLNHL 177
              +++FE Y+  GV   I ++   Y     G             T+++P+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYGFYNYYPSGKQTGLVIDCGHEDTNVIPIVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVS--YDLDLDTKLARE 235
            +R++  G     +L DL++ +   F     +     + +   YVS  YD D+D  L  E
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSRNYDEDVDKILTLE 268

Query: 236 T 236
            
Sbjct: 269 N 269

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 58/144 (40%), Gaps = 28/144 (19%)

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEML-------FNTIQAADVDVRSALYRAIVLS 303
           + +  ER   PE +FQP +   +Q G+ E+        F +           +   + ++
Sbjct: 612 MHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTSIDMANNVFIT 671

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGA 358
           GG++  PGL  R+ KE              + +DPS L+ +K               G A
Sbjct: 672 GGNAKVPGLKERIVKEFTGFLPVGTNININMSSDPS-LDAWK---------------GMA 715

Query: 359 VLANIMADKDHMWLSKQEWQEMGP 382
            LA    +     +S++E++E GP
Sbjct: 716 ALAQNEEEYKRTIISRKEYEEYGP 739

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 98/234 (41%), Gaps = 10/234 (4%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D   PI +D G+  ++ G   +  P + FP+++ +   R  +     T + +  + D+A 
Sbjct: 35  DPHLPIAIDFGSSRLRAGFVNQATPTHIFPNVLTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTS-GGKVMLTEPPMNPLRNRE 120
            VRS  Q   P +   + NW+  E + DY F+    LP+      ++LTE        R 
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVLPNNGISNPILLTERMATVQSQRA 148

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLNHL 177
              +++FE Y+  GV   I ++ + Y     G             T +VP+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYSFYNNNPSGNKTGLVIDCSHEDTSVVPIVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTK 231
            +R++  G     +L DL++ +   F     +     + +   YVS + D D K
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 60/139 (43%), Gaps = 18/139 (12%)

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEM-------LFNTIQAADVDVRSALYRAIVLS 303
           + +  ER   PE +FQP +   +Q G+ E+        F + +         +   I+++
Sbjct: 612 MHLNVERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKLSSTSLDMVNNILIT 671

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++  PGL  R+ KE  +  F  V  N         V I   P      + G A LA  
Sbjct: 672 GGNAKVPGLRERIVKEFTE--FLPVGTN-------VAVNISSNPSLD--AWRGMAALARN 720

Query: 364 MADKDHMWLSKQEWQEMGP 382
            A+     +SK+E++E GP
Sbjct: 721 KAEYKKTVISKEEYEEYGP 739

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 99/233 (42%), Gaps = 11/233 (4%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64
           TPI +D G+  V+ G    + P + FP+ + R   R  + +   T + + ++ D+   VR
Sbjct: 37  TPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRH--RDRKLSKTFTFIGNDVLLDQ--TVR 92

Query: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRN-REQMC 123
           S  Q   P +   I NW  +E +  Y F     +   S    ++   P+  L++ R+   
Sbjct: 93  S--QSKSPFDGSFIANWDYVEDIMQYTFNHLGVVGDNSVRNPLIINEPLGSLQSQRKNWY 150

Query: 124 EVMFEKYDFGGVYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRL 181
           E++FE +    V   I  +   YA  +G             T ++PV +   +    +R+
Sbjct: 151 ELLFECFHLPNVSFGIDGMFGFYANNEGNQDGIVINCSNEETDVIPVVDGRGVLTDAKRI 210

Query: 182 DVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVS--YDLDLDTKL 232
           +  GR    +L DL+S +   F         +Q+     YVS  Y  D+DT L
Sbjct: 211 NWGGRQAVDYLSDLMSLKYPYFPSKLSTFQYQQMYTNYCYVSPDYSNDIDTML 263

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 59/138 (42%), Gaps = 18/138 (13%)

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEML-------FNTIQAADVDVRSALYRAIVLS 303
           + +  ER   PE LFQP +   +Q G+ E+        F +      +    + + I L+
Sbjct: 609 LHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETSLGMAKNIWLT 668

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG S  PGL  R+ KE     FT  L   P    K  V++   P      + G   LA  
Sbjct: 669 GGHSKLPGLRERIVKE-----FTGFL---PVGT-KLGVKMSKNPSLD--AWYGMRKLAQN 717

Query: 364 MADKDHMWLSKQEWQEMG 381
            AD     +SK++++E G
Sbjct: 718 EADYKDSIISKKDYEEYG 735

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 84/188 (44%), Gaps = 24/188 (12%)

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV 222
           T I+PV + +      +++D+ GR +T  L + LS R Y  N + +   V  IKEK  +V
Sbjct: 204 TWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHY--NVTDETILVNNIKEKCLFV 261

Query: 223 ---SY--DLDLDTKLARE------TTTLV------ENYELPD-GRVIKVGSERFEAPECL 264
              SY     L  K A E       TT +         +LPD  ++I +  E F   E +
Sbjct: 262 APKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETI 321

Query: 265 FQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL-KQL 323
           F P +  + +PG+ E +  ++      +R  +   IV  GG+   P    RL  EL +QL
Sbjct: 322 FHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQL 381

Query: 324 ---WFTRV 328
              W T V
Sbjct: 382 PTDWTTHV 389

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 64/138 (46%), Gaps = 20/138 (14%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PIV+D G+  +K G +    P     +I       A+++ N V       + ++   ++ 
Sbjct: 5   PIVIDNGSYEIKFGVSNSRIPFRAINAI-------AKDKYNTV------YLSNQIKGIKD 51

Query: 66  YLQISY--PMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRN 118
              +++  P E G + +W     +WDY FY     D  +L  TS   ++++E  ++    
Sbjct: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111

Query: 119 REQMCEVMFEKYDFGGVY 136
              +  ++FE+Y++G +Y
Sbjct: 112 SRNIDHIIFEEYNYGSIY 129

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 86/199 (43%), Gaps = 15/199 (7%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS--- 61
           TPI LD G+  V+ G   ++ P + FP+     I+R +ER  +   L    IG++ S   
Sbjct: 40  TPIALDFGSYEVRAGFTSQDTPSHVFPT----KIVRYKERK-IQKAL--TFIGNDCSLDN 92

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTS-GGKVMLTEPPMNPLRNRE 120
           AVRS+ +   P +  +I NW  ME +  Y F+     P+      ++LTE        R 
Sbjct: 93  AVRSHSR--SPYDGSLITNWEYMEDMLSYTFHHLGVQPNDGISNPMILTEKMATVQAQRS 150

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGL--XXXXXXXXXXXXTHIVPVYESVVLNHLT 178
              +++FE Y    V   I  + + YA                 T+I+PV +   +    
Sbjct: 151 NWYQLLFECYGIPQVTFGIDGLFSFYANNSPDSTGLIINSGHEDTNIIPVIKGKGILSEA 210

Query: 179 RRLDVAGRDVTRHLIDLLS 197
           +R+D  G     +L  LLS
Sbjct: 211 KRIDWGGNQSIDYLKSLLS 229

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRA-------IVLSGGSSM 308
           ER  APE +FQP++  ++Q G+ E+    +        S L +        I ++GG++ 
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLDMASNIFITGGNTK 670

Query: 309 YPGLPSRLEKEL 320
            P L  R+  E 
Sbjct: 671 IPNLRERIVNEF 682

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 96/231 (41%), Gaps = 17/231 (7%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D   PI +D G+  V+ G   ++ P + F + + R   R + R N+        IG++ +
Sbjct: 34  DPNVPIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNR-NLT------FIGNDTN 86

Query: 62  ---AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSG--GKVMLTEPPMNPL 116
              +VRS  Q   P +  ++ NW   E + +Y F+  + +    G    +++TE      
Sbjct: 87  LDLSVRS--QAKSPYDGAIVSNWDYTEEIMEYTFH-HLGVNGNDGVSNPILMTEKLATLQ 143

Query: 117 RNREQMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVPVYESVVL 174
             RE   +++FE +    V   I ++ + YA                 TH++PV     +
Sbjct: 144 SQRENWYQLLFECFGVPQVTFGIDSLFSFYANNDATASGLVINSGNEDTHVIPVMNGKGV 203

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD 225
               +R++  GR    +L +LL+ +   F         + + E   YVS D
Sbjct: 204 LSEAKRINWGGRQSVEYLSNLLALKYPYFPIKPSTHQFQSLYEDFCYVSVD 254

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPNLVDVEQPGVGEML-------FNTIQAADVDVRSALYRAIVLSGGSSM 308
           ER   PE +FQP++  ++Q GV E+        F + ++   +    L   + L+GG+  
Sbjct: 609 ERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSEGSKKLAANVFLTGGNMR 668

Query: 309 YPGLPSRLEKEL 320
            PG+  R+ +E 
Sbjct: 669 LPGVRERIVREF 680

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 65/134 (48%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPNLVDVEQPGVGEML-------FNTIQAADVDVRSALYRAIVLSGGSSM 308
           ER   PE LFQPN+   +Q G+ E+        F + Q    DV +++ + + ++GG++ 
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAK 670

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PGL  R+ KE     F+  L   PS    F +R    P      + G A LA    D  
Sbjct: 671 LPGLRERIVKE-----FSEFL---PSG-SPFSIRKSQDPSLD--AWRGMAKLAQNTEDFK 719

Query: 369 HMWLSKQEWQEMGP 382
           H +++KQE+ E GP
Sbjct: 720 HGYITKQEYLEYGP 733

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 101/237 (42%), Gaps = 19/237 (8%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS---A 62
           PI +D G+  ++ G   +  P + FP+ + R   R  + A  +T      IG++ S   A
Sbjct: 38  PIAIDFGSSKLRAGYVNDPNPSHIFPNRLTR--YRDRKLAKTMT-----FIGNDTSLDQA 90

Query: 63  VRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSG--GKVMLTEPPMNPLRNRE 120
           VR  +Q     +  ++ NW  +E   +Y F + + + +  G    +++ E        R 
Sbjct: 91  VR--VQAKSAFDGPLVTNWDYVEDTLEYTF-NHLGVAANGGISNPLVINERLATIQSQRA 147

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQG--LXXXXXXXXXXXXTHIVPVYESVVLNHLT 178
              +++FE +D  GV   I ++   Y                  T+++PV +   +   +
Sbjct: 148 NWYQILFECFDVPGVTFGIDSLFGFYHNSGPNSTGLVIGCGNEDTNVIPVVDGKGVLTES 207

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV--SYDLDLDTKLA 233
           +R++  G   T +L +L+S +   F         + + E   YV  SYD +L+  L+
Sbjct: 208 KRINWGGNQATEYLTNLMSLKYPYFPTKLSPFQYKTMYEDYCYVSQSYDEELEKYLS 264

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 100/235 (42%), Gaps = 21/235 (8%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D   PI +D G+  ++ G   ++ P + FP+ + R   R  +     T      IG++ S
Sbjct: 34  DSTIPIAIDFGSSQIRAGYTNQSTPSHIFPNRLTR--YRDRKINKTFT-----FIGNDVS 86

Query: 62  ---AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSG--GKVMLTEPPMNPL 116
              A+R+  Q   P +  +I NW  +E +  Y F + + +   +G    ++LTE      
Sbjct: 87  LDQAIRT--QSKSPFDGSIITNWDYVEDIMQYIF-NHLGVVGHNGVSNPILLTEKLATLQ 143

Query: 117 RNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXX----XXXXXXTHIVPVYESV 172
             R    +++FE +D   V + I ++ A Y  GL                T ++PV E  
Sbjct: 144 SQRSNWYQLLFECFDIPEVTLGIDSMFAFY--GLNERSSTGLVIDCGNEETDVIPVVEGA 201

Query: 173 VLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLD 227
            +    +R++  GR    +L DLL+ +   F         +++ +   YV+ D D
Sbjct: 202 GMLTDAKRINWGGRQAVDYLNDLLTLKYPYFPTKLSTAQYQRVYQDYCYVAKDYD 256

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPNLVDVEQPGVGEML-------FNTIQAADVDVRSALYRAIVLSGGSSM 308
           ER   PE LFQP++   +Q G+ E+        F + Q        A+   + ++GG+S 
Sbjct: 614 ERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTALAMANNLWITGGNSK 673

Query: 309 YPGLPSRLEKEL 320
            PG+  R+ KE 
Sbjct: 674 LPGMKERIVKEF 685

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 100/239 (41%), Gaps = 12/239 (5%)

Query: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63
           ++PI +D G+  ++ G      P + FP+ + +   R  +     T + +  + D+A  V
Sbjct: 37  QSPIAIDFGSSKLRAGFVNHATPTHIFPNALTK--FRDRKLNKNFTFVGNDTLLDQA--V 92

Query: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTS-GGKVMLTEPPMNPLRNREQM 122
           RS  Q   P +   + NW+  E + DY F+    +P       ++LTE        R   
Sbjct: 93  RS--QSRSPFDGPFVTNWNLTEEILDYTFHHLGVVPDNGIPNPILLTERLATVQSQRTNW 150

Query: 123 CEVMFEKYDFGGVYVAIQAVLALYA---QGLXXXXXXXXXXXXTHIVPVYESVVLNHLTR 179
            +++FE Y+  GV   I ++ + Y     G             T+++PV +   +    +
Sbjct: 151 YQILFETYNVPGVTFGIDSLFSFYNYNPSGNKTGLVISCGHEDTNVIPVVDGAGILTDAK 210

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVS--YDLDLDTKLARET 236
           R++  G     +L DL++ +   F     +     + +   YVS  YD D++  L  E 
Sbjct: 211 RINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYKDYCYVSRNYDEDIEKILTLEN 269

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 59/144 (40%), Gaps = 28/144 (19%)

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEM-------LFNTIQAADVDVRSALYRAIVLS 303
           + +  ER   PE +FQP +   +Q G+ E+        F +           +   ++++
Sbjct: 612 MHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTSIDMVNNVLIT 671

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGA 358
           GG++  PGL  R+ KE           T  + +DPS L+ +K               G A
Sbjct: 672 GGNAKVPGLKERIVKEFTGFLPTGTNITVNMSSDPS-LDAWK---------------GMA 715

Query: 359 VLANIMADKDHMWLSKQEWQEMGP 382
            LA          +SK+E++E GP
Sbjct: 716 ALARNEEQYRKTVISKKEYEEYGP 739

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 89/230 (38%), Gaps = 17/230 (7%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS---A 62
           PI +D G+  V+ G   E  P + FP+ + R   R   +    T       G++ S    
Sbjct: 38  PIAIDFGSSTVRAGYTNEARPSHIFPTKLTRYRDRKINKTFTFT-------GNDCSLDQT 90

Query: 63  VRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTS-GGKVMLTEPPMNPLRNREQ 121
           +RS  Q+  P +  +I NW  +E +  Y F     +P       +++TE        R  
Sbjct: 91  IRS--QMKSPFDGALITNWDYVEDILQYTFNHLGVVPDHGVQNPIIITEKLATIQSQRSN 148

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH----IVPVYESVVLNHL 177
             +++FE Y+       I ++ A Y                +H    I+P+ +   +   
Sbjct: 149 WYQLLFETYNVPKATFGIDSLFAFYNNNNGSATSTGMVIDCSHEETNIIPIVDGQGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLD 227
            +R++  GR    +L +LL+ +   F           + +   YVS D D
Sbjct: 209 AKRINWGGRHAIDYLSNLLALKYPYFPTKLSSYQYESMYQNFCYVSQDYD 258

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 61/139 (43%), Gaps = 18/139 (12%)

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEM-------LFNTIQAADVDVRSALYRAIVLS 303
           I +  ER   PE +FQP++  ++Q G+ E+        F +      ++   +   I L+
Sbjct: 611 IHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLT 670

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG+S  PGL  R+ KE ++               +F V +   P      + G A LA  
Sbjct: 671 GGNSKIPGLRERIVKEFREFLPVNT---------QFNVNMTSDP--TFDAWNGMAKLAQN 719

Query: 364 MADKDHMWLSKQEWQEMGP 382
             D     +SK+E++E GP
Sbjct: 720 ETDYKKTIISKKEYEEYGP 738

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 63/134 (47%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPNLVDVEQPGVGEM-------LFNTIQAADVDVRSALYRAIVLSGGSSM 308
           ER   PE LFQP +   +Q G+ E+        F +  +   D   A+ + + ++GG + 
Sbjct: 618 ERPRVPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQ 677

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PGL +R+ KE     FT  L ND     KF V I   P      + G A  ++  AD  
Sbjct: 678 LPGLKTRIVKE-----FTSFLPNDA----KFSVNISKHPSLD--AWKGMAKFSSDDADFK 726

Query: 369 HMWLSKQEWQEMGP 382
              +SK+E++E GP
Sbjct: 727 SSLISKKEYEEYGP 740

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 86/203 (42%), Gaps = 17/203 (8%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D   PI +D GT  VK G   +  P + FP+ + R   R  + +  +T      IG++ +
Sbjct: 35  DSSIPIAIDFGTCSVKAGYVNKADPAFNFPTRLTR--FRDRKMSRTMT-----FIGNDTN 87

Query: 62  ---AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSG--GKVMLTEPPMNPL 116
              AVRS  Q   P +   + NW   E + +Y F   + + +  G    +++TE      
Sbjct: 88  LDYAVRS--QSKTPFDGPFVTNWEYAEDILEYTF-KHLGVTANHGISNPLIMTEKLATLQ 144

Query: 117 RNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX--XXXXXTHIVPVYESVVL 174
             R    +++FE ++   V   I  V A YA                 T+++P+ +   +
Sbjct: 145 SQRANWYQLLFETFNTSNVSFGIDNVFAFYANTDKHSSGLVFGLNNQDTNVIPIIDGKPV 204

Query: 175 NHLTRRLDVAGRDVTRHLIDLLS 197
              T+R++  G     +L DL++
Sbjct: 205 LTDTKRINWGGSQSVGYLSDLMT 227

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/282 (21%), Positives = 113/282 (40%), Gaps = 36/282 (12%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS--- 61
           T I +D G+  V+ G   +  P + FP+ + R   R   R N+        IG++ +   
Sbjct: 37  TAIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNR-NLT------FIGNDTNLDL 89

Query: 62  AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSG--GKVMLTEPPMNPLRNR 119
           +VRS  Q   P +  ++ NW   E + +Y F+  + +  T G    +++TE        R
Sbjct: 90  SVRS--QSRSPYDGALVTNWDYTEDIMEYTFH-HLGVKGTDGIPNPIIMTEKLGALHSQR 146

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPVYESVVLNHL 177
           +   +++FE +    V   + ++ + YA                 THI+PV +   +   
Sbjct: 147 DNWYQLLFECFGAPQVTFGLDSLFSFYANNDASASGLVISSGNEDTHIIPVVDGKGVLGE 206

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETT 237
            +R++  GR    +L +LL+ +   F         + + ++  YVS D            
Sbjct: 207 AKRINWGGRQSVDYLSNLLALKYPYFPIKPSTHQFKALYDEFCYVSPD------------ 254

Query: 238 TLVENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGE 279
                Y+    R++ +  E  E    L +   VDV QP   E
Sbjct: 255 -----YQDEIQRILTL--EELETKNVLVEAPFVDVVQPEKSE 289

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEML-------FNTIQAADVDVRSALYRAIVLS 303
           + +  ER   PE +FQP++  ++Q G+ E+        F + ++    +  +L   + L+
Sbjct: 604 MHLNVERIRVPEVIFQPSMGGLDQAGIIEICETNFLKKFGSSRSELSSISRSLASNVFLT 663

Query: 304 GGSSMYPGLPSRLEKELKQL 323
           GG+   PG+  R+ +E + L
Sbjct: 664 GGNMRLPGMRERVVREFRGL 683

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 102/235 (43%), Gaps = 18/235 (7%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PI +D G+  VK G   ++ P + F + + R   R  + A  +T      IG++ +  + 
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLPTHVFTNKLTR--YRDRKLAKTMT-----FIGNDTNLDQP 90

Query: 66  Y-LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSG---GKVMLTEPPMNPLRNREQ 121
             +Q   P +   I NW   E ++DY  +  + + +T+G     ++LTE        R  
Sbjct: 91  LRIQAKRPYDGLFIANWEYAEEIFDYTLH-HLGVQTTNGSISNPIILTEKMACLQSQRAN 149

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXX----XXXXXXTHIVPVYESVVLNHL 177
             +++FE +D       + ++ A Y                    T+IVP+ +   +   
Sbjct: 150 WYQLLFETFDVPSATFGLDSLYAFYNNCANPFESDGLVINCGHEDTNIVPIVQGKGILTE 209

Query: 178 TRRLDVAGRDVTRHLIDLLS-RRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTK 231
            +R++  GR  T +L  LL+ +  Y   + ++F+  + + E   YVS + + D K
Sbjct: 210 AKRINWGGRHSTEYLSSLLTLKYPYFPTKLSEFQ-YQTMYEDFCYVSPNYNEDIK 263

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 64/147 (43%), Gaps = 28/147 (19%)

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEM-------LFNTIQAADVDVRSALYRAIVLS 303
           I +  ER   PE +FQP++   +Q G+ E+        FN+       +   +   + L+
Sbjct: 617 IHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERMLNNVWLT 676

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGA 358
           GG +  PGL  R+ KE  +        +  + NDPS L+ +K               G A
Sbjct: 677 GGHAKLPGLKERIVKEYTEFLPVGTKMSINISNDPS-LDTWK---------------GMA 720

Query: 359 VLANIMADKDHMWLSKQEWQEMGPSAM 385
            LA+       + ++K++++E GP  M
Sbjct: 721 KLASNTDYLKKIQVTKKDYEEYGPEYM 747

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 94/232 (40%), Gaps = 15/232 (6%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS---A 62
           PI +D G+  ++ G      P + F + + R   R  +    +T      IG++ +   A
Sbjct: 38  PIAVDFGSNQLRAGLINRATPSHVFTNRITR--FRDRKLMKTMT-----FIGNDVNLDQA 90

Query: 63  VRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTS-GGKVMLTEPPMNPLRNREQ 121
           VR+  Q   P +  ++ NW  +E + +Y F      P+      +++TE        R  
Sbjct: 91  VRA--QSKSPFDGPMVTNWDYVEDILEYTFNHLGSTPNNGISNPILVTERLATLQTQRSS 148

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX--XXXXXTHIVPVYESVVLNHLTR 179
             +V+FE ++  GV   I ++ A Y                  T+I+PV +   +    +
Sbjct: 149 WYQVLFECFNVPGVTFGIDSLFAYYQNTTANSTGLVIGCGNEDTNIIPVVDGQGMLTEAK 208

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTK 231
           R++  G     +L +L++ +   F         R + E   YVS D D + K
Sbjct: 209 RINWGGSQAADYLTNLMTLKYPYFPTKLSNFHYRTMYEDYCYVSQDYDEELK 260

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 58/134 (43%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPNLVDVEQPGVGEML-------FNTIQAADVDVRSALYRAIVLSGGSSM 308
           ER   PE  FQP +   +Q GV E+        F         + S + + + ++GG++ 
Sbjct: 612 ERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGGNAK 671

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PGL  R+ KE     FT  L  + S    F V I   P      + G A  A    D  
Sbjct: 672 IPGLRERIVKE-----FTGFLPVNTS----FNVNISSDPSLD--AWRGMAKYAQNETDYK 720

Query: 369 HMWLSKQEWQEMGP 382
             ++SK+E++E GP
Sbjct: 721 KSFISKKEYEEYGP 734

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/231 (20%), Positives = 92/231 (39%), Gaps = 13/231 (5%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS 61
           D   PI +D G+  V+ G   ++ P + FP+ + R   R   +           +G++ +
Sbjct: 34  DPNVPIAIDFGSSEVRAGYTNQSLPSHVFPTRLTRHRDRKINKTFT-------FVGNDTN 86

Query: 62  AVRSY-LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSG--GKVMLTEPPMNPLRN 118
             ++   Q   P +  +I NW  +E + +Y F + + +    G    ++LTE        
Sbjct: 87  LEQTLRTQSRSPFDGPMITNWDYVEDMMEYTF-NHLGVVGHDGISNPILLTEKMATLQSQ 145

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLNH 176
           R    ++MFE +    +   I ++ + +A  Q              T+++PV     +  
Sbjct: 146 RSNWYQLMFECFGVPKLTFGIDSLFSYFANNQSDSTGLVISSGNEDTNVIPVVCGKGILS 205

Query: 177 LTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLD 227
             +R++  GR    +  +LLS +   F         + I     YVS D D
Sbjct: 206 EAKRINWGGRHSVEYTTNLLSLKYPYFPTKLVSSQFQSIYHDFCYVSRDYD 256

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPNLVDVEQPGVGEM-------LFNTIQAADVDVRSALYRAIVLSGGSSM 308
           ER   PE +FQP +  ++Q G+ E+        F + +     V   +   + L+GG+  
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQEMANNVFLTGGNVR 669

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PGL  R+ +E     FT  L   P    K+ +++   P      + G A  A    D  
Sbjct: 670 VPGLRDRIVRE-----FTEFL---PVGT-KYNIKVASDPAID--AWKGMAKFAQSSTDYK 718

Query: 369 HMWLSKQEWQEMGP 382
             +++K+E++E GP
Sbjct: 719 GSYVTKKEYEEYGP 732

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 18/139 (12%)

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEML-------FNTIQAADVDVRSALYRAIVLS 303
           + + +ER   PE LF+P++   +Q G+ E+        F +         S +   + ++
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWIT 667

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++  PG+ +R+ KE     FT  L   P+         EDP       + G A LAN 
Sbjct: 668 GGNARIPGIKNRIVKE-----FTEFL---PAGTPLSVHMSEDPSLD---AWKGMAKLANN 716

Query: 364 MADKDHMWLSKQEWQEMGP 382
             D  +  ++++E++E GP
Sbjct: 717 ETDYKNTAVTRKEYEEYGP 735

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/222 (19%), Positives = 88/222 (39%), Gaps = 10/222 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRSY 66
           I +D G+  ++ G   +N P Y FP+ + +   R  +     T + +  + D+   +RS 
Sbjct: 39  IAIDFGSYNIRAGYTNQNTPSYIFPTRLTKH--RDRKLQKTFTFIGNDTLLDQ--TIRS- 93

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSG--GKVMLTEPPMNPLRNREQMCE 124
            Q   P +  ++ NW  +E + +Y F+  + +   +G    +++ E        R    +
Sbjct: 94  -QSKSPFDGTLLTNWDYVEDMLEYTFH-HLGVSGNNGVSNPLIINERLACLQSQRNSWYQ 151

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXX-XXXXXXXXXTHIVPVYESVVLNHLTRRLDV 183
           ++FE +D   V   I ++ + Y                 T ++P+     +    +R++ 
Sbjct: 152 LLFETFDLPEVSFGIDSLFSFYGNSTKEDGLVINCGNEETDVIPIVGGRGILSECKRINW 211

Query: 184 AGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD 225
            G   T  L  LL+ +   F          Q+ E   Y S D
Sbjct: 212 GGSQSTNFLSSLLTLKYPYFPAKLSTLQYTQMYEDYCYTSPD 253

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/236 (20%), Positives = 91/236 (38%), Gaps = 17/236 (7%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEAS---A 62
           PI +D G+  +K G   ++ P   FP+ + R   R       +T      IG++ S   A
Sbjct: 39  PIAIDFGSNTLKAGYTNQDVPSLVFPTRLTR--FRDRRLNRTMT-----FIGNDISLDQA 91

Query: 63  VRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTS-GGKVMLTEPPMNPLRNREQ 121
           VR+  Q   P +  ++ NW  ++ + +Y F     L        ++ +E        R Q
Sbjct: 92  VRA--QSKSPFDGSMVTNWEYIDEMLEYTFKHLGVLGDNGISNPLIFSEKLAVVQAQRSQ 149

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPVYESVVLNHLTR 179
             +++FE ++       I    A +A                 T+++P+   V      +
Sbjct: 150 WYQLLFETFNISKATFGIDNQFAFFANNSIDSTGLMIGCNNEDTNVIPIVNGVASLQECK 209

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVS--YDLDLDTKLA 233
           R++  G     ++ +LLS +   F         +++     YVS  Y  D+D  L 
Sbjct: 210 RINWGGNHAVSYMNNLLSLKYPYFPTKLTDLQYQKLYHDYCYVSPDYSADIDKYLT 265

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPNLVDVEQPGVGEML-------FNTIQAADVDVRSALYRAIVLSGGSSM 308
           ER   PE LFQP +   +Q GV E+        F +           +   I LSGG++ 
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 309 YPGLPSRLEKEL 320
            PGL +R+ KE 
Sbjct: 673 VPGLKNRIVKEF 684

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 62/138 (44%), Gaps = 18/138 (13%)

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAA------DVDVRS-ALYRAIVLS 303
           + +  ER   PE +FQP L   +Q G+ E+    I         ++  +S  + + + L 
Sbjct: 612 MHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLV 671

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++  PGL SR+ KE     FT  L +D     K  V I + P     V+ G   LAN 
Sbjct: 672 GGNAQVPGLKSRVVKE-----FTEFLPSDT----KINVNISEAPTLD--VWNGMYRLANT 720

Query: 364 MADKDHMWLSKQEWQEMG 381
             D     ++ +E+ E G
Sbjct: 721 EEDYQRTIVTSEEYDECG 738

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/234 (20%), Positives = 92/234 (39%), Gaps = 15/234 (6%)

Query: 2   DLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA- 60
           D   PI +D G+  ++ G    + P + FP+   +     + + N   P     IG +  
Sbjct: 38  DPNIPIAIDFGSYELRAGYTNISRPSHIFPNRFSK---YRDRKTNKYLPC----IGYDTW 90

Query: 61  --SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRN 118
                RS  Q   P +  ++ NW  +E +  Y F+     P       ++    +  L++
Sbjct: 91  LDQTTRS--QARSPFDGPLVVNWDMVEDILQYTFHHLGVQPDNGVTNPIIINEKLACLQS 148

Query: 119 -REQMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVPVYESVVLN 175
            R    + +FE +    V +A++ +LA Y    G             T+++P+ E   + 
Sbjct: 149 QRSNWYQTLFESFGVPKVSMAVEGMLAFYGHNGGSSTGIVIDCGYEDTNVIPIVEGQGMM 208

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLD 229
              +R++  G     +L +LL  +   F     +    ++ +   YVS D + D
Sbjct: 209 LDAKRINWGGHSSIDYLSNLLYLKYPYFPTKLSYLQYEKMYKDYCYVSQDYETD 262

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 64/134 (47%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPNLVDVEQPGVGEML-------FNTIQAADVDVRSALYRAIVLSGGSSM 308
           ER   PE +FQP++  ++Q G+ E+        F + +    ++   + + I ++GG++ 
Sbjct: 609 ERIRVPEVIFQPSIGGLDQAGIVELCETLLLKKFGSNRRELSEISKMMAKNIFITGGNAK 668

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PG+  R+ +E     F  V  N   +L       EDP       + G A  AN  +  +
Sbjct: 669 LPGIRERVVREF--TGFLPVGTNLNVKL------AEDPS---MSAWRGMAKFANNTSLYE 717

Query: 369 HMWLSKQEWQEMGP 382
              ++K+E++E+GP
Sbjct: 718 TSIMTKKEYEELGP 731

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 78/198 (39%), Gaps = 13/198 (6%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64
           TPI +D G+  V+ G   +  P   F + + R   R   R           +G++ +  +
Sbjct: 37  TPIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYT-------FVGNDTNLDQ 89

Query: 65  SY-LQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSG--GKVMLTEPPMNPLRNREQ 121
           S   Q   P +  +I NW  ++ +  Y F+  + +    G    V++TE        R  
Sbjct: 90  SIRTQSKSPFDGSMITNWDYVDDILAYTFH-HLDVRGNGGVPNPVLITERMAALQSQRSN 148

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGL--XXXXXXXXXXXXTHIVPVYESVVLNHLTR 179
             E++FE Y+   V   I ++ + Y +                T ++PV     +    +
Sbjct: 149 WYELLFECYNLQKVTFGIDSLFSFYGEHPPGTTGIAINSGNEDTSVIPVVNGKGILTEAK 208

Query: 180 RLDVAGRDVTRHLIDLLS 197
           R++  G+    +L  LLS
Sbjct: 209 RINWGGQQSVGYLNGLLS 226

>SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 311

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/250 (18%), Positives = 101/250 (40%), Gaps = 42/250 (16%)

Query: 83  DMELLWD--YAFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQ 140
           D E LW   Y  Y    + + S  KV++ E  + PL  +E +C+V+ ++     +     
Sbjct: 37  DEEFLWRLFYKCYHDELMVAPSSTKVVIIENVLLPLNCKELLCQVLLKRLLVSSIVFVPD 96

Query: 141 AVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHL-------- 192
            ++  ++ G+              +VP+ +  +L++ +   + AG+ +  +L        
Sbjct: 97  VLMTCFSSGVKDGLVIDVGWEYVAVVPILDLRILDNWSHISNKAGKFLYDNLKEILPPGT 156

Query: 193 -IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVI 251
            +D+L  +  A     DF+                       RE +      E+ +G + 
Sbjct: 157 DLDILVPQIMACEGDKDFQY----------------------REISI---TKEVRNGFLK 191

Query: 252 KVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPG 311
           K      E       P   D ++  + +++  T++   VDV+  ++  ++++G +S  PG
Sbjct: 192 KTIGHFDE------DPLEYDDDELPISQVVLKTLKDLPVDVKKRVFPHLMITGLASNIPG 245

Query: 312 LPSRLEKELK 321
              +L KE+K
Sbjct: 246 FKMKLLKEVK 255

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 18/139 (12%)

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEML-------FNTIQAADVDVRSALYRAIVLS 303
           + +  ER   PE +FQP++  ++Q GV E+        F++ + A       + + + ++
Sbjct: 609 MHINVERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRRALSATCEKMAKNVFIT 668

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++  PG+  R+ +E     FT  L   P   E  KV +   P      + G A  A+ 
Sbjct: 669 GGNTKLPGIRERIVRE-----FTGFL---PVGTE-LKVTLAKDP--SLSAWKGMAKFASD 717

Query: 364 MADKDHMWLSKQEWQEMGP 382
                   L+K+E++E GP
Sbjct: 718 PTSYKSSILTKREYEEYGP 736

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 90/232 (38%), Gaps = 23/232 (9%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65
           PI +D G+  V+ G      P   FP+ + R   R   R       +D  +    +++R+
Sbjct: 42  PIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDRKASRTYTFVG-RDTGLD---ASIRT 97

Query: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGG----KVMLTEPPMNPLRNREQ 121
             Q   P +  ++ NW  ++ +  Y F+    L    GG     V+LTE        R  
Sbjct: 98  --QSRSPFDGPMVTNWDYVDDMLAYTFH---HLGVRGGGGVPNAVVLTERLATLQSQRAN 152

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQ------GLXXXXXXXXXXXXTHIVPVYESVVLN 175
             E+++E Y+   V   I ++ + Y +      GL            T +VPV +   + 
Sbjct: 153 WYELLYEAYNLQEVTFGIDSLFSFYGERGPGSTGL----VVSSGNEDTCVVPVVDGRGVV 208

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLD 227
              +R++  G+    +L  LL+ +   F           I  +  YV+ D +
Sbjct: 209 SEAKRINWGGQQAVDYLTGLLALKYPYFPTKLSGSQFETIYREHCYVAEDFE 260

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 81/423 (19%), Positives = 153/423 (36%), Gaps = 118/423 (27%)

Query: 72  PMENGVIKNWSDMELLWDYAFYDQMKLPSTSGG---KVMLTEPPMNPLRNR-------EQ 121
           P+ENG+I N    +    Y +   +K          +   T  P+  L N        E 
Sbjct: 66  PIENGMIINLEAFQEFLKYIYISLLKQKHDENADSFEYSFTNIPLLLLNNHKWSQFQMES 125

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQ-GLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +   +FEK    G+ +   ++ A Y+   L            T IVP+ +   +NHL+  
Sbjct: 126 ITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTTINHLSNT 185

Query: 181 LDVAGRDVTRHLIDLL----SRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKL---- 232
           L+  G  +   L  LL     ++     +S  FE + + ++  S   ++  + T      
Sbjct: 186 LNYGGSYINTILQKLLPELNDQQIEDLKKSPIFEVLTEDEKNDSAFDFNNPITTSTKNKD 245

Query: 233 --------------ARETTTLVENYE-------LP------------DGRVIKVGSERFE 259
                          ++T  ++   E       LP            +G  IK+G +RF+
Sbjct: 246 DDDADFDVASIINSGKDTREILAEREKKNQKKSLPNSQLEFNTFKDNNGNQIKIGKQRFQ 305

Query: 260 APECLFQPNLVDVEQPGVGEMLFNTI-QAADVDVRSALYRAIVLSGGSSMYPGL------ 312
             + L Q          +   + +TI Q  D+  + A++  IV+ G +S+  G       
Sbjct: 306 GCDELIQK---------ISTRVGHTINQLEDLSKQRAIWENIVIVGNTSLITGFKEALLN 356

Query: 313 ----------PSRLEKELKQLWFTRVL-----------------RND------------- 332
                     P+  +++ ++  F ++L                 +N+             
Sbjct: 357 QLVIDHLVVEPADEKRQREKENFEKILASQNESNTSTSSTITNKKNNTKAYGAPFLPSLE 416

Query: 333 ----PSRLEKFKVRIEDPPRRKH----MVFIGGAVLAN--IMADKDHMWLSKQEWQEMGP 382
               PS ++  K     P  +KH    +VF+GG ++A       KD  + +K +++  GP
Sbjct: 417 YVHGPSVIKLAKYPEYFPEWKKHGYGDIVFLGGQIVAKQIFTHSKDTFYTTKHKYERHGP 476

Query: 383 SAM 385
           SA+
Sbjct: 477 SAI 479

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 70/358 (19%), Positives = 136/358 (37%), Gaps = 48/358 (13%)

Query: 1   MDLRTP--IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGD 58
           MDL     +V+  GT     G +    P    PS      L+ ++ + V     D+M   
Sbjct: 1   MDLSNSKCVVIHNGTSTTIAGFSNSEIPKCIIPS----SYLKKKDGSFVFGTF-DMMDSL 55

Query: 59  EASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPM----N 114
           E     S +      + GV  NW  +E  W+Y F  Q+K   T    V++T P       
Sbjct: 56  EDEGAESDIFTIVDSQLGVPYNWEALEKQWEYIFEKQLKCDPTE-LPVLITIPSSISKNE 114

Query: 115 PLRNR--EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESV 172
            + N+  EQ C++ FEK+    + +  +++      G             + + P+ + V
Sbjct: 115 DIENKVIEQYCKIAFEKFKIPYLQIVNESLSISLGLGKKTSLVIDISGSGSSVTPIVDGV 174

Query: 173 VLNH---------------LTRRLDVAGRDVTRHLID----LLSRRGY--AFNRSADFET 211
           ++ +               + ++      D+   + +     +S   +   F ++    T
Sbjct: 175 IIKNGIVKSKYGGDFLDYQIIKKFSTIDEDLEEEMTNSSNIWVSSNSWIKNFKKTMLQVT 234

Query: 212 VRQIKEKLSYVSYDLDLDTKLARETT---------TLVENYELPDGRVIKVGS-ERFEAP 261
            +++++   Y    L L  +L  + +         ++ + Y     + +   S E ++  
Sbjct: 235 DKKLQDVEKYYEEQLRLQAELQNQGSITSVGTNPLSVKKEYLYRSRKTVTFESRELYQFG 294

Query: 262 ECLFQPNLVDVE---QPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRL 316
           E LFQP L   +     G+GE+++ +I +A +    A   A    GGSS   G  S +
Sbjct: 295 EYLFQPQLASEQYNRDDGLGELIYRSITSAAMGNMPAAVAASNNIGGSSGATGGDSNV 352

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 72/185 (38%), Gaps = 9/185 (4%)

Query: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63
           R  +V+  G+     G +    P    PS     I R +E   +   +  + +  E  A 
Sbjct: 5   RKCVVIKNGSHTTVAGFSNTELPQCILPS---SYIKRDDEY--IFGKIDMLEVASERDAA 59

Query: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMN---PLRNRE 120
           +     +   ENGV  NW  +E  W Y F +++K  S     +++T P M     LR  E
Sbjct: 60  KKGEVYTIIDENGVPYNWEALERQWKYIFENELKCKSDE-FPLVITVPIMKDAVALRVME 118

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 180
           +  ++ F K++   + V I+ +    + G              ++ PV +  V  +   +
Sbjct: 119 RYFDLAFNKFNVPVLQVIIEPLAIALSMGKSSALVVDLGSSSCNVTPVIDGTVAKNSVLK 178

Query: 181 LDVAG 185
              AG
Sbjct: 179 SKYAG 183

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 94/242 (38%), Gaps = 33/242 (13%)

Query: 54  IMIGDEASAV-RSYLQISYPMENGVIKNW------------SDMELLWDYAFY---DQMK 97
           I  G+EA    +    I YP   G   N             SD+  L++YA     + + 
Sbjct: 380 IYFGEEAERCNKENFIIRYPFNKGGSLNLDSPYYSSLPELLSDVTRLFEYALTKRDESIT 439

Query: 98  LPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX 157
                  KV+L  P +    + E +  ++ ++  F  V +  +++ A Y  G+       
Sbjct: 440 QAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIV 499

Query: 158 XX-XXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVR--Q 214
                 T I  V E  VL +   +LD  G D+TR     L    + F +  D ++     
Sbjct: 500 NIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPF-QDLDLDSTHGWT 558

Query: 215 IKEKL--SYVSY-DLDLDTKL----ARETTTLVENYELPDGRVIKVGSERFEAPECLFQP 267
           + E+L  +Y ++ D ++  +L     R    + E YE       KV  E   AP  LF P
Sbjct: 559 LAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEF------KVFDEVILAPLALFYP 612

Query: 268 NL 269
           ++
Sbjct: 613 DI 614

>KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 253

 Score = 36.2 bits (82), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 14/98 (14%), Positives = 46/98 (46%)

Query: 91  AFYDQMKLPSTSGGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL 150
           +++  + + ++ G K++++EP    +  ++++C+V+F +     +      + A    G+
Sbjct: 47  SWFHDILMYNSKGVKIVISEPLWLSILRKQRLCKVLFGRLKVNSICFVPNCLAAFIGAGI 106

Query: 151 XXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDV 188
                       T ++P+++  +L+  +R   +   +V
Sbjct: 107 RNGLYIEVNSKNTELIPIFDGRILDSYSRSSKLGSDNV 144

>TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 73/193 (37%), Gaps = 44/193 (22%)

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL-----------------------SRR 199
           T I+P+ +   L H +  + + G D+  HL  +L                       +++
Sbjct: 177 TDILPIVDYSQLTHFSSTIPIGGNDINTHLKSILPSLSDDQIEDLKLSNIYEVLNAEAKK 236

Query: 200 GYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP------------D 247
            YA    AD +      +  + ++   D    L  E     EN  LP            +
Sbjct: 237 NYADLHQADEDEDDSAIDVAAIITSGRDAREILEGERKNKNEN-SLPNSELDKNSFVDRN 295

Query: 248 GRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSS 307
           G++I VG +RF+  E     NL+      VG   +      D++ + A++  IV+ G +S
Sbjct: 296 GQLISVGKQRFQGCE-----NLIKAISKRVG---YTISMVQDINKQKAMWENIVIVGNTS 347

Query: 308 MYPGLPSRLEKEL 320
           +  G    L  +L
Sbjct: 348 LLTGFQDSLLTKL 360

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 60/153 (39%), Gaps = 9/153 (5%)

Query: 58  DEASAVRSYLQ-----ISYPMENGVIKNWSDMELLWDYAFYDQ-MKLPSTSGG--KVMLT 109
           DE   VR   Q     I+ P    + +  SD+  L +YA   + + + ST     KV+L 
Sbjct: 396 DEKFVVRKPFQGGSFNINSPYYESLAELISDVTKLLEYALASETLNVKSTKFNQYKVVLV 455

Query: 110 EPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPV 168
            P +    + E    V+  +  F  V V  +++   Y  G+             T I  V
Sbjct: 456 IPDVFKKNHVETFIRVLLTELQFQAVAVIQESLATCYGAGISTSTCVVNIGATETRIACV 515

Query: 169 YESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGY 201
            E  VL H    L+  G D+TR    LL +  +
Sbjct: 516 DEGTVLEHSAVTLNYGGDDITRLFALLLLQSDF 548

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 50/128 (39%), Gaps = 4/128 (3%)

Query: 67  LQISYPMENGVIKNWSDMELLWDYAFYDQ---MKLPSTSGGKVMLTEPPMNPLRNREQMC 123
             I+ P    + +  SD+  L +YA   +   +K    +  KV+L  P +    + E   
Sbjct: 400 FNINSPYYKSLAELISDVTKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIETFI 459

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVVLNHLTRRLD 182
            V+  +  F  V +  +++   Y  G+             T I  V E  VL H    LD
Sbjct: 460 RVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITLD 519

Query: 183 VAGRDVTR 190
             G D+TR
Sbjct: 520 YGGDDITR 527

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 48/239 (20%), Positives = 89/239 (37%), Gaps = 48/239 (20%)

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQ-GLXXXXXXXXXXXXTHIVPVYESVVLNHLT 178
           E + + +FE  +   +     ++ A Y+   L            T I+P+ +   L+HL 
Sbjct: 125 ETITQYIFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTYHTDIIPIVDYAQLDHLV 184

Query: 179 RRLDVAGRDVTRHLIDLLSR----RGYAFNRSADFETVRQIKEKLSYVSYDLD------- 227
             L V G+ +   L  LL +    +  +  +S  FE +    +KLS   +  D       
Sbjct: 185 SSLPVGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSNFDFGNDNEDEDEE 244

Query: 228 -----------------LDTKLARETTTLVENYELP-------DGRVIKVGSERFEAPEC 263
                            L+ +   + T  V+N +L        +G  IKVG +RF+    
Sbjct: 245 TLNVAEIITSGRDTREVLEERERSQKTKNVKNSDLEFNTFWDRNGNEIKVGKQRFQGCNS 304

Query: 264 LFQ--PNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL 320
           L +   N V +    +           D++   A++  I++ GG++   G    L  +L
Sbjct: 305 LLKSISNRVGLTLDKID----------DINKARAVWENIIIVGGTTSISGFKEALLGQL 353

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 36/200 (18%), Positives = 77/200 (38%), Gaps = 9/200 (4%)

Query: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIM-IGDEASA 62
           +  IV+ QGT     G    + P    PS      +  ++   ++  L D++ I      
Sbjct: 10  KKCIVIQQGTNTTIAGFNNSDLPQCVIPSTY----IYDKQEDKMIFGLYDMLDIATSLED 65

Query: 63  VRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNR--- 119
              Y   +   +NG+  NW  +E  W+Y F D ++  S     +++T P M    +    
Sbjct: 66  ADRYEVFTILDKNGIPYNWEALEQQWNYLFNDVLRC-SPEEYPLVITIPSMKKEIDGEVL 124

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTR 179
           E+   ++FE++ F    + ++ +    + G               + P+ +  V+ +   
Sbjct: 125 EKYFSLVFERFKFPVFQIILEPLAITLSLGKSSGLVIDMGSSGCRVTPIIDGTVIKNAVL 184

Query: 180 RLDVAGRDVTRHLIDLLSRR 199
                G  +   +I+ L ++
Sbjct: 185 SSKYGGAFLDYQIIETLQKK 204

>KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033W ARP9
           Actin-related protein
          Length = 432

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 95/234 (40%), Gaps = 41/234 (17%)

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQG-LXXXXXXXXXXXXTHIVPVYESVVLNHLT 178
           E + + +FE+           A+ + YA G L            T ++P+ + + L HL 
Sbjct: 98  ETIAQFVFEQLQINNFMFLPSALASSYALGSLQNCVVIDIHTNGTDVIPILDYIQLGHLA 157

Query: 179 RRLDVAGRDVTRHLIDLLSR----RGYAFNRSADFETVRQIKEKLSYVSYD-------LD 227
            +++  G  + + L  LL +    +     +S+ FE + +  +K S +++        LD
Sbjct: 158 VKVEHGGSQIDQELAKLLPQWTPEQIEDLKKSSIFEVLSEDAKKSSSLNFKHGEDEGALD 217

Query: 228 LDTKLARETTTL--------------VENYELPD-------GRVIKVGSERFEAPECLFQ 266
           +   +  +  T               VEN E  +       G+ I VG +RF+  E L  
Sbjct: 218 VAALVTSDRDTREILEEREKNKDKHNVENSEQENNVFVDRHGKQIIVGKQRFKGCESL-- 275

Query: 267 PNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL 320
             + ++ +  VG +L    Q  D     A++  I++ GG++   G    L ++L
Sbjct: 276 --VAEISKT-VGRVL---SQIDDFHKLRAMWENILVVGGTTSISGFKEALLQKL 323

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/223 (17%), Positives = 86/223 (38%), Gaps = 40/223 (17%)

Query: 105 KVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH 164
           K+++ E  +  +  ++++C V+ ++     V      ++A  A G+            T 
Sbjct: 61  KIVILENVLLDVPKKKRLCHVLLDRLMVSSVVFLPDILMACVAGGVTDAIVVDIGWENTV 120

Query: 165 IVPVYESVVLNHLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFET-----VRQIKEK 218
           + P+ +  +L               +H+ I  +  +      S+ FE      VR IK  
Sbjct: 121 VAPIMDMRILE--------------QHMGISKIGAKWIGSKLSSTFEIDGEKIVRMIKLD 166

Query: 219 LSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVG 278
                  + ++ +   +   ++ N    D             PEC       D+++  + 
Sbjct: 167 TDINCNGVQIEWRDIEDCMEILWNINKQD-------------PEC-------DIDEFPII 206

Query: 279 EMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELK 321
            ++  +I+   +DV+S + + +++ GG S   GL  RL + L+
Sbjct: 207 SLVLESIKQLPIDVKSKVLQNVIIIGGLSKIQGLKERLIENLR 249

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 58/150 (38%), Gaps = 15/150 (10%)

Query: 69  ISYPMENGVIK----NWSDM-ELLWDYAFYDQMKLPST---------SGGKVMLTEPPMN 114
           + YP  NG       N++ + ELL D        L  T         S   V+L  P + 
Sbjct: 286 LRYPFANGSFNVKSPNYNSLQELLNDVVNLITFALSETKLNISKSQFSSYNVVLIIPDLF 345

Query: 115 PLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVV 173
                EQM  ++  + DF  V +  +++ + Y  GL             T I  V E  V
Sbjct: 346 EKSYVEQMIRLLISEMDFQAVALIQESLASCYGAGLSNSTCVIDIGGSETKISCVDEGQV 405

Query: 174 LNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203
           + +   +L   G D+T+   +LL +  + +
Sbjct: 406 IQNSCIKLSYGGDDITKLFAELLLQSNFPY 435

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/129 (17%), Positives = 55/129 (42%), Gaps = 4/129 (3%)

Query: 75  NGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNR---EQMCEVMFEKYD 131
           NG+  NW  ++  W+Y + + +K  S     +++T P  N   +    ++  E+ FE ++
Sbjct: 78  NGLPYNWDALKEQWEYIYREVLKCNSDE-YPLVITIPSANKDVDEIILKKYFELAFETFN 136

Query: 132 FGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRH 191
              + + I+ +    + G              ++ P+ +  V+ H   +    G  +   
Sbjct: 137 VPVLQIIIEPLAVALSLGKSSSLVVNLGASGCNVTPIVDGTVIKHAVMKSKYGGDFLDFQ 196

Query: 192 LIDLLSRRG 200
           ++++L  +G
Sbjct: 197 IVNILQEKG 205

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 15/93 (16%)

Query: 292 VRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPR--- 348
           + +AL   IV++G +S+ PG+  R+  EL              +  ++K+     P    
Sbjct: 336 IHAALLTNIVITGSTSLVPGVEQRIVNELSY------------QFPQYKLSSFANPMVLD 383

Query: 349 RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 381
           RK   + GG  ++N+ + +   W+++QE+   G
Sbjct: 384 RKLQSWQGGVTMSNLPSWELGNWITRQEYDANG 416

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 34/87 (39%), Gaps = 1/87 (1%)

Query: 105 KVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXT 163
           KV+L  P +    + E    V+  +  F  V +  +++   Y  G+             T
Sbjct: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508

Query: 164 HIVPVYESVVLNHLTRRLDVAGRDVTR 190
            I  V E  VL H    LD  G D+TR
Sbjct: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535

>TPHA0N01730 Chr14 complement(369871..371103) [1233 bp, 410 aa] {ON}
           
          Length = 410

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 275 PGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPS 334
           P +    FN  Q +      +L +AI +   S+   G  S+ E+E   + F R LRND +
Sbjct: 189 PAMANDKFNYCQFS-----RSLEQAINVPESSNTGMGHYSKKEEEESMVNFRRSLRNDRN 243

Query: 335 RLEKFKVRIEDPPRR 349
           +L KF+   +D   +
Sbjct: 244 KLVKFQFNFDDDSNK 258

>AAR103C Chr1 complement(527960..530596) [2637 bp, 878 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR135W
           (CTF4)
          Length = 878

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 301 VLSGGSSMYPG----LPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIG 356
           +L  G +++PG    LPS +E  L  L  T+VL+ND S  E+  +    P       F+ 
Sbjct: 722 ILIKGKNLWPGFPLPLPSEMEIRLPLLDKTQVLKNDTSPDEEVVIP---PALAAEEEFLR 778

Query: 357 GAVLANIMAD 366
             VLA ++AD
Sbjct: 779 SQVLAGLLAD 788

>Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034W
           (REAL)
          Length = 479

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 37/194 (19%), Positives = 75/194 (38%), Gaps = 24/194 (12%)

Query: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63
           R  +V+  G+     G +    P    PS     + R +E   V        + D A+  
Sbjct: 5   RKCVVIHNGSHRTVAGFSNVELPQCIIPSSY---VKRTDEAGKVELIFGTYDMTDAAAEK 61

Query: 64  RSYLQISYPMEN-GVIKNWSDMELLWDYAFYDQMK-----------LPSTSGGKVMLTEP 111
           R+  ++   +++ G+  NW  +E  W Y +  Q+K           +P+T+G      +P
Sbjct: 62  RNGDEVYTLVDSQGLPYNWEALESQWRYLYDTQLKVSPNELPLVITMPATNG------KP 115

Query: 112 PMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYES 171
            M+ LR   +  E+ F+K +     + I+ +    + G              ++ P+ + 
Sbjct: 116 DMSILR---RYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDMGASGCNVTPIIDG 172

Query: 172 VVLNHLTRRLDVAG 185
           +V+ +   R    G
Sbjct: 173 IVVKNAVVRSKFGG 186

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 76/194 (39%), Gaps = 24/194 (12%)

Query: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63
           R  +V+  G+     G +    P    PS   +    A  +A  V    D++  D  +  
Sbjct: 5   RKCVVIHNGSHRTVAGFSNVELPQCIIPSSYVKRTNDAG-KAEFVFGTYDMI--DATAEK 61

Query: 64  RSYLQISYPMEN-GVIKNWSDMELLWDYAFYDQMK-----------LPSTSGGKVMLTEP 111
           RS  ++   M++ G+  NW  +EL W Y +  Q+K           +P+T+G      +P
Sbjct: 62  RSDDEVYTLMDSQGLPYNWEALELQWRYMYETQLKVSPEELPLVITMPATNG------KP 115

Query: 112 PMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYES 171
            M+ L   E+  E+ F+K       + I+ +    + G              ++ P+ + 
Sbjct: 116 DMSIL---ERYYELAFDKLKVPVFQIVIEPLAIALSMGKSSAFVIDMGASGCNVTPIIDG 172

Query: 172 VVLNHLTRRLDVAG 185
           +V+ +   R    G
Sbjct: 173 IVVKNAVVRSKFGG 186

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 9/89 (10%)

Query: 292 VRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKH 351
           V S L   I+++G SS+  G+  R+ KEL        +R    +L  F  ++     RK 
Sbjct: 384 VYSLLLTNIIITGSSSLIEGMEQRIIKELS-------IRFPQYKLTTFANQVM--MDRKI 434

Query: 352 MVFIGGAVLANIMADKDHMWLSKQEWQEM 380
             ++G   +AN+ +     W SK++++ +
Sbjct: 435 QGWLGAVTMANLPSWNLGKWYSKEDYESL 463

>CAGL0F05907g Chr6 (591411..592799) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033w ARP9
           Actin-related protein
          Length = 462

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 76/190 (40%), Gaps = 40/190 (21%)

Query: 163 THIVPVYESVVLNHLTRRLDVAG----RDVTRHLIDLLSRRGYAFNRSADFETV----RQ 214
           T I+PV +   + HLT  +++ G     ++ + L  L   +     RS  FE +    R+
Sbjct: 172 TDIIPVVDYTPMEHLTSTINLGGDSINTELAKKLPQLTETQIETLKRSTIFEVLSADARE 231

Query: 215 I-----KEKLSYVSYDLDLDTKLARETTTLVE------------NYEL-------PDGRV 250
           I      E++   + D+       R+T  ++E            N EL        DG+ 
Sbjct: 232 ILDTNDGEEMDEGALDVAAIVTSGRDTREVLEERERKKKQRNVKNAELDTNSFYDDDGQE 291

Query: 251 IKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYP 310
           I VG +RFE  E      L++     VG +L +    A       ++  I++ GG+S   
Sbjct: 292 ITVGKQRFEGTE-----KLIESISHRVGNVLAHIHDKAKA---RHIWENIIVVGGTSSIV 343

Query: 311 GLPSRLEKEL 320
           G    L  +L
Sbjct: 344 GFREALIAQL 353

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,639,549
Number of extensions: 1605754
Number of successful extensions: 4201
Number of sequences better than 10.0: 173
Number of HSP's gapped: 3879
Number of HSP's successfully gapped: 256
Length of query: 391
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 279
Effective length of database: 40,638,807
Effective search space: 11338227153
Effective search space used: 11338227153
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)