Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F06468g3.162ON83783742310.0
Kwal_33.141673.162ON83884328250.0
SAKL0C07348g3.162ON86188221190.0
ADR317C3.162ON81985018940.0
TDEL0D046003.162ON79583017870.0
ZYRO0B04906g3.162ON84787217450.0
NCAS0I020803.162ON77483916330.0
KLLA0C03828g3.162ON79381116180.0
Ecym_52363.162ON86451515880.0
Kpol_1032.103.162ON79159815670.0
Suva_4.2213.162ON76582015330.0
TPHA0M003003.162ON77484115090.0
Skud_4.2233.162ON76981815060.0
YDL028C (MPS1)3.162ON76482014800.0
Smik_4.2073.162ON76582014560.0
KAFR0F022203.162ON74781514230.0
CAGL0K01617g3.162ON77484113421e-173
NDAI0A066203.162ON74744412651e-162
TBLA0F008603.162ON98036912351e-155
KNAG0K017403.162ON76543110731e-133
NCAS0C035603.162ON6413298411e-101
KNAG0B043205.406ON10272932631e-22
CAGL0L11550g5.406ON10722792632e-22
Skud_8.1635.406ON10762792561e-21
NDAI0F045201.24ON4893042511e-21
NDAI0C017005.406ON10202932551e-21
KLTH0D03454g1.271ON14332862552e-21
CAGL0K02673g2.496ON9153442532e-21
KLLA0F24618g3.229ON5562822502e-21
KLLA0D11990g8.482ON3043112403e-21
Kpol_1031.105.406ON11273052505e-21
Smik_8.1805.406ON10732792506e-21
KAFR0D041001.52ON11172882506e-21
NDAI0A038702.496ON8952982496e-21
CAGL0K08514g2.479ON14892372507e-21
KNAG0B053502.496ON8362992488e-21
KLLA0F14190g1.271ON13383222499e-21
KNAG0F002901.52ON11253052489e-21
KLLA0F11143g8.676ON8132542471e-20
TBLA0A071501.52ON13912422481e-20
Suva_2.6871.52ON11282492471e-20
YDR507C (GIN4)1.52ON11422352471e-20
CAGL0K05709g1.52ON11032302471e-20
NCAS0H019405.406ON10153162461e-20
SAKL0H11638g8.482ON3043102351e-20
Kwal_26.73551.271ON14462862471e-20
Smik_4.7891.52ON11362352462e-20
Suva_15.2975.406ON10742792462e-20
TPHA0G032002.479ON15342412462e-20
TDEL0E021805.406ON9872822442e-20
NDAI0E021108.676ON9032972442e-20
Kwal_55.215455.406ON8652812433e-20
Kpol_2002.461.52ON11232422433e-20
YHR102W (KIC1)5.406ON10802802434e-20
TPHA0C017808.482ON3053102314e-20
KLTH0E11220g8.482ON3023102315e-20
TDEL0C064901.52ON11533072425e-20
KAFR0E010403.229ON5022382385e-20
KAFR0D049505.406ON10082822416e-20
TPHA0I009201.271ON14342862418e-20
YDR490C (PKH1)3.92ON7662312398e-20
KLTH0F16676g5.406ON8782812398e-20
Skud_4.7831.52ON11352352408e-20
TBLA0I002802.496ON13163002409e-20
KLLA0B13607g2.496ON9892982391e-19
TPHA0E036401.52ON11372512391e-19
SAKL0G01848g5.406ON8852792381e-19
KLTH0D06006g2.496ON9542892381e-19
Kwal_26.78612.496ON9552892381e-19
TPHA0H016305.406ON10362952381e-19
KNAG0J012903.229ON5082492351e-19
Sklu_YGOB_Anc_2.4962.496ON6192482361e-19
Kpol_1040.207.86ON12972372381e-19
NDAI0A006601.52ON10222372382e-19
Skud_4.7643.92ON7562312352e-19
KAFR0K007007.86ON13812462363e-19
Kpol_1007.178.482ON3073112253e-19
Kpol_1055.242.496ON9372382353e-19
ABL034W2.479ON14252352353e-19
Smik_4.7673.92ON7582312344e-19
KLLA0C01650g1.52ON11122352354e-19
ZYRO0F17402g1.52ON11892352344e-19
Ecym_10581.52ON11642352344e-19
NCAS0A050502.496ON8932352344e-19
KNAG0A023108.482ON3023102226e-19
Skud_8.392.496ON9232992326e-19
KNAG0B017801.271ON15802892337e-19
TBLA0B016303.177ON12952962327e-19
YOL100W (PKH2)3.92ON10812392327e-19
NCAS0B086001.52ON11172422327e-19
Skud_16.2518.482ON3053102227e-19
NCAS0C024708.482ON3113102227e-19
TPHA0H026307.86ON13672372327e-19
Suva_16.2868.482ON3053102218e-19
NCAS0C049403.92ON11162282328e-19
Smik_8.422.496ON9392992319e-19
Ecym_63441.271ON13972872311e-18
SAKL0H06534g8.676ON8042412301e-18
YHL007C (STE20)2.496ON9393002301e-18
TBLA0I018003.229ON6292562291e-18
Kwal_56.227883.229ON5153082271e-18
CAGL0L12474g8.482ON3023162201e-18
YJL095W (BCK1)1.271ON14782852311e-18
KAFR0H015308.482ON3063122201e-18
NDAI0K021002.496ON9093002301e-18
ACL104C5.406ON9472792301e-18
KAFR0A017602.496ON8852892292e-18
TBLA0C029401.271ON16433012302e-18
Kpol_463.81.271ON14472872302e-18
NCAS0A123502.496ON7462782282e-18
NCAS0A102903.229ON5092502252e-18
ZYRO0F08074g8.482ON3043102182e-18
AER264C6.341ON14832492292e-18
Suva_2.6663.92ON7642322272e-18
Kpol_1072.168.676ON7952442272e-18
Kpol_1037.523.229ON5122422242e-18
CAGL0I07513g3.92ON10762392273e-18
Ecym_35473.229ON5372422253e-18
AFR696C1.52ON11422372273e-18
ZYRO0A06446g5.406ON9432802273e-18
NCAS0A002801.24ON5352862243e-18
Suva_8.472.496ON9802992263e-18
KNAG0K006803.92ON10952412273e-18
YPL031C (PHO85)8.482ON3053102173e-18
ZYRO0B01166g2.496ON9632982263e-18
Skud_11.675.274ON5083312234e-18
NCAS0A053706.341ON15081982274e-18
SAKL0C01716g1.52ON12152372264e-18
TDEL0B015408.482ON3043122164e-18
Ecym_25318.482ON3013082164e-18
SAKL0C08844g3.229ON5313192234e-18
Kwal_26.71547.86ON12132372264e-18
TDEL0A075606.341ON15752642264e-18
KLTH0C08932g3.229ON5192502224e-18
NDAI0B047001.336ON5282812234e-18
NDAI0G034508.141ON9482802254e-18
TPHA0G032902.496ON9732382254e-18
KLTH0C10912g6.31ON6972282245e-18
Kwal_26.77882.479ON12672352255e-18
Smik_2.1463.229ON5262282225e-18
TBLA0A035705.406ON9752962255e-18
SAKL0D05522g1.271ON14743212255e-18
TBLA0D022308.141ON11542932256e-18
KAFR0H024308.676ON7843112246e-18
Skud_3.391.52ON10172282246e-18
Skud_2.1413.229ON5262402216e-18
TPHA0A041703.229ON5132342217e-18
Kwal_56.224766.31ON6972202227e-18
TPHA0C004705.611ON6313292218e-18
KAFR0D033902.496ON7983022228e-18
KLTH0D11242g8.676ON7952402221e-17
Ecym_55055.406ON10032792221e-17
YBR028C (YPK3)3.229ON5252402191e-17
ACR142W8.676ON8372432221e-17
TDEL0A027202.496ON9152482221e-17
TDEL0A025502.479ON13692352231e-17
CAGL0L03520g1.271ON14472872231e-17
SAKL0B04488g4.184ON3682702151e-17
SAKL0C09174g3.92ON10712342221e-17
Kpol_431.92.479ON15522352221e-17
Kpol_1018.655.611ON6013242201e-17
Ecym_73922.479ON14342352221e-17
ZYRO0G03366g2.479ON16162382222e-17
NCAS0C041008.141ON9052802202e-17
Smik_6.3508.676ON8222402202e-17
AGL242C8.482ON3033092112e-17
ZYRO0A03894g3.229ON4522522172e-17
KAFR0C030108.141ON7902812202e-17
AEL083W3.229ON5362382182e-17
Ecym_24996.341ON15412452212e-17
Kpol_541.498.141ON9942802202e-17
NCAS0A094701.271ON15153242212e-17
KLLA0C17160g8.141ON8312802192e-17
NCAS0F015807.86ON13822462202e-17
KLLA0E21693g5.406ON10162792192e-17
Kwal_27.118038.482ON2462482063e-17
CAGL0M08910g5.611ON6123422173e-17
TDEL0A062208.676ON7942502183e-17
Ecym_35863.92ON10772582183e-17
YPL153C (RAD53)8.676ON8212412173e-17
KLTH0F01672g1.52ON11642352183e-17
ZYRO0B06512g3.92ON11112462183e-17
Kwal_26.87968.676ON7962402174e-17
Skud_16.1298.676ON8272412174e-17
NCAS0A080805.611ON6232952155e-17
TBLA0D056401.225ON8162902165e-17
CAGL0B04301g3.229ON5422502145e-17
Kwal_56.226933.92ON9842352165e-17
NCAS0A057702.479ON14612392176e-17
Suva_16.1578.676ON8322412156e-17
SAKL0E02860g2.479ON13772352166e-17
KAFR0C014403.92ON10952652166e-17
Suva_2.1573.229ON5262392136e-17
Kwal_23.63256.341ON15422482167e-17
Suva_1.507.86ON13602452167e-17
Smik_10.1471.271ON14783202168e-17
TBLA0D050101.374ON4343282118e-17
Skud_11.1262.479ON15182372159e-17
CAGL0L06006g8.141ON9422802149e-17
Ecym_61454.184ON3652712089e-17
Skud_10.1191.271ON14812852159e-17
TDEL0D014001.271ON14293262159e-17
Smik_1.507.86ON13572462151e-16
YAL017W (PSK1)7.86ON13562462141e-16
CAGL0M02233g8.676ON7672422131e-16
NDAI0G054701.271ON15552852141e-16
KLTH0C09548g3.92ON9932332131e-16
Suva_6.1691.271ON14843202141e-16
YCL024W (KCC4)1.52ON10372422131e-16
KAFR0D032002.479ON14482372141e-16
NDAI0G042903.92ON11132292131e-16
Ecym_26407.86ON13252352131e-16
Ecym_46527.441ON11433322131e-16
Kwal_14.14164.184ON3653172061e-16
Suva_3.1901.52ON10242282131e-16
Smik_7.928.141ON8972802122e-16
KLLA0F07623g7.86ON12292472132e-16
Kwal_33.138311.180ON7002392112e-16
NDAI0A071903.229ON5352992102e-16
KLTH0A06776g6.341ON15232482122e-16
Smik_3.541.52ON10322282122e-16
KLLA0F11319g8.668ON8432262112e-16
KNAG0A067502.496ON7912222102e-16
KNAG0G012508.141ON8572812102e-16
TDEL0D039503.229ON4932522082e-16
KNAG0B032305.611ON6412772093e-16
AFR092W1.271ON14232902113e-16
KAFR0A014201.271ON13983282113e-16
Ecym_24342.496ON11222992103e-16
ZYRO0G15290g1.271ON14872872113e-16
SAKL0E01584g6.31ON6952952093e-16
NDAI0E031708.482ON3232372023e-16
Suva_6.781.374ON4452412063e-16
KLTH0G17512g4.184ON3652662043e-16
TBLA0B023103.92ON8192212093e-16
Suva_11.655.274ON5042652073e-16
Skud_1.447.86ON13562462103e-16
AFR335C3.92ON10332192103e-16
TBLA0E033605.611ON6542832084e-16
Smik_15.573.92ON10812482094e-16
KLLA0A03806g5.611ON6023102084e-16
Suva_15.653.92ON10802382094e-16
Suva_2.6515.611ON6332832084e-16
Smik_4.7545.611ON6322832074e-16
CAGL0H06259g7.86ON13362362094e-16
SAKL0G10978g5.274ON5213242064e-16
TPHA0D028405.611ON6342812075e-16
YDR477W (SNF1)5.611ON6332832075e-16
TBLA0I011502.479ON17452352095e-16
TBLA0A016308.482ON3513402025e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F06468g
         (837 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...  1634   0.0  
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...  1092   0.0  
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   820   0.0  
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   734   0.0  
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   692   0.0  
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   676   0.0  
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    633   0.0  
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...   627   0.0  
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...   616   0.0  
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....   608   0.0  
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...   595   0.0  
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   585   0.0  
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...   584   0.0  
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   574   0.0  
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   565   0.0  
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   552   0.0  
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...   521   e-173
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   491   e-162
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   480   e-155
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....   417   e-133
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...   328   e-101
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   105   1e-22
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   105   2e-22
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   103   1e-21
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...   101   1e-21
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   102   1e-21
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   102   2e-21
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   102   2e-21
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   100   2e-21
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    97   3e-21
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   100   5e-21
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   100   6e-21
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...   100   6e-21
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    100   6e-21
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   100   7e-21
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   100   8e-21
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   100   9e-21
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   100   9e-21
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   100   1e-20
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   100   1e-20
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...   100   1e-20
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...   100   1e-20
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   100   1e-20
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    99   1e-20
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    95   1e-20
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   100   1e-20
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    99   2e-20
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    99   2e-20
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    99   2e-20
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    99   2e-20
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    99   2e-20
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    98   3e-20
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    98   3e-20
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    98   4e-20
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    94   4e-20
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    94   5e-20
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    98   5e-20
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    96   5e-20
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    97   6e-20
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    97   8e-20
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    97   8e-20
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    97   8e-20
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    97   8e-20
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    97   9e-20
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    97   1e-19
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    97   1e-19
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    96   1e-19
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    96   1e-19
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    96   1e-19
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    96   1e-19
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    95   1e-19
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    96   1e-19
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    96   1e-19
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     96   2e-19
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    95   2e-19
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    96   3e-19
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    91   3e-19
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    95   3e-19
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    95   3e-19
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    95   4e-19
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    95   4e-19
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    95   4e-19
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    95   4e-19
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    95   4e-19
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    90   6e-19
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    94   6e-19
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    94   7e-19
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    94   7e-19
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    94   7e-19
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    94   7e-19
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    90   7e-19
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    90   7e-19
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    94   7e-19
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    90   8e-19
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    94   8e-19
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    94   9e-19
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    94   1e-18
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    93   1e-18
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    93   1e-18
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    93   1e-18
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    92   1e-18
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    89   1e-18
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    94   1e-18
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    89   1e-18
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    93   1e-18
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    93   1e-18
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    93   2e-18
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    93   2e-18
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    93   2e-18
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    92   2e-18
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    91   2e-18
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    89   2e-18
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    93   2e-18
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    92   2e-18
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    92   2e-18
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    91   2e-18
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    92   3e-18
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    91   3e-18
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    92   3e-18
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    92   3e-18
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        91   3e-18
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    92   3e-18
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    92   3e-18
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    88   3e-18
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    92   3e-18
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    91   4e-18
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    92   4e-18
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    92   4e-18
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    88   4e-18
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    88   4e-18
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    91   4e-18
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    92   4e-18
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    92   4e-18
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    90   4e-18
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    91   4e-18
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     91   4e-18
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    91   4e-18
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    91   5e-18
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    91   5e-18
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    90   5e-18
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    91   5e-18
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    91   5e-18
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    91   6e-18
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    91   6e-18
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    91   6e-18
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    90   6e-18
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    90   7e-18
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    90   7e-18
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    90   8e-18
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    90   8e-18
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    90   1e-17
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    90   1e-17
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    89   1e-17
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    90   1e-17
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    90   1e-17
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    91   1e-17
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    91   1e-17
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    87   1e-17
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    90   1e-17
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    90   1e-17
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    89   1e-17
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    90   1e-17
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    90   2e-17
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     89   2e-17
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    89   2e-17
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    86   2e-17
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    88   2e-17
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    89   2e-17
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    89   2e-17
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    90   2e-17
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    89   2e-17
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    90   2e-17
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    89   2e-17
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    89   2e-17
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    89   2e-17
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    84   3e-17
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    88   3e-17
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    89   3e-17
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    89   3e-17
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    88   3e-17
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    89   3e-17
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    89   3e-17
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    88   4e-17
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    88   4e-17
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    87   5e-17
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    88   5e-17
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    87   5e-17
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    88   5e-17
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    88   6e-17
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    87   6e-17
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    88   6e-17
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    88   6e-17
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    87   6e-17
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    88   7e-17
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    88   7e-17
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    88   8e-17
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    86   8e-17
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    87   9e-17
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    87   9e-17
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    85   9e-17
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    87   9e-17
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    87   9e-17
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    87   1e-16
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    87   1e-16
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    87   1e-16
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    87   1e-16
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    87   1e-16
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    87   1e-16
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    87   1e-16
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    87   1e-16
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    87   1e-16
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    87   1e-16
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    87   1e-16
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    84   1e-16
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    87   1e-16
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    86   2e-16
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    87   2e-16
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    86   2e-16
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    86   2e-16
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    86   2e-16
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    86   2e-16
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    86   2e-16
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    86   2e-16
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    86   2e-16
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    85   2e-16
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    85   3e-16
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    86   3e-16
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    86   3e-16
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    86   3e-16
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    86   3e-16
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    85   3e-16
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    82   3e-16
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    84   3e-16
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    83   3e-16
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    85   3e-16
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    84   3e-16
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    86   3e-16
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    86   3e-16
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    85   4e-16
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    85   4e-16
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    85   4e-16
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    85   4e-16
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    85   4e-16
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    84   4e-16
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    85   4e-16
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    84   4e-16
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               84   5e-16
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    84   5e-16
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    85   5e-16
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    82   5e-16
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    84   5e-16
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    85   6e-16
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    84   6e-16
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    84   6e-16
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    84   6e-16
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    84   7e-16
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               84   7e-16
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    83   7e-16
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    82   7e-16
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    84   7e-16
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    85   7e-16
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      84   7e-16
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    84   7e-16
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    84   8e-16
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    84   8e-16
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    84   8e-16
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              84   8e-16
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    84   8e-16
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    84   9e-16
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    83   1e-15
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    84   1e-15
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    83   1e-15
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    84   1e-15
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    84   1e-15
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    83   1e-15
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    84   1e-15
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    84   1e-15
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    84   1e-15
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    84   1e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    82   1e-15
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    83   1e-15
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    84   1e-15
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    82   1e-15
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    83   1e-15
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    83   2e-15
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    82   2e-15
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    83   2e-15
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    81   2e-15
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    83   2e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    83   2e-15
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    82   2e-15
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    82   2e-15
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    83   2e-15
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    83   2e-15
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    83   2e-15
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    83   2e-15
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    81   2e-15
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    82   2e-15
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    82   2e-15
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    80   3e-15
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    83   3e-15
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    82   3e-15
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    82   3e-15
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    82   3e-15
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    80   3e-15
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    82   3e-15
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    82   3e-15
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    80   3e-15
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    82   3e-15
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    82   3e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    81   3e-15
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    82   3e-15
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    82   4e-15
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    80   4e-15
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    82   4e-15
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    82   4e-15
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    82   4e-15
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    82   4e-15
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    82   4e-15
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    80   4e-15
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    82   4e-15
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    82   4e-15
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    82   4e-15
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    82   5e-15
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    81   5e-15
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    82   5e-15
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    82   5e-15
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    82   5e-15
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    80   5e-15
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    80   5e-15
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    81   5e-15
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    81   5e-15
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    81   5e-15
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    80   6e-15
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    80   6e-15
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    81   7e-15
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    81   7e-15
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    81   7e-15
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    81   7e-15
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    81   8e-15
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    80   8e-15
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    81   9e-15
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    80   1e-14
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    80   1e-14
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    80   1e-14
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    80   1e-14
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    80   1e-14
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    80   1e-14
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    76   1e-14
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    80   1e-14
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    80   1e-14
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    79   1e-14
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     78   1e-14
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    80   1e-14
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    80   1e-14
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    79   1e-14
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     80   1e-14
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    80   1e-14
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             80   1e-14
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     78   1e-14
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    80   1e-14
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     80   1e-14
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    80   1e-14
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    78   2e-14
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    80   2e-14
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    80   2e-14
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    80   2e-14
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    80   2e-14
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    79   2e-14
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    79   2e-14
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    79   2e-14
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    79   2e-14
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    80   2e-14
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    80   2e-14
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    77   2e-14
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    77   2e-14
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    78   2e-14
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    79   2e-14
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      79   2e-14
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    79   2e-14
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    79   2e-14
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    78   2e-14
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    79   2e-14
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    79   2e-14
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    79   3e-14
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    79   3e-14
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    79   3e-14
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    79   3e-14
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    79   3e-14
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    79   3e-14
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    78   3e-14
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    78   3e-14
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    79   3e-14
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    78   3e-14
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    79   3e-14
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    79   3e-14
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    79   3e-14
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    79   3e-14
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    78   3e-14
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    78   3e-14
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    79   3e-14
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    79   4e-14
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    79   4e-14
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    77   4e-14
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    78   4e-14
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    79   4e-14
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    79   4e-14
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    78   4e-14
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       79   4e-14
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    78   4e-14
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    78   4e-14
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    78   4e-14
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    78   4e-14
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    77   4e-14
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    78   4e-14
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    78   4e-14
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    79   4e-14
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    78   4e-14
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    79   4e-14
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    78   4e-14
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    79   4e-14
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    78   5e-14
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    78   5e-14
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    78   6e-14
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    77   6e-14
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    77   6e-14
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    78   6e-14
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    77   6e-14
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    77   6e-14
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    78   7e-14
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    78   7e-14
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    77   7e-14
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    78   7e-14
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    77   8e-14
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    77   8e-14
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    77   8e-14
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    77   8e-14
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    77   9e-14
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    77   9e-14
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    77   9e-14
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    77   9e-14
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    77   9e-14
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    77   9e-14
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    77   1e-13
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    77   1e-13
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    77   1e-13
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    77   1e-13
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    76   1e-13
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    77   1e-13
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    76   1e-13
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    77   1e-13
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    75   1e-13
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    76   1e-13
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    77   1e-13
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    77   1e-13
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    77   1e-13
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    77   1e-13
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    76   1e-13
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    77   1e-13
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    77   1e-13
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    77   1e-13
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    77   1e-13
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    77   1e-13
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    76   1e-13
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    76   1e-13
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    77   1e-13
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    77   1e-13
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    77   1e-13
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    76   2e-13
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    75   2e-13
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               75   2e-13
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    77   2e-13
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    76   2e-13
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    77   2e-13
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    75   2e-13
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    75   2e-13
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    76   2e-13
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    76   2e-13
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    75   2e-13
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    76   2e-13
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    76   2e-13
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    75   2e-13
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    77   2e-13
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     75   2e-13
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    75   2e-13
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    76   2e-13
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    76   2e-13
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    74   2e-13
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    76   2e-13
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    76   2e-13
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    76   2e-13
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    76   2e-13
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    75   2e-13
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    75   2e-13
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    75   2e-13
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    74   2e-13
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    75   2e-13
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    76   3e-13
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    75   3e-13
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    75   3e-13
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    75   3e-13
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    76   3e-13
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    76   3e-13
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    76   3e-13
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    75   3e-13
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    76   3e-13
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    75   3e-13
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       76   3e-13
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    75   3e-13
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    75   3e-13
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    76   3e-13
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    74   3e-13
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    75   3e-13
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    75   3e-13
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    75   3e-13
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             75   3e-13
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    74   3e-13
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    75   3e-13
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    75   3e-13
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    75   3e-13
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    74   3e-13
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    75   3e-13
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    75   3e-13
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    75   3e-13
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    75   3e-13
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    75   3e-13
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    75   3e-13
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    75   4e-13
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    74   4e-13
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    75   4e-13
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    75   4e-13
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    75   4e-13
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    74   4e-13
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    75   4e-13
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               75   4e-13
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     74   4e-13
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    75   4e-13
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    75   5e-13
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    75   5e-13
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    74   5e-13
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    75   5e-13
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    74   5e-13
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    74   5e-13
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    74   5e-13
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    75   5e-13
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    75   5e-13
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    75   5e-13
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    75   5e-13
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    74   5e-13
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    75   5e-13
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              75   5e-13
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    74   5e-13
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    74   5e-13
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    75   5e-13
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    75   5e-13
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    74   6e-13
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    75   6e-13
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    75   6e-13
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    74   6e-13
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    74   6e-13
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    74   6e-13
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    75   6e-13
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    74   6e-13
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    74   6e-13
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    74   7e-13
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    74   7e-13
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    75   7e-13
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    74   7e-13
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    73   7e-13
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    74   7e-13
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    74   7e-13
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    74   7e-13
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    74   8e-13
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    74   8e-13
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    75   8e-13
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    73   8e-13
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    74   8e-13
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    74   8e-13
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    74   8e-13
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    74   8e-13
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    74   8e-13
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    74   9e-13
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    74   9e-13
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    73   9e-13
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    73   9e-13
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    74   9e-13
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    74   9e-13
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    73   9e-13
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    74   1e-12
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    74   1e-12
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    74   1e-12
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 73   1e-12
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    72   1e-12
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    72   1e-12
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              74   1e-12
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    74   1e-12
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    73   1e-12
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    74   1e-12
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    74   1e-12
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    73   1e-12
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    73   1e-12
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               73   1e-12
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    73   1e-12
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    72   1e-12
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    72   1e-12
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    74   1e-12
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    73   1e-12
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    73   1e-12
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    73   1e-12
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    73   1e-12
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    72   2e-12
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    74   2e-12
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    72   2e-12
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    72   2e-12
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    73   2e-12
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    74   2e-12
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    72   2e-12
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    73   2e-12
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    73   2e-12
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    73   2e-12
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    73   2e-12
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               73   2e-12
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    73   2e-12
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    73   2e-12
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    72   2e-12
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    72   2e-12
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    73   2e-12
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    72   2e-12
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    72   2e-12
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    73   2e-12
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    72   2e-12
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    73   2e-12
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    73   2e-12
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    73   2e-12
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    73   2e-12
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    72   2e-12
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    73   2e-12
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    72   2e-12
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    72   2e-12
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    71   2e-12
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    72   2e-12
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     72   2e-12
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    72   2e-12
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    73   2e-12
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    72   2e-12
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    72   2e-12
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    72   2e-12
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    72   3e-12
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    73   3e-12
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              72   3e-12
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    71   3e-12
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    72   3e-12
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    73   3e-12
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              72   3e-12
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    72   3e-12
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    72   3e-12
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    71   3e-12
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    72   3e-12
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    72   3e-12
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    70   3e-12
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    72   3e-12
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    72   3e-12
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    72   3e-12
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    71   3e-12
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    72   3e-12
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    71   3e-12
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    71   3e-12
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    71   3e-12
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    71   3e-12
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    72   3e-12
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    70   4e-12
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    71   4e-12
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    71   4e-12
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    72   4e-12
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    70   4e-12
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    72   4e-12
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    72   4e-12
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    72   4e-12
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    71   4e-12
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    72   4e-12
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    72   4e-12
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    72   4e-12
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    72   4e-12
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    72   5e-12
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    71   5e-12
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    70   5e-12
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    72   5e-12
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    72   5e-12
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    70   5e-12
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    72   5e-12
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    71   5e-12
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    71   6e-12
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    70   6e-12
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    70   6e-12
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    70   6e-12
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    71   6e-12
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    71   6e-12
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    71   6e-12
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    70   6e-12
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    71   7e-12
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    70   7e-12
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    70   7e-12
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    70   7e-12
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    71   7e-12
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    71   7e-12
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    70   7e-12
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    70   7e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    70   8e-12
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    71   8e-12
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    71   8e-12
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    71   8e-12
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    71   8e-12
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    71   9e-12
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    71   9e-12
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    71   9e-12
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    70   9e-12
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    71   9e-12
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    71   1e-11
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    70   1e-11
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    69   1e-11
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    70   1e-11
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    70   1e-11
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    70   1e-11
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    70   1e-11
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    69   1e-11
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    70   1e-11
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    69   1e-11
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    70   1e-11
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    70   1e-11
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    70   1e-11
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    70   1e-11
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    69   1e-11
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    70   1e-11
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    70   1e-11
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    68   1e-11
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    69   1e-11
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    70   1e-11
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    70   1e-11
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    69   1e-11
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    70   2e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    70   2e-11
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    69   2e-11
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    69   2e-11
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    69   2e-11
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     69   2e-11
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    69   2e-11
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    70   2e-11
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    69   2e-11
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    69   2e-11
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    68   2e-11
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    69   2e-11
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    69   2e-11
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    70   2e-11
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    69   2e-11
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    69   2e-11
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    68   2e-11
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    69   2e-11
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    70   2e-11
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    70   2e-11
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    69   2e-11
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    69   2e-11
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    70   2e-11
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    70   2e-11
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    68   2e-11
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    69   2e-11
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    69   2e-11
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    69   2e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    70   2e-11
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    68   2e-11
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    67   2e-11
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    69   2e-11
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    69   2e-11
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    69   2e-11
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    69   2e-11
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    69   3e-11
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    68   3e-11
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    69   3e-11
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    69   3e-11
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    69   3e-11
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    69   3e-11
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    69   3e-11
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    68   3e-11
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    69   3e-11
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    69   3e-11
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    69   3e-11
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    69   3e-11
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    69   3e-11
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    69   3e-11
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    69   3e-11
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    68   3e-11
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    69   3e-11
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    69   4e-11
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    69   4e-11
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    68   4e-11
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    68   4e-11
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    69   4e-11
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    68   4e-11
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    68   4e-11
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    69   4e-11
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    68   4e-11
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    69   4e-11
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    69   4e-11
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    67   4e-11
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    69   4e-11
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    68   4e-11
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    69   4e-11
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    69   4e-11
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    69   4e-11
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    69   4e-11
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    67   4e-11
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    68   5e-11
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    68   5e-11
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    68   5e-11
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    68   5e-11
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    69   5e-11
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    69   5e-11
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    67   5e-11
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    68   5e-11
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    68   5e-11
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    67   5e-11
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    68   5e-11
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    69   5e-11
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    67   6e-11
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    67   6e-11
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    67   6e-11
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    67   6e-11
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    69   6e-11
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    67   6e-11
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    68   6e-11
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               67   6e-11
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    68   6e-11
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    69   6e-11
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    66   6e-11
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    68   6e-11
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     68   6e-11
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    67   6e-11
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    68   6e-11
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    67   6e-11
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    68   6e-11
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    66   7e-11
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    68   7e-11
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    67   7e-11
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    68   7e-11
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    67   7e-11
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     68   7e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     68   7e-11
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    68   7e-11
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    67   7e-11
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    68   7e-11
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    67   7e-11
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    68   7e-11
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    67   7e-11
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    68   7e-11
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    67   7e-11
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    67   8e-11
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    67   8e-11
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    67   8e-11
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    67   8e-11
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    67   8e-11
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    67   8e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    68   8e-11
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    67   8e-11
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    68   8e-11
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    67   8e-11
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    68   8e-11
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    67   9e-11
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    68   9e-11
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    67   9e-11
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    66   9e-11
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    67   9e-11
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    67   9e-11
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    66   1e-10
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    67   1e-10
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    67   1e-10
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    66   1e-10
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    67   1e-10
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    67   1e-10
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    67   1e-10
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    66   1e-10
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    66   1e-10
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    66   1e-10
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    67   1e-10
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    66   1e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    67   1e-10
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    67   1e-10
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    67   1e-10
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    67   1e-10
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    65   1e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    67   1e-10
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    64   1e-10
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    66   1e-10
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     66   2e-10
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    67   2e-10
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    67   2e-10
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    67   2e-10
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    66   2e-10
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    67   2e-10
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    66   2e-10
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    66   2e-10
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    67   2e-10
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    66   2e-10
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    65   2e-10
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    67   2e-10
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    65   2e-10
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    65   2e-10
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    65   2e-10
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    66   2e-10
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    67   2e-10
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    66   2e-10
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    66   2e-10
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    66   2e-10
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    67   2e-10
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    65   2e-10
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    66   2e-10
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    66   2e-10
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    66   2e-10
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       65   2e-10
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               65   2e-10
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    65   2e-10
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    66   2e-10
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    66   2e-10
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    66   2e-10
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    66   2e-10
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    66   2e-10
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    66   2e-10
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    66   2e-10
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    64   2e-10
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    65   2e-10
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    66   2e-10
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    66   3e-10
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    66   3e-10
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    66   3e-10
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    66   3e-10
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    66   3e-10
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               66   3e-10
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    65   3e-10
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    65   3e-10
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    65   3e-10
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    66   3e-10
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    66   3e-10
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    65   3e-10
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    65   3e-10
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    65   3e-10
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    65   3e-10
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    66   3e-10
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    65   3e-10
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    66   3e-10
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    66   3e-10
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    65   3e-10
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    66   3e-10
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    65   3e-10
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    65   3e-10
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    66   3e-10
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    65   3e-10
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    65   3e-10
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    65   3e-10
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    64   4e-10
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    65   4e-10
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    65   4e-10
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    65   4e-10
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    65   4e-10
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               65   4e-10
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    65   4e-10
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    65   4e-10
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    65   4e-10
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    65   4e-10
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    64   4e-10
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    65   4e-10
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    64   4e-10
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    64   4e-10
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    65   5e-10
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    64   5e-10
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    65   5e-10
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    65   5e-10
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    65   5e-10
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    65   5e-10
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    65   5e-10
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    65   5e-10
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    65   5e-10
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    65   5e-10
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    63   6e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    65   6e-10
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    65   6e-10
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    65   6e-10
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    65   6e-10
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    64   6e-10
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    64   6e-10
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    65   6e-10
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    64   6e-10
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    64   6e-10
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    64   6e-10
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    64   6e-10
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    64   7e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    65   7e-10
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    64   7e-10
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    64   7e-10
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    65   7e-10
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    64   7e-10
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              64   7e-10
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    64   7e-10
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    64   8e-10
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    64   8e-10
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    65   8e-10
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    64   8e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    65   8e-10
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    64   8e-10
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    64   8e-10
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    64   8e-10
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    64   8e-10
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    64   8e-10
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    64   8e-10
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    64   8e-10
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    64   8e-10
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    63   8e-10
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    64   9e-10
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    64   9e-10
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    64   9e-10
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    63   9e-10
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    64   9e-10
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    63   9e-10
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    64   9e-10
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    64   9e-10
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    64   9e-10
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    64   1e-09
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    64   1e-09
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    63   1e-09
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    64   1e-09
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    64   1e-09
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    63   1e-09
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               64   1e-09
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    64   1e-09
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    63   1e-09
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    64   1e-09
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    63   1e-09
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               64   1e-09
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    64   1e-09
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    64   1e-09
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    64   1e-09
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    64   1e-09
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    64   1e-09
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    64   1e-09
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    63   1e-09
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    63   1e-09
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    64   1e-09
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    63   1e-09
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    64   1e-09
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    64   1e-09
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    64   1e-09
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    64   2e-09
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    63   2e-09
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    62   2e-09
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    63   2e-09
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    63   2e-09
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    64   2e-09
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    64   2e-09
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    62   2e-09
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    64   2e-09
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    62   2e-09
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    63   2e-09
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    63   2e-09
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    64   2e-09
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    63   2e-09
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    63   2e-09
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     62   2e-09
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    63   2e-09
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    60   2e-09
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    63   2e-09
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    62   2e-09
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    63   2e-09
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    62   2e-09
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    63   2e-09
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    63   2e-09
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    63   2e-09
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    63   2e-09
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    63   2e-09
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    63   2e-09
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    63   2e-09
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    64   2e-09
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    63   2e-09
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    62   2e-09
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    63   2e-09
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    63   2e-09
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    61   2e-09
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    63   2e-09
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    63   2e-09
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    62   2e-09
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    63   2e-09
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    63   2e-09
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    62   2e-09
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    63   2e-09
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    63   2e-09
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    63   2e-09
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    63   2e-09
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    63   2e-09
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    62   2e-09
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    63   3e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    62   3e-09
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    63   3e-09
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    62   3e-09
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    63   3e-09
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    63   3e-09
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    63   3e-09
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    63   3e-09
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               62   3e-09
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    63   3e-09
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    63   3e-09
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    62   3e-09
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    63   3e-09
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    63   3e-09
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    62   3e-09
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    62   3e-09
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    62   3e-09
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    63   3e-09
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    62   3e-09
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    62   3e-09
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    61   4e-09
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    62   4e-09
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    62   4e-09
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    62   4e-09
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    62   4e-09
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    62   4e-09
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    62   4e-09
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    62   4e-09
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    62   4e-09
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    62   4e-09
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    62   4e-09
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    62   4e-09
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    63   4e-09
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    60   4e-09
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    62   4e-09
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    61   4e-09
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              60   4e-09
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    61   4e-09
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    62   4e-09
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    62   4e-09
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    60   4e-09
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    62   4e-09
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    62   5e-09
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    61   5e-09
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    62   5e-09
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    62   5e-09
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    62   5e-09
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    62   5e-09
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    62   5e-09
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    60   5e-09
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    62   5e-09
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    61   5e-09
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    62   5e-09
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    62   5e-09
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    61   5e-09
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    62   5e-09
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    62   6e-09
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    61   6e-09
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    62   6e-09
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    61   6e-09
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    62   6e-09
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    61   6e-09
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    62   6e-09
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    61   6e-09
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    62   6e-09
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    61   6e-09
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    62   6e-09
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    61   6e-09
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    61   6e-09
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    62   6e-09
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    62   6e-09
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    62   6e-09
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    62   6e-09
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    61   7e-09
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    62   7e-09
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    62   7e-09
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    61   7e-09
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    62   7e-09
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    62   7e-09
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    61   7e-09
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    61   7e-09
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    61   7e-09
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    60   7e-09
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    61   8e-09
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    61   8e-09
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    62   8e-09
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    61   8e-09
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    60   8e-09
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    60   8e-09
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    61   8e-09
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    61   8e-09
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    60   8e-09
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    61   9e-09
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    61   9e-09
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    61   9e-09
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    61   1e-08
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    60   1e-08
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    60   1e-08
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    60   1e-08
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    61   1e-08
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    60   1e-08
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    61   1e-08
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    59   1e-08
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    60   1e-08
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    60   1e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    59   1e-08
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    60   1e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    60   1e-08
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    61   1e-08
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    59   1e-08
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    61   1e-08
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    60   1e-08
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    60   1e-08
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    60   1e-08
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    61   1e-08
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    60   1e-08
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    60   1e-08
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    60   1e-08
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    60   1e-08
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    60   1e-08
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    60   1e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    60   1e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    60   1e-08
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    60   1e-08
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    60   1e-08
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    60   1e-08
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    60   2e-08
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    59   2e-08
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    60   2e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               59   2e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    59   2e-08
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    60   2e-08
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              60   2e-08
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    60   2e-08
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    60   2e-08
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     60   2e-08
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    60   2e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    60   2e-08
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    59   2e-08
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    59   2e-08
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    60   2e-08
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    60   2e-08
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    60   2e-08
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    60   2e-08
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    59   2e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    59   2e-08
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    59   2e-08
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    60   2e-08
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    59   2e-08
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    59   2e-08
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    60   2e-08
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    60   2e-08
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    60   2e-08
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    60   2e-08
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    59   2e-08
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    59   2e-08
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    58   2e-08
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    59   2e-08
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    60   3e-08
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    59   3e-08
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    59   3e-08
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    58   3e-08
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    59   3e-08
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    60   3e-08
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    60   3e-08
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    59   3e-08
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    59   3e-08
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    58   3e-08
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    60   3e-08
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    59   3e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    59   3e-08
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    59   3e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    59   3e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    59   3e-08
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     58   3e-08
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    59   3e-08
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    59   3e-08
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    59   3e-08
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    59   3e-08
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    59   4e-08
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      59   4e-08
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    59   4e-08
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    59   4e-08
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      59   4e-08
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    59   4e-08
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    59   4e-08
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    57   4e-08
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    59   4e-08
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    59   4e-08
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     59   4e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    58   4e-08
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    59   4e-08
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    59   4e-08
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     59   4e-08
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    59   5e-08
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    58   5e-08
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    59   5e-08
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    57   5e-08
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    59   5e-08
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    59   5e-08
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    58   5e-08
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    58   6e-08
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    59   6e-08
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    59   6e-08
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    58   6e-08
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    58   7e-08
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    58   8e-08
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    58   8e-08
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    57   8e-08
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    57   8e-08
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    58   8e-08
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    58   8e-08
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    58   8e-08
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    58   8e-08
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    58   8e-08
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    58   9e-08
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              58   9e-08
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    57   9e-08
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    58   9e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    58   9e-08
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    57   1e-07
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    58   1e-07
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    57   1e-07
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    58   1e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    57   1e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    57   1e-07
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    58   1e-07
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    57   1e-07
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    57   1e-07
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    57   1e-07
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    57   1e-07
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    57   1e-07
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     57   1e-07
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    57   1e-07
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    57   1e-07
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    57   1e-07
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    57   1e-07
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    57   1e-07
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    57   1e-07
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    57   1e-07
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    57   1e-07
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    57   1e-07
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     57   1e-07
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    56   1e-07
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    57   1e-07
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    57   1e-07
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    56   1e-07
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    56   1e-07
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    57   2e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    57   2e-07
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     56   2e-07
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    57   2e-07
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    57   2e-07
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    57   2e-07
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    57   2e-07
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               56   2e-07
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    57   2e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    56   2e-07
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    57   2e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    57   2e-07
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    56   2e-07
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    57   2e-07
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    57   2e-07
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    56   2e-07
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    57   2e-07
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    57   2e-07
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    56   2e-07
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    56   3e-07
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    57   3e-07
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    56   3e-07
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    56   3e-07
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    57   3e-07
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    56   3e-07
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    56   3e-07
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    56   3e-07
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    56   3e-07
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    55   3e-07
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      56   3e-07
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    56   3e-07
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    56   3e-07
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    55   3e-07
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    56   3e-07
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    56   3e-07
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    56   3e-07
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    56   3e-07
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    56   4e-07
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    55   4e-07
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    55   4e-07
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    55   4e-07
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    56   4e-07
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    55   4e-07
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    55   5e-07
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    55   5e-07
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    55   5e-07
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    55   5e-07
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    55   5e-07
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    55   5e-07
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    55   6e-07
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    55   6e-07
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    54   6e-07
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    55   6e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    55   7e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    55   7e-07
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    55   7e-07
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    54   7e-07
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    55   7e-07
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    55   7e-07
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    54   8e-07
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    55   8e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    55   8e-07
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    54   8e-07
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    55   8e-07
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    55   8e-07
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      54   9e-07
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    54   9e-07
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    55   9e-07
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    54   9e-07
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    54   9e-07
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    54   9e-07
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    54   1e-06
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    54   1e-06
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    54   1e-06
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    54   1e-06
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    54   1e-06
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    54   1e-06
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    54   1e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    55   1e-06
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    54   1e-06
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    54   1e-06
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    54   1e-06
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     54   1e-06
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    53   1e-06
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    54   1e-06
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    54   1e-06
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    54   1e-06
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    54   1e-06
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    53   1e-06
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    53   1e-06
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    54   2e-06
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    53   2e-06
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    53   2e-06
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    54   2e-06
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    54   2e-06
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    53   2e-06
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    54   2e-06
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    53   2e-06
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    54   2e-06
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    53   2e-06
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    54   2e-06
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    54   2e-06
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    54   2e-06
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    54   2e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    54   2e-06
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    53   2e-06
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    53   2e-06
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              54   2e-06
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    52   2e-06
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               53   2e-06
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    53   2e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    53   2e-06
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    53   2e-06
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    53   2e-06
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    52   2e-06
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    53   2e-06
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    52   2e-06
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    53   2e-06
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    52   2e-06
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    53   2e-06
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    53   2e-06
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    53   2e-06
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    54   2e-06
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    53   3e-06
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    53   3e-06
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    53   3e-06
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    53   3e-06
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    52   3e-06
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    52   3e-06
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    52   3e-06
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    53   3e-06
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    53   3e-06
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    53   3e-06
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    52   3e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    52   4e-06
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    53   4e-06
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    53   4e-06
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    53   4e-06
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    52   4e-06
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    52   4e-06
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    52   4e-06
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    52   4e-06
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    52   4e-06
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    52   4e-06
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    52   4e-06
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    52   4e-06
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    53   4e-06
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    53   4e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    52   4e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    52   4e-06
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    52   5e-06
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    49   5e-06
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    52   5e-06
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    52   5e-06
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    52   5e-06
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    52   5e-06
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    52   5e-06
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    52   5e-06
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    52   5e-06
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              52   5e-06
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    52   6e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    52   6e-06
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    51   6e-06
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    52   6e-06
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    52   6e-06
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    52   6e-06
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    52   6e-06
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    52   6e-06
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    52   6e-06
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    52   7e-06
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    51   7e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    52   7e-06
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    52   7e-06
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    51   7e-06
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    51   8e-06
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    50   8e-06
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    51   8e-06
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    51   8e-06
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    52   9e-06
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    51   9e-06
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    51   9e-06
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    51   9e-06
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    51   9e-06
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    51   9e-06
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    51   9e-06
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    51   9e-06
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    51   1e-05
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    50   1e-05
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    51   1e-05
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    51   1e-05
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    51   1e-05
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    51   1e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    51   1e-05
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    50   1e-05
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    51   1e-05
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    51   1e-05
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    50   1e-05
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    50   1e-05
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    51   1e-05
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    50   1e-05
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    51   1e-05
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    51   1e-05
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    50   1e-05
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      51   1e-05
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    51   1e-05
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    51   1e-05
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    51   1e-05
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    51   1e-05
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    50   1e-05
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    50   1e-05
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    50   1e-05
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    50   1e-05
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    50   1e-05
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               50   1e-05
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    50   1e-05
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    50   1e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    51   2e-05
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    50   2e-05
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    51   2e-05
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    50   2e-05
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    50   2e-05
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    50   2e-05
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    50   2e-05
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    50   2e-05
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    50   2e-05
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    50   2e-05
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    50   2e-05
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    50   2e-05
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    50   2e-05
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    49   2e-05
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    50   2e-05
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    50   2e-05
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               50   2e-05
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    50   2e-05
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    50   2e-05
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    50   2e-05
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    49   2e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    50   2e-05
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    50   2e-05
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    50   2e-05
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    50   2e-05
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    50   2e-05
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    50   2e-05
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    50   2e-05
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    50   2e-05
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    50   2e-05
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    50   2e-05
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    50   2e-05
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    50   2e-05
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    50   2e-05
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    50   3e-05
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    50   3e-05
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    49   3e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    50   3e-05
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    50   3e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    50   3e-05
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    49   3e-05
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    50   3e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    50   3e-05
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               50   3e-05
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    50   3e-05
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    49   3e-05
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    49   3e-05
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    50   3e-05
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    50   3e-05
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    49   3e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    49   3e-05
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    49   3e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    50   3e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    49   3e-05
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    49   4e-05
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    49   4e-05
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    49   4e-05
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             49   4e-05
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    49   4e-05
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    49   4e-05
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    49   4e-05
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    49   4e-05
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    49   4e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    49   4e-05
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    49   5e-05
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    49   5e-05
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    49   5e-05
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    49   5e-05
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    49   5e-05
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    49   5e-05
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    49   5e-05
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    49   6e-05
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    48   6e-05
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    49   6e-05
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    48   6e-05
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    49   6e-05
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    48   6e-05
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    48   6e-05
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    48   7e-05
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    48   7e-05
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    49   7e-05
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    48   7e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    48   7e-05
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    48   7e-05
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    47   8e-05
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    49   8e-05
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    48   8e-05
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    48   8e-05
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    48   8e-05
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    48   9e-05
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    47   9e-05
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    47   9e-05
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    48   1e-04
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    48   1e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    48   1e-04
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    48   1e-04
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    48   1e-04
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    47   1e-04
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    48   1e-04
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    48   1e-04
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    48   1e-04
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     48   1e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    48   1e-04
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    48   1e-04
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    48   1e-04
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    47   1e-04
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    48   1e-04
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    47   1e-04
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    48   1e-04
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    47   1e-04
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    47   1e-04
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    47   1e-04
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    48   1e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    48   1e-04
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    47   1e-04
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    47   1e-04
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    48   1e-04
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    47   1e-04
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    47   2e-04
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    47   2e-04
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    47   2e-04
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    47   2e-04
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    47   2e-04
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    47   2e-04
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    47   2e-04
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    47   2e-04
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    47   2e-04
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    47   2e-04
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    47   2e-04
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     47   2e-04
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    47   2e-04
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    46   2e-04
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    47   2e-04
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    47   2e-04
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    47   2e-04
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    47   2e-04
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     47   2e-04
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    46   3e-04
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    47   3e-04
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    47   3e-04
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    46   3e-04
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    46   3e-04
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    46   3e-04
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    46   3e-04
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    46   3e-04
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    46   3e-04
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    46   3e-04
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    46   4e-04
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    46   4e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    45   4e-04
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    46   5e-04
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    46   5e-04
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    46   5e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    45   5e-04
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    46   5e-04
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    46   5e-04
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    46   5e-04
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    45   5e-04
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    45   5e-04
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    45   5e-04
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    45   5e-04
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    45   5e-04
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    45   6e-04
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    45   6e-04
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    45   6e-04
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    45   6e-04
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    45   6e-04
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    45   6e-04
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    45   6e-04
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    45   6e-04
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    45   6e-04
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    45   6e-04
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     45   7e-04
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    45   7e-04
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    45   7e-04
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    45   7e-04
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    45   8e-04
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    45   8e-04
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    45   8e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    45   8e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    45   9e-04
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    45   0.001
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    44   0.001
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    44   0.001
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    44   0.001
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    44   0.001
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    44   0.001
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    44   0.001
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    44   0.001
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    44   0.001
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    44   0.001
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    44   0.001
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    44   0.001
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    44   0.001
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    44   0.001
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    44   0.001
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    44   0.002
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    44   0.002
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    44   0.002
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    44   0.002
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    44   0.002
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    44   0.002
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    44   0.002
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    44   0.002
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    44   0.002
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    44   0.002
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    44   0.002
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    44   0.002
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    44   0.002
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    44   0.002
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    44   0.002
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    44   0.003
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    44   0.003
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    43   0.003
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    43   0.003
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    43   0.003
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    43   0.003
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    43   0.003
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    43   0.003
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    43   0.003
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    42   0.003
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    43   0.003
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    43   0.003
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    43   0.003
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    43   0.003
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    43   0.004
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    42   0.004
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    43   0.004
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    42   0.004
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    43   0.004
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    42   0.004
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    43   0.004
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    42   0.005
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    42   0.005
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    42   0.005
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    42   0.005
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    42   0.005
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    42   0.005
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    42   0.006
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    42   0.006
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    42   0.006
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    42   0.006
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    42   0.006
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    42   0.007
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    42   0.007
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    42   0.007
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    42   0.007
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    42   0.008
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    42   0.008
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    42   0.008
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    42   0.008
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    42   0.009
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    42   0.009
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    42   0.009
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    42   0.010
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    42   0.010
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    41   0.011
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    41   0.011
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    41   0.011
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    41   0.011
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    41   0.011
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    41   0.012
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    41   0.013
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    41   0.014
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    41   0.014
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    41   0.014
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     41   0.017
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    40   0.017
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    40   0.017
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    40   0.017
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    40   0.018
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    41   0.019
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    40   0.019
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    40   0.019
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    40   0.019
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    40   0.020
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    40   0.020
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    40   0.021
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    40   0.022
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    40   0.023
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     40   0.023
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    40   0.023
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    40   0.026
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    40   0.027
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    40   0.028
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    40   0.028
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    40   0.030
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    40   0.030
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    40   0.030
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    40   0.034
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    40   0.036
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    40   0.037
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    40   0.037
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    40   0.039
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    39   0.043
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    39   0.044
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    39   0.045
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    39   0.046
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    39   0.046
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       39   0.050
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    39   0.051
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    39   0.057
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    39   0.058
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    39   0.067
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    39   0.075
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    39   0.077
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    39   0.078
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    38   0.079
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     38   0.086
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    39   0.087
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    38   0.089
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    38   0.092
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    38   0.096
Smik_5.268 Chr5 (413820..415397) [1578 bp, 525 aa] {ON} YER123W ...    38   0.098
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    38   0.099
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    38   0.10 
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    38   0.11 
Skud_5.255 Chr5 complement(415109..416686) [1578 bp, 525 aa] {ON...    38   0.11 
YER123W Chr5 (404813..406387) [1575 bp, 524 aa] {ON}  YCK3Palmit...    38   0.12 
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    38   0.12 
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    38   0.12 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    38   0.12 
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    38   0.12 
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    38   0.13 
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    38   0.13 
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    38   0.13 
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    38   0.13 
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    37   0.14 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    37   0.14 
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    37   0.14 
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    37   0.16 
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    37   0.16 
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    37   0.17 
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    37   0.18 
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    37   0.20 
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    37   0.21 
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    37   0.21 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    37   0.22 
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    37   0.23 
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    37   0.24 
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    37   0.25 
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    37   0.26 
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    37   0.26 
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    37   0.29 
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    37   0.29 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    37   0.29 
NCAS0B04520 Chr2 (821360..822787) [1428 bp, 475 aa] {ON} Anc_8.132     37   0.29 
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    37   0.30 
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    36   0.30 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    37   0.34 
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    37   0.34 
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    36   0.35 
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    36   0.36 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    37   0.36 
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    36   0.36 
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    36   0.36 
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    36   0.36 
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    36   0.38 
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    36   0.38 
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    36   0.39 
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    36   0.40 
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    36   0.41 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     36   0.42 
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    36   0.43 
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    36   0.43 
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    36   0.48 
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    36   0.48 
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    36   0.48 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    36   0.49 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    36   0.50 
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    36   0.50 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    36   0.52 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    36   0.53 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    36   0.54 
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    35   0.55 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    35   0.57 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    35   0.58 
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    35   0.59 
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    35   0.61 
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    36   0.61 
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     35   0.63 
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    35   0.64 
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    35   0.65 
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    35   0.67 
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    34   0.70 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    35   0.71 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    35   0.71 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    35   0.76 
Kwal_47.17314 s47 complement(347091..348356) [1266 bp, 421 aa] {...    35   0.77 
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    35   0.78 
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    35   0.80 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    35   0.83 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    35   0.84 
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    35   0.86 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    35   0.88 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    35   0.88 
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    35   0.89 
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    35   0.91 
ZYRO0E02376g Chr5 complement(181177..182817) [1641 bp, 546 aa] {...    35   0.93 
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    35   0.96 
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    35   0.96 
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    35   0.98 
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    35   1.0  
TDEL0F01010 Chr6 complement(178943..180418) [1476 bp, 491 aa] {O...    35   1.0  
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    35   1.1  
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    35   1.2  
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    34   1.3  
KLTH0E06952g Chr5 complement(639783..641045) [1263 bp, 420 aa] {...    34   1.3  
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    35   1.3  
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    34   1.3  
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    34   1.4  
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    35   1.4  
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    34   1.4  
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    34   1.5  
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     34   1.5  
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    34   1.6  
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    34   1.7  
KLTH0F17468g Chr6 complement(1412804..1413529) [726 bp, 241 aa] ...    33   1.7  
TBLA0G02780 Chr7 (730835..732529) [1695 bp, 564 aa] {ON} Anc_8.1...    34   1.8  
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    34   1.9  
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    34   1.9  
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    34   2.2  
KLLA0E13531g Chr5 (1193481..1194902) [1422 bp, 473 aa] {ON} some...    33   2.4  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    33   2.4  
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    33   2.5  
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    33   2.6  
SAKL0B06468g Chr2 complement(553462..557226) [3765 bp, 1254 aa] ...    33   2.8  
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    33   3.5  
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    33   4.3  
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    32   5.3  
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    32   5.5  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    33   5.6  
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    32   5.8  
KNAG0M02360 Chr13 complement(436455..439187) [2733 bp, 910 aa] {...    32   7.7  
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    32   9.0  
KLTH0F07304g Chr6 (635266..635712) [447 bp, 148 aa] {ON} similar...    30   9.6  

>KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 837

 Score = 1634 bits (4231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 791/837 (94%), Positives = 791/837 (94%)

Query: 1   MSSYTVRSSVPGAPSNRRLEFPARRTSVQSLARDDSDDENMLGPPKLSNFGSALLSDKEN 60
           MSSYTVRSSVPGAPSNRRLEFPARRTSVQSLARDDSDDENMLGPPKLSNFGSALLSDKEN
Sbjct: 1   MSSYTVRSSVPGAPSNRRLEFPARRTSVQSLARDDSDDENMLGPPKLSNFGSALLSDKEN 60

Query: 61  VEPYPYSRNQSVSNAKRYSQPPRAAARPETFGAVREFSSSNTNNSVAGPYSTFHSEEHSD 120
           VEPYPYSRNQSVSNAKRYSQPPRAAARPETFGAVREFSSSNTNNSVAGPYSTFHSEEHSD
Sbjct: 61  VEPYPYSRNQSVSNAKRYSQPPRAAARPETFGAVREFSSSNTNNSVAGPYSTFHSEEHSD 120

Query: 121 STMFATSKHNQQSMTTFNPETPSEQGKPEDMYLEKSRSRVKSMQQTLRDEXXXXXXXXXX 180
           STMFATSKHNQQSMTTFNPETPSEQGKPEDMYLEKSRSRVKSMQQTLRDE          
Sbjct: 121 STMFATSKHNQQSMTTFNPETPSEQGKPEDMYLEKSRSRVKSMQQTLRDELSLRSSKRRN 180

Query: 181 XXXXXXXXXXLGPAKRASSNTGTPNHSELADESNVSQQEANFSHSSSAGATAHQNEYNVF 240
                     LGPAKRASSNTGTPNHSELADESNVSQQEANFSHSSSAGATAHQNEYNVF
Sbjct: 181 RRFVSSRFNLLGPAKRASSNTGTPNHSELADESNVSQQEANFSHSSSAGATAHQNEYNVF 240

Query: 241 YESQNSSSPQKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQK 300
           YESQNSSSPQKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQK
Sbjct: 241 YESQNSSSPQKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQK 300

Query: 301 GENRKTALRKNIAAKDAFQTRLTSASLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATN 360
           GENRKTALRKNIAAKDAFQTRLTSASLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATN
Sbjct: 301 GENRKTALRKNIAAKDAFQTRLTSASLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATN 360

Query: 361 NDXXXXXXXXXXXKGLKTAPSRDGTSPRASEMYENIERPERDTFGSIRRREALSNININS 420
           ND           KGLKTAPSRDGTSPRASEMYENIERPERDTFGSIRRREALSNININS
Sbjct: 361 NDSKAWSSPVSSSKGLKTAPSRDGTSPRASEMYENIERPERDTFGSIRRREALSNININS 420

Query: 421 NYHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVE 480
           NYHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVE
Sbjct: 421 NYHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVE 480

Query: 481 PLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXX 540
           PLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSS              
Sbjct: 481 PLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSKVYKVKNVANNKVY 540

Query: 541 XLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSH 600
            LKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSH
Sbjct: 541 ALKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSH 600

Query: 601 TLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIAN 660
           TLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIAN
Sbjct: 601 TLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIAN 660

Query: 661 AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQM 720
           AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQM
Sbjct: 661 AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQM 720

Query: 721 IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSV 780
           IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSV
Sbjct: 721 IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSV 780

Query: 781 DEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837
           DEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL
Sbjct: 781 DEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837

>Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028C
           (MPS1) - serine/threonine/tyrosine protein kinase (dual
           specificity), able to autophosphorylate as well as act
           on Mad1p. A mutation predicted to abolish kinase
           function eliminates in vitro protein kinase activity and
           behaves like a null mutation in vivo. [contig 105] FULL
          Length = 838

 Score = 1092 bits (2825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/843 (65%), Positives = 646/843 (76%), Gaps = 11/843 (1%)

Query: 1   MSSYTVRSS-VPGAPSNRRLEFPARRTSVQSLARDDSDDENMLGPPKLSNFGSALLSDKE 59
           MSSY+VRS+ +   P  R L+F  RR ++ S ARDDSDDENMLGPP LSNFGSALLSDKE
Sbjct: 1   MSSYSVRSNLISKPPEIRGLDFRPRRPNIHSTARDDSDDENMLGPPTLSNFGSALLSDKE 60

Query: 60  NVEPY---PYSRNQSVSNAKR-YSQPPRAAARPETFGAVREFSSSNTNNSVAGPYSTFHS 115
           NVEP+     SR+  ++   R +SQ P   +R ET    REFS++NTN+S  GP+ST HS
Sbjct: 61  NVEPHRSTASSRHHPLNQMSRTHSQLP---SRTETLAMSREFSTANTNSSYTGPHSTIHS 117

Query: 116 EEHSDSTMFATSKHNQQSMTTFNPETPSEQGKPEDMYLEKSRSRVKSMQQTLRDEXXXXX 175
            +HSDST+FAT K NQQSMTTFNP+    Q   + + LE+SRS++KS+QQ LRD+     
Sbjct: 118 VDHSDSTLFATFKDNQQSMTTFNPDDQLHQSGLDRVSLEQSRSKIKSLQQALRDDLSSRN 177

Query: 176 XXXXXXXXXXXXXXXLGPAKRASSNTGTPNHSELADESNVSQQEANFSHSSSAGATAHQN 235
                          LGPAKRASS +GTPN SEL +ESN+SQ E N S+SS+  A+A+ N
Sbjct: 178 SKRRTRRFASSRLSLLGPAKRASSTSGTPNRSELIEESNISQPEGNISNSSTRTASANLN 237

Query: 236 EYNVFYESQNSSSPQKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLY 295
           E+N+FYE QNS+   + S +P   ++INY+++EFGDLNPYQYLKK+N+PTTELPNISR+Y
Sbjct: 238 EHNIFYEPQNSNQAIQSSHSPFISSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIY 297

Query: 296 FERQKGENRKTALRKNIAAKDAFQTRLTSASLSNSPLLKHVDLIKREQSIPKRQPRRKIS 355
           FERQKG+NRK ALRK+IA+KDA Q R+ + S  +SP +   D I+R+ S  KRQPRRKIS
Sbjct: 298 FERQKGQNRKAALRKSIASKDAIQNRIATTSSPHSPPVD-ADAIRRDNSAFKRQPRRKIS 356

Query: 356 DHATNNDXXXXXXXXXXXKGLKTAPSRDGTSPRASEMYENIERPERDTFGSIRRREALSN 415
           + AT+ND                A +R     +A E Y N E P+ + F S RRREALSN
Sbjct: 357 ESATSNDPKAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSN 416

Query: 416 ININS-NYHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERK 474
           ININS +  Q Q+K+ KYS  N +E   + RP  E+           FKHRSPP +P  K
Sbjct: 417 ININSYSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPLIPG-K 475

Query: 475 HVEIVEPLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXX 534
           HVEIVEP++T ESIPLKPPA+S D   R++P +YVNGTEYEKLELLGRGG+S        
Sbjct: 476 HVEIVEPIRTKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSKVYKVKNA 535

Query: 535 XXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECG 594
                  LKRVSFDEFDDSSI+GFKGEIELLKKLET+PRVVKLIDHEMDHGVLY VMECG
Sbjct: 536 NNNKVYALKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECG 595

Query: 595 DHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKII 654
           DHDLS TLA RSGM LDVEFVR+H+QEMLKCVKVVHD+GIVHSDLKPANFVFVKGILKII
Sbjct: 596 DHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKII 655

Query: 655 DFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCG 714
           DFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT  Q  EQ+RWKVGKPSDIWSCG
Sbjct: 656 DFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCG 715

Query: 715 CIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNP 774
           CIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGD VPKTAIDTMKACLERNP
Sbjct: 716 CIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNP 775

Query: 775 EKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLAD 834
            KRW+V+EV NG FVKP++VTHFFIRDLI+NSV+YGANQ+EIS+ K+EELAEDVWHRL +
Sbjct: 776 NKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEE 835

Query: 835 FRL 837
           FRL
Sbjct: 836 FRL 838

>SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some
           similarities with uniprot|P54199 Saccharomyces
           cerevisiae YDL028C MPS1 Dual-specificity kinase required
           for spindle pole body (SPB) duplication and spindle
           checkpoint function substrates include SPB proteins
           Spc42p Spc110p and Spc98p mitotic exit network protein
           Mob1p and checkpoint protein Mad1p
          Length = 861

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/882 (51%), Positives = 575/882 (65%), Gaps = 76/882 (8%)

Query: 6   VRSSVPGAPSNRRLEFPARRTSVQSLARDDSDDENMLGPPKLSNFGSALLSDKENVEPYP 65
           V SS  G  + ++     +R+S +   +DDSDDE+ +GPPKLSNFGSALL DKEN  P  
Sbjct: 6   VASSSFGPDTGKQESHLFQRSSQRVSLKDDSDDEHPIGPPKLSNFGSALLFDKENHTPTG 65

Query: 66  --YSRNQSVSNAKR---YSQPPRAAARPETFGAVREFS---SSNTNNSVAGPYSTFHSEE 117
               R+ + ++ ++   +        RP      R  S    SNTNN+    Y +++SE+
Sbjct: 66  TGLQRDAAAADLRKSVAFQDISTGCQRPSQVPLSRNLSLNSMSNTNNTFGASYPSYNSED 125

Query: 118 HSDSTMFATSKHNQQSMTTFNPETPSEQGKPEDMYLEKSRSRVKSMQQTLRDEXXXXXXX 177
            S ST+F TS+H Q SMTT +PE             E+S  R++++Q +L++E       
Sbjct: 126 PSQSTLFTTSRH-QPSMTTVHPEPHGLDSSKS----EQSSHRLRALQHSLKEELSSRHAK 180

Query: 178 XXXXXXXXXXXXXLGPAKRASSNTGTPNHSELADESNVSQQEANFSHSSSAGATAHQNE- 236
                        LGPAKRASS  G        D++++SQQEAN S SSS       NE 
Sbjct: 181 RRNRRFVSSRLGLLGPAKRASSTAGLAYTDSGNDDASISQQEANVSGSSSTSGFVGNNEG 240

Query: 237 YNVFYESQNSSSPQKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYF 296
           YNVF ES   +  ++   +  D T ++Y +++FGDLNPYQYLKKHN+PT+ELPNIS++YF
Sbjct: 241 YNVFLESHTGAGERQHHTSSKD-TGVDYRDVDFGDLNPYQYLKKHNLPTSELPNISKIYF 299

Query: 297 ERQKGENRKTALRKNIAAKDAFQTRLTSASLSNSPLLKHVDLIKREQS------------ 344
           ERQK ENR+TALRKN+  ++    R+  AS+ N        L +RE +            
Sbjct: 300 ERQKEENRRTALRKNVVTRETLHERV--ASMPNVSF--GAALQQREHAGASTSTNTSNSA 355

Query: 345 ----IPKRQPRRKISDHATNNDXXXXXXXXXXXKGLKTAPSRDGTSPRASEMYENIERPE 400
               I  RQPRRK SD                   L T+ S        +  +  I+ P+
Sbjct: 356 SNSNITTRQPRRKASD------TPSSAFSKSLSSPLTTSNSSTYAVAATAAKHPYIDHPQ 409

Query: 401 R--DTFGSI-----RRREALSNININSNYH-QLQNKRTKYSTENLEEARGIHRPPFEHSV 452
           +  DT  +      ++REAL+NI+ NS  H   Q K  + S  +L      HR       
Sbjct: 410 QKYDTPPATDTPIHKKREALANIDTNSQRHSHAQTKMHRSSAASLRNEVHQHR------- 462

Query: 453 QEERFANHGFKHR----------SPPAVPERKHVEIVEPLKTTESIPLKPPAT------- 495
           Q++  +   F HR          S P   +R+  E+ +  +  E++PLKPPAT       
Sbjct: 463 QQQLGSQQEFLHRRAPAPPPPPPSLPTDSDRRG-ELTKAARV-ETVPLKPPATGSLKPPA 520

Query: 496 SGDSYNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSI 555
           S DS+ RRKPTI VNGTEYEK+ELLGRGGSS               LKRV+FDEFD+SS+
Sbjct: 521 SLDSHARRKPTIQVNGTEYEKMELLGRGGSSKVYKVRTPNNKVYA-LKRVAFDEFDESSV 579

Query: 556 EGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFV 615
           +GFKGEIELLKKLE +PRVV+L+D+EM HGVL+ VMECGDHDLS  LA R+ + LD+EFV
Sbjct: 580 DGFKGEIELLKKLENQPRVVRLVDYEMAHGVLFVVMECGDHDLSSILAHRASLPLDIEFV 639

Query: 616 RFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQI 675
           R+H+QEML+CVKVVHD+ IVHSDLKPANFVFVKGILKIIDFGIANAVP+HTVNIYRETQI
Sbjct: 640 RYHAQEMLRCVKVVHDADIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRETQI 699

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           GTPNYMAPEALVAMNY QGQP +QNRWKVGKPSDIWSCGCI+YQMIYGRPPYGGFQGQNR
Sbjct: 700 GTPNYMAPEALVAMNYAQGQPHQQNRWKVGKPSDIWSCGCILYQMIYGRPPYGGFQGQNR 759

Query: 736 LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVT 795
           LLAIMNPEVKIVYPEKT +GDVVP+TA+DTMKACLERNP+KR +VDEVLNG F++P++VT
Sbjct: 760 LLAIMNPEVKIVYPEKTPSGDVVPRTALDTMKACLERNPDKRCTVDEVLNGAFIRPVSVT 819

Query: 796 HFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837
           HFF+RDLIKN+VKYG+ QRE+S+EK+EELA+DVW+RLA+FRL
Sbjct: 820 HFFVRDLIKNAVKYGSEQREVSSEKVEELADDVWNRLAEFRL 861

>ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL028C
           (MPS1)
          Length = 819

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/850 (50%), Positives = 533/850 (62%), Gaps = 114/850 (13%)

Query: 35  DSDDENMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETFGAV 94
           DSDD++ LGPPKLSNFGSALL+DKEN  P  Y R    S     +       +P TF   
Sbjct: 37  DSDDDHPLGPPKLSNFGSALLTDKENETP-TYLRRSGTSLQGGNATATSGHTKPSTF--- 92

Query: 95  REFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHNQQSMTTFNPETPSEQGKPEDMYLE 154
                + T N+           E S ST+F++   +Q SMTT +    +E+  P D  L 
Sbjct: 93  -----TGTMNT-----------EDSHSTLFSSMSKHQPSMTTVD----AERTAPGDDGLS 132

Query: 155 KSRSRVKSMQQTLRDEXXXXXXXXXXXXXXXXXXXXLGPAKRASSNTGTPNHSELADES- 213
             R +V  +QQ+++DE                    LGPAKR S+ T     S ++ +  
Sbjct: 133 SHRYQV--IQQSMKDEILSRQGTRRSRRFITSRLATLGPAKRNSTTTNFEFSSNISHDEP 190

Query: 214 -NVSQQEANFSHSSSAGATA-HQNEYNVFYESQNSSS-PQKDSAAPTDHTSI-NYDNIEF 269
            +VS QE N S SS++ +   + N YNVF +++  +    K+S +    + + +Y NI F
Sbjct: 191 RDVSHQEGNVSTSSNSNSGVLNNNGYNVFLDTEERARHDDKESHSAARQSGLSDYGNISF 250

Query: 270 GDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRL----TSA 325
           GDLNPYQYLKKHN+PT+ELPNISR+YFE QK ENR+ A+RKN+      Q        SA
Sbjct: 251 GDLNPYQYLKKHNLPTSELPNISRIYFEMQKRENRRAAVRKNVLNGSGGQVAQLPTNNSA 310

Query: 326 SLSNSPLLKHVD--------------------LIKREQSIPKRQPRRKISDHATNN---- 361
             S +  LK  +                    +IKR+     RQPRRK SD + ++    
Sbjct: 311 IASTAVALKEANGIASISSGSNKLTPPQAANSMIKRD-----RQPRRKHSDASVSSFSKL 365

Query: 362 -DXXXXXXXXXXXKGLKTAPSRDGTSPRASEMYENIERPERDTFGSIRRREALSNININS 420
                           K  P +  ++P     YE +   +     + ++REAL+++++N+
Sbjct: 366 LSSPISAGAPNYADSQKHTPVQKNSTP-----YEPLLINQ-----NTKKREALNSLDVNA 415

Query: 421 NYH-QLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIV 479
           N H  +  K+ K     ++E                    H +  ++P A   +K VEIV
Sbjct: 416 NRHPSIITKKQK-----VDEL-------------------HDYLKKAPAAASVKK-VEIV 450

Query: 480 EPLK--TTESIPLKPPATSGDSY-----NRRKPTIYVNGTEYEKLELLGRGGSSXXXXXX 532
           EP++     +IPLKPP+    +       R++  I VNG+EYEK+ELLGRGGSS      
Sbjct: 451 EPVRDPVITTIPLKPPSAEVPANVHQLPQRKRQVITVNGSEYEKVELLGRGGSS-KVYKV 509

Query: 533 XXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME 592
                    LKRVSFDEFDD+S +GFKGEIELLKKLE + RVVKLIDHEM+HGVLY VME
Sbjct: 510 RNSSNRIYALKRVSFDEFDDASADGFKGEIELLKKLENQTRVVKLIDHEMNHGVLYVVME 569

Query: 593 CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILK 652
           CGDHDLS  LA RS M LD+EFVR+H+QEMLKCVKVVHD+GIVHSDLKPANFVFVKGILK
Sbjct: 570 CGDHDLSQVLAQRSSMPLDIEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILK 629

Query: 653 IIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQG-----QPAEQNRWKVGKP 707
           IIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVAMNYTQ      Q    NRWKVGKP
Sbjct: 630 IIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTQDSDQIQQEMHHNRWKVGKP 689

Query: 708 SDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMK 767
           SDIWSCGCI+YQMIYG+PPYG FQGQNRLLAIMNPEVKIVYPEKT  GD VP+TA+DT+K
Sbjct: 690 SDIWSCGCIMYQMIYGKPPYGSFQGQNRLLAIMNPEVKIVYPEKTPTGDFVPRTALDTIK 749

Query: 768 ACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAED 827
           ACLERNPE+RW+VDE+L GPF+KPI VTHFFIRDLIKN+VKYG++QR +S EK+E LA+D
Sbjct: 750 ACLERNPERRWTVDELLRGPFIKPITVTHFFIRDLIKNAVKYGSDQRYVSKEKVENLADD 809

Query: 828 VWHRLADFRL 837
           VWHRL+DFRL
Sbjct: 810 VWHRLSDFRL 819

>TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.162
           YDL028C
          Length = 795

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/830 (49%), Positives = 517/830 (62%), Gaps = 81/830 (9%)

Query: 33  RDDSDDENMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETFG 92
           +DDSDDE + GPPKLS+FG ALL +KEN+ P    R +   N+ +     R       FG
Sbjct: 22  KDDSDDEKITGPPKLSDFGVALLMEKENMAPSMVRRGEPSPNSFKRELKTR-------FG 74

Query: 93  AVRE--FSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHNQQ-SMTTFNP---ETPSEQG 146
                 FS SN   S +  Y + +S E S ST+FA S+ NQQ SMTT +    + P+   
Sbjct: 75  PTNTDYFSGSNNQTSFSQTYVSANSGEPSQSTIFAQSRFNQQPSMTTMDTNGIKIPASD- 133

Query: 147 KPEDMYLEKSRSRVKSMQQTLRDEXXXXXXXXXXXX-XXXXXXXXLGPAKRASSNTGTPN 205
                 LE S  R+KSMQQ +R+E                     LGPAKRASS  G   
Sbjct: 134 ------LETSFGRIKSMQQNMREELTTRHAQRRSRRFLHGTRIGVLGPAKRASSTNG--- 184

Query: 206 HSELADESNVSQQEANFSHSSSAGATAHQNEYNVFYESQNSSSPQKDSAAPTDHTSINYD 265
               AD S++S         +         E     +S     P            ++Y 
Sbjct: 185 ----ADMSDLSIGNVQMVQQTDNTPLEEHREV----QSPAEIKPDLTKKETRTRDVLDYK 236

Query: 266 NIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLTSA 325
           +I+FGD+NP QYLK HN+ ++ELP +S++YFERQ+ E  + AL+K+I++++A   ++  +
Sbjct: 237 SIDFGDMNPVQYLKLHNLSSSELPKLSKVYFERQREEIHQMALQKSISSREALTNKVQRS 296

Query: 326 SLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATNNDXXXXXXXXXXXKGLKTAPSRD-- 383
             S S      + I+RE S+P   PRRK+SD  T+                   P ++  
Sbjct: 297 FSSIS---SSGNSIRRESSMP-LYPRRKLSD--TSVSSAAKTSFQSSFSSPLAYPKKNFL 350

Query: 384 -----GTSPRASEMYENIER--PERDTF---GSIRRREALSNININSNYHQ--LQNKRTK 431
                 TS  A++  +N+ +   +R+ +    S ++REAL+NI+IN N  +   Q KR K
Sbjct: 351 IDQPVVTSKPAADHGKNLTKQYAQREQYTLESSFKKREALANIDINRNSQESLQQPKRFK 410

Query: 432 --YSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVEPLKTTESIP 489
              + E L E+   H P  E  V +E + N     R PP     K VEI+EP        
Sbjct: 411 PIRTQEQLSES---HLP--EPYVNKEEYLN-----REPPKPRATKRVEILEP-------- 452

Query: 490 LKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDE 549
            KP  + G S   RK  + VN  EYEK+ELLGRGGSS               LKRV FDE
Sbjct: 453 -KP--SQGQS---RKNVVKVNDVEYEKVELLGRGGSSKVYKVRDRSNNVYA-LKRVVFDE 505

Query: 550 FDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMG 609
           FDDSS+ GFKGEIELLKKLE + RVV+L+DHEM+HGVLY +MECGDHDLS  L  R+GM 
Sbjct: 506 FDDSSVSGFKGEIELLKKLENQNRVVQLVDHEMEHGVLYLIMECGDHDLSRILNHRAGMP 565

Query: 610 LDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNI 669
           LD+EFVR+H++EML+CVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVP+HTVNI
Sbjct: 566 LDMEFVRYHAREMLRCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNI 625

Query: 670 YRETQIGTPNYMAPEALVAMNYTQGQPA--EQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 727
           YRE QIGTPNYMAPEALVAMNYTQ      +QNRWKVGKPSDIWSCGCIIYQMIYGRPPY
Sbjct: 626 YRENQIGTPNYMAPEALVAMNYTQDDEKYQQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 685

Query: 728 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGP 787
           GGFQGQNRLLAIMNP+VKI++ +KTS  + +P++A+DTMKACL RNP+KR +VDEVL   
Sbjct: 686 GGFQGQNRLLAIMNPDVKIIFSDKTSRDETIPRSALDTMKACLTRNPDKRLTVDEVLESN 745

Query: 788 FVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837
           F+KP+ VT FFIRDLIKN+V+YGA+Q+E+S EK+EELA+DV  RL+DFRL
Sbjct: 746 FLKPLMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELADDVLSRLSDFRL 795

>ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 847

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/872 (46%), Positives = 528/872 (60%), Gaps = 108/872 (12%)

Query: 20  EFPARRTSVQSLARDDSDDENMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYS 79
           E   ++ S +++  DDSDDE +  PPKLSNFGSALLS+KE          ++++    + 
Sbjct: 30  EHDQKKVSTKTIFTDDSDDEKISIPPKLSNFGSALLSEKEK---------ENINENDLFE 80

Query: 80  QPPRAAARPETFGAVREFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSK-HNQQSMTTFN 138
             P+ + +P +      ++S   N++    Y++ HS + S ST+FA  + H Q SMTT N
Sbjct: 81  MLPKDSVKPSSLNNEPYYNS--VNHTPGNTYASIHSGDPSQSTLFAQYRSHQQPSMTTMN 138

Query: 139 PETPSEQGKPEDMYLEKSRSRVKSMQQTLRDEXXXXXXXXXXXXXXXXXXXX-LGPAKRA 197
                ++   +    E S  ++KSMQQ++R+E                     LGPAKRA
Sbjct: 139 STDVQDKDGND---FENSFQKIKSMQQSMREELTSRHAERRSRRFLNSSRKEFLGPAKRA 195

Query: 198 SSNTGTPNHSELADESNVSQQEANFSHSSSAGATAHQNEYNVFYESQNSSSPQKDSAAPT 257
           S+    P   +       +    N +++S+ G      E                  +P 
Sbjct: 196 SA--IFPEALDRRFSGTTNSNGTNDNNNSTDGLLQLNRE-----------------ESPE 236

Query: 258 DHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDA 317
           +  S++   ++ GDLNP QYLKKH++PT+ELP ISRLYFE+QK    + A  K    ++ 
Sbjct: 237 EKLSLS-SQVDLGDLNPVQYLKKHDLPTSELPRISRLYFEKQKPRKMELARLK----QEI 291

Query: 318 FQTRLTSASLSNSPLLKHVDLIKREQSI-PKRQPRRKISDHATNNDXXXXXXXXXXXKGL 376
            +   TS+S +N   ++H+  I+RE S+    QPRRK+SD ++ N            +G 
Sbjct: 292 LRESRTSSSGNNGSGVQHIP-IRRENSLSAATQPRRKLSDTSSRN---------IFQRGF 341

Query: 377 KTAPSRDGTSPR-ASEMYENIERPERDTFG-------SIRRREALSNININSN----YHQ 424
            +  +R   S R       +++  E D++        S R+REAL+NI++N N     ++
Sbjct: 342 SSPVARSVDSQRNILSDKSSLKHNEYDSYPHSNTLLYSHRKREALANIDVNRNNNDQIYE 401

Query: 425 LQNKRTKYSTENLEEARG--------------IHR--------------------PPFEH 450
            + KR KY  E+    R                HR                    PP   
Sbjct: 402 PELKRYKYFDEHHNNNRNNDYEPESKRYDLFEDHRNGNNNKDEKPISLERLPSEAPPVAI 461

Query: 451 SVQEERFANHGFKHRSPPAVPERKHVEIVEPLKTTESIPLKPPATSGDSYNRRKPTIYVN 510
            +       + F HR  P  P  K VEIVEP K T+S   K  +++G++  RR  T  VN
Sbjct: 462 PIHPSVIQENEFHHREAPKPPVVKKVEIVEPEKRTDS---KGKSSNGEALTRRNATT-VN 517

Query: 511 GTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLET 570
             EYEK+ELLGRGGSS               LKRV FDEFDDSS+ GFKGEIELL KL+ 
Sbjct: 518 DVEYEKIELLGRGGSSKVYKVKDNNNKLYA-LKRVVFDEFDDSSVNGFKGEIELLNKLKD 576

Query: 571 KPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVH 630
           K RVVKL D+EM+HGVLY +MECGDHDLS  L  R+GM LD+EFVR+H++EMLKCVKVVH
Sbjct: 577 KTRVVKLFDYEMEHGVLYLIMECGDHDLSQILNQRAGMPLDIEFVRYHAREMLKCVKVVH 636

Query: 631 DSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 690
           D+GIVHSDLKPANFVFVKGILKIIDFGIANAVP+HTVNIYRETQIGTPNYMAPEALVAMN
Sbjct: 637 DAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMN 696

Query: 691 YTQGQP-----AEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK 745
           YT GQ       +QNRWKVGKPSD+WSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK
Sbjct: 697 YT-GQNDGDKYKQQNRWKVGKPSDVWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK 755

Query: 746 IVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKN 805
           I++ EKT+N + VP++ +DTMKACL RNP+KR +VDEVL+ PF+KP+ VT FFIRDLIKN
Sbjct: 756 IIFSEKTANDEAVPRSILDTMKACLLRNPDKRLTVDEVLDSPFLKPVMVTPFFIRDLIKN 815

Query: 806 SVKYGANQREISNEKIEELAEDVWHRLADFRL 837
           +V+YGA+Q+E+S EK+EELA+DV  +LAD RL
Sbjct: 816 AVRYGADQKEVSKEKVEELADDVLGKLADIRL 847

>NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162
          Length = 774

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/839 (44%), Positives = 490/839 (58%), Gaps = 103/839 (12%)

Query: 24  RRTSVQSLAR----DDSDDENMLGPPKLSNFGSALLS--DKENVEPYPYSRNQSVSNAKR 77
           RR  +Q+L      DDSDDE + GPP LSNF SA LS  DK          N   ++  +
Sbjct: 14  RREPLQNLGTNIEPDDSDDEKVSGPPVLSNFASAFLSEGDKNTSNIREEETNVFNNSNMK 73

Query: 78  YSQPPRAAARPETFGAVREFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHNQQS-MTT 136
            SQ P  +  P     +                 + HS      T+FA +  N+QS +TT
Sbjct: 74  LSQTPNNSIEPNQADDL-----------------SLHS------TLFANTVGNRQSSLTT 110

Query: 137 FNPE---TPSEQGKPEDMYLEKSRSRVKSMQQTLRDEXXXXXXXXXXXXXXXXXXXXLGP 193
            N       +     E    E +  ++KS+QQT+++E                    LGP
Sbjct: 111 MNSTNNFALNHDTNKEHTVFEDNLQKIKSLQQTMKEELTSRYIERRNKRFLTSRRNNLGP 170

Query: 194 AKRASSNTGTPNHSELADESNVSQQEANFSHSSSAGATAHQ--------NEYNVFYESQN 245
           AKRAS++  + +  +   E++       +S    +   A Q        N  N  ++S N
Sbjct: 171 AKRASTSAISASTEDRYQENDKHSNNEKYSTQDDSNILAKQVGRLSSPLNRQNRAFQSSN 230

Query: 246 SSSPQKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRK 305
                 +   P D++SI     EFG+L P++YLKKH++PT+ELP ISR+YFE+QK ENR+
Sbjct: 231 GDDT--NMKEPVDYSSI-----EFGELTPFEYLKKHDLPTSELPYISRIYFEKQKLENRQ 283

Query: 306 TALRK-NIAAKDAFQTRLTS--ASLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATNND 362
           T LRK   ++K++     TS  A  SNS      + + R+ S+    PRRKISD ++   
Sbjct: 284 TVLRKRRFSSKESLSLGTTSSLAPYSNSK-NNTTNQVSRDLSL----PRRKISDTSS--- 335

Query: 363 XXXXXXXXXXXKGLKTAPSRDGTSPRASEMYENIERPERDTFGSIRRREALSNININSNY 422
                        L  + S  G  P    +    E  E+ +      R  L ++N+N+  
Sbjct: 336 -KISKQILKSNINLSESGSH-GFPPDLQSIQRQHESAEKLS------RAPLIDLNVNN-- 385

Query: 423 HQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPE----RKHVEI 478
                     S + +++ R  H+        + R     F  ++   V E    RK VEI
Sbjct: 386 ---------VSPKRMDKLRETHK------FSDSRLNVQDFSKKTDVVVYEKQAPRKKVEI 430

Query: 479 VEPLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXX 538
           VEP ++   +              ++ TI VN TEYEK+ELLGRGGSS            
Sbjct: 431 VEPKRSHSKLA-------------KRNTITVNDTEYEKIELLGRGGSS-RVYKVKNSQNK 476

Query: 539 XXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDL 598
              LKRVSFDEFDDSS++GFKGEIELL+KL  + RVVKL D++MD GVL+ +MECGDHDL
Sbjct: 477 VFALKRVSFDEFDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMDSGVLFLIMECGDHDL 536

Query: 599 SHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGI 658
           S  L+ RS M LD++FVR+H++E+++C+K+VHD+GIVHSDLKPANFVFVKGILKIIDFGI
Sbjct: 537 SQILSQRSDMPLDMDFVRYHAREVVRCIKIVHDAGIVHSDLKPANFVFVKGILKIIDFGI 596

Query: 659 ANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIY 718
           ANA+P+HTVNIYRE QIGTPNYMAPEALVAMNYT       N+WKVGKPSDIWSCGCIIY
Sbjct: 597 ANAIPDHTVNIYRENQIGTPNYMAPEALVAMNYTNENDG-GNKWKVGKPSDIWSCGCIIY 655

Query: 719 QMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRW 778
           QMIYGRPPY GFQGQNRLLAIMNP+VK+++ EKT+N + +P++ ID MK CL R+PEKRW
Sbjct: 656 QMIYGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLMKGCLTRDPEKRW 715

Query: 779 SVDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837
           SVD+VL  PF  PI VT FFI+DLIKN+V+YG +QRE+SNEKIEELA DV  RL DF++
Sbjct: 716 SVDQVLESPFFNPIVVTPFFIKDLIKNAVRYGVDQREVSNEKIEELANDVLGRLTDFKM 774

>KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 793

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/811 (45%), Positives = 489/811 (60%), Gaps = 130/811 (16%)

Query: 94  VREFSSSNTNNSVAGPYSTFHSEEHSDSTMFA-TSKHNQQSMTTFNPETP---------- 142
           VR F+  NT       +++ H+E+ S ST+F   +K  Q SMTT N              
Sbjct: 46  VRHFNGRNTT------HTSNHTEDQSQSTVFTMVNKQFQPSMTTMNTVVKEDNDISNSNS 99

Query: 143 ---------SEQGKPEDMYLEKSRSRVKSMQQTLRDEXXXXXXXXXXXXXX---XXXXXX 190
                    +E+   +D     +  + K +QQ++++E                       
Sbjct: 100 NHDNKYNKLNEESLMKDDTHSHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLSS 159

Query: 191 LGPAKR---ASSNTGTP----------NHSELADESNVSQQEANFSHSSSAGATAHQ-NE 236
           LGPAKR    S N  +P          N S + D SN+SQQ+   SH+S++  T ++ ++
Sbjct: 160 LGPAKRNLSTSFNVDSPSESRVDNSQINSSIINDTSNISQQDIENSHTSNSSNTGYRYHD 219

Query: 237 YNVFYES--QNSSSPQKDSAAPTDHT--SINYDNIEFGDLNPYQYLKKHNIPTTELPNIS 292
           +N+F E+  Q+S+    ++  P+ +   +INY+NI+FGDLNPYQYLKK+N+P+ ELP IS
Sbjct: 220 HNIFLETHRQHSTPSHDENKDPSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYIS 279

Query: 293 RLYFERQKGENRKTALRKNIAAKDAFQTRLTSASLSNSPLLKHVDLIKREQSIPKRQPRR 352
           ++YFERQK ENRKT LRK  +   A +   T                +R Q+   RQPRR
Sbjct: 280 KVYFERQKEENRKTVLRKATSGTLALKREFTQ--------------YRRTQT--ARQPRR 323

Query: 353 KISDHATNNDXXXXXXXXXXXKGLKTAPSRDGTSP--RASEMYENIERPERDTFGSIRRR 410
           K   H    D              KT+     +SP  +   +++ ++R   +      +R
Sbjct: 324 K---HNFGTD--------------KTSLQDPLSSPLQKNQLVFQEVDRELAN------KR 360

Query: 411 EALSNININSNYHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAV 470
           EAL  +++N+     + KR KY  +++ E    +RPPF             F HR  P+ 
Sbjct: 361 EALKPLDVNNPSSSQEAKRPKYENDHVPED---YRPPF-------------FSHRKAPSP 404

Query: 471 PERK---HVEIVEPLKTT-ESIPLKPPATS-------GDSY-------NRRK------PT 506
            + K    VEIVEP K+T E IPLK            GD+Y       + +K      PT
Sbjct: 405 HDSKPFKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPT 464

Query: 507 IYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLK 566
           I VNGT YEK+ELLG+GGS                LKRVSFDEFD+SSI+GFKGEIELLK
Sbjct: 465 ITVNGTAYEKVELLGKGGSGKVYKVKSSDHKVYA-LKRVSFDEFDESSIDGFKGEIELLK 523

Query: 567 KLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCV 626
           KLE K RVVKLID+ M  GVL+ +MECG+HDLS  L  RS +  D EFVR+H QEM+KCV
Sbjct: 524 KLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCV 583

Query: 627 KVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 686
           KVVHD+ IVHSDLKPANFVFVKG+LKIIDFGIANAVP+HTVNIYR+ QIGTPNYMAPE L
Sbjct: 584 KVVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETL 643

Query: 687 VAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 746
           VAMN+T+    EQ +WKVGKPSD+WSCGCI+YQM+YG+PPYG FQG NRL AIMNP+VKI
Sbjct: 644 VAMNFTRND-GEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKI 702

Query: 747 VYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNS 806
            YPEK S G V+P+T IDT+++CLERNP  R ++D++L+G  + P+ VT FFI DLIKN+
Sbjct: 703 PYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNA 762

Query: 807 VKYGANQREISNEKIEELAEDVWHRLADFRL 837
           V YG +Q+ ++NE++EEL+EDVW++LA+F+L
Sbjct: 763 VNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793

>Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar to
           Ashbya gossypii ADR317C
          Length = 864

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/515 (61%), Positives = 383/515 (74%), Gaps = 57/515 (11%)

Query: 344 SIPKR--QPRRKISDHATNNDXXXXXXXXXXXKGLKTAPSRDGTSPRASEMYENIERPER 401
           S+PKR  QPRRK SD + ++              + ++P   G +    E  + I+ P +
Sbjct: 386 SVPKRDRQPRRKTSDASVSS-----------FSKILSSPIT-GAANNYVESQKQIQPPMQ 433

Query: 402 DTFGSI---------RRREALSNININSNYHQLQNKRTKYSTENLEEARGIHRPPFEHSV 452
            +  S+         ++REAL+ +++NS   Q                  +H+   +H  
Sbjct: 434 RSPVSLGPLQLNPNTKKREALNKLDVNSTNQQAI----------------VHK---KHKS 474

Query: 453 QEERFANHGFKHRSPPAVPERKHVEIVEPLKTT--ESIPLKPPATSGDSYN---RRKPTI 507
            E+ F  H  K  +PPAV   K VEI+EP+K T   +IPLKPP+T   SY    R++  I
Sbjct: 475 DEQNFY-HIRKAPNPPAV---KKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQII 530

Query: 508 YVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKK 567
            VNG+EYEK+ELLGRGGSS               LKRVSFDEFDD+SI+GFKGEIELLK+
Sbjct: 531 QVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYA-LKRVSFDEFDDTSIDGFKGEIELLKR 589

Query: 568 LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
           LE + RVVKLIDHEM+HGVLY VMECGDHDLS  LA R+ M  D+EFVR+H+QEMLKCV+
Sbjct: 590 LEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQ 649

Query: 628 VVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 687
           VVHD+GIVHSDLKPANFVFVKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALV
Sbjct: 650 VVHDTGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALV 709

Query: 688 AMNYT--QGQP---AEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 742
           AMNYT  QGQ     +QNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP
Sbjct: 710 AMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 769

Query: 743 EVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDL 802
           EVKIVYPEKT++GD+VP+TA+DT+KACLERNPE+RW+VD++L GPF+KP++VTHFFIRDL
Sbjct: 770 EVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDL 829

Query: 803 IKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837
           IKN+VKYG++QR +S EK+E+LA+DVW+RL+DFRL
Sbjct: 830 IKNAVKYGSDQRYVSKEKVEDLADDVWNRLSDFRL 864

 Score =  170 bits (430), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 158/297 (53%), Gaps = 33/297 (11%)

Query: 35  DSDDENMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETFGAV 94
           DSDDEN L PPKLSNFGSAL +DKEN  P    ++  V+    Y      A +P T    
Sbjct: 38  DSDDENPLSPPKLSNFGSALFTDKENETPTYLRKSGVVAQPAPYPNINMNANKPPTLTG- 96

Query: 95  REFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHNQQSMTTFNPE--TPSEQGKPEDMY 152
                            T H ++ S ST+F +   +Q SMTT N E  TP E+G      
Sbjct: 97  -----------------TLHMDDGSHSTLFTSVSKHQPSMTTVNQEQRTPGEEGL----- 134

Query: 153 LEKSRSRVKSMQQTLRDEXXXXXXXXXXXXXXXXXXXXLGPAKRASSNTGTPNHSELA-- 210
                 R + +QQ+++DE                    LGPAKR ++ T   + S     
Sbjct: 135 ---GSYRFQMIQQSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTLTANLDFSSNMSH 191

Query: 211 -DESNVSQQEANFSHSSSAGATAHQNE-YNVFYESQNSSSPQ-KDSAAPTDHTSINYDNI 267
            D  ++S Q+ N S SS+  +   QN+ YNVF +++ +  P  K++      +SI+YDNI
Sbjct: 192 EDSRDLSHQDGNISSSSNNHSGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSIDYDNI 251

Query: 268 EFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLTS 324
            FGDLNPYQYLKKHN+PT+ELPNISR+YFE QK ENR+ A+RKNI   ++  +  T+
Sbjct: 252 SFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRKNIFTNNSINSSSTA 308

>Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON}
           (24479..26854) [2376 nt, 792 aa]
          Length = 791

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/598 (54%), Positives = 401/598 (67%), Gaps = 47/598 (7%)

Query: 253 SAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNI 312
           S   T  T+INYD I+FG+LNP QY+KK+N+PTTELP IS+LYFERQ+ E+RK AL+K+ 
Sbjct: 228 SINQTSQTTINYDLIDFGELNPVQYIKKNNLPTTELPTISKLYFERQRAESRKIALKKHS 287

Query: 313 AAKDAFQTRLTSASLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATNNDXXXXXXXXXX 372
           ++K+      +S++L NS              I   Q   K   + T +           
Sbjct: 288 SSKEL-LFSSSSSALKNSF-----------NQISDAQNESKCISNNTGDTDALSEPKISD 335

Query: 373 XKGLKTAPSRDGTSPRASEMYENIE---RPERDTFGSIRRREALSNININSN----YHQL 425
            +  ++  SR+G +    +   N+E    P   +    ++REALS+IN+N+N    Y +L
Sbjct: 336 KENSRSTWSRNGYAILKDDYINNLEYYKNPSGYSSSLNKKREALSSINVNTNHNHSYQEL 395

Query: 426 -QNKRTKYSTENLE---EARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVEP 481
             NKR K ST+ +E   E         E    E+  + +  KH        +K VEI+EP
Sbjct: 396 GDNKRNKISTKGIESEIEHVAARNSMLEQQKVEQLNSANIHKH-------GKKKVEIIEP 448

Query: 482 LKTTESIPLKPPATSGDSYNR--RKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXX 539
                            S NR   K  + VNG EYEK+ELLGRGGSS             
Sbjct: 449 --------------KSASANRIASKSVVSVNGVEYEKIELLGRGGSSKVYKVKNVHNNKI 494

Query: 540 XXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLS 599
             LKRV FDEFD+SSI+ FKGEIELLKKLE + RVV LI H+M+ GVL  +MECGDHDLS
Sbjct: 495 FALKRVMFDEFDESSIDSFKGEIELLKKLENEKRVVTLIQHQMESGVLLLIMECGDHDLS 554

Query: 600 HTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIA 659
             L  R  M LD+EF+RFH++EMLKCVKVVHD+GIVHSDLKPANFVFVKGILKIIDFGIA
Sbjct: 555 QILNQRMNMPLDIEFIRFHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIA 614

Query: 660 NAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQ 719
           NAVP+HTVNIYRETQIGTPNYMAPEALVAMN +Q    +QN+WKVGKPSDIWSCGCI+YQ
Sbjct: 615 NAVPDHTVNIYRETQIGTPNYMAPEALVAMN-SQQDSDQQNKWKVGKPSDIWSCGCILYQ 673

Query: 720 MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWS 779
           M YGRPPYG FQGQNRLLAIMNP VKIV+ EKTSN + +P++A++TMKACL RNP+KRW+
Sbjct: 674 MFYGRPPYGSFQGQNRLLAIMNPNVKIVFSEKTSNNERIPRSALETMKACLIRNPDKRWA 733

Query: 780 VDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837
           VD+VL G F  P+ VT F IRDLIKN+V YGA+QR +++EKI ELA+DV +RLADFRL
Sbjct: 734 VDQVLEGSFFNPVMVTSFIIRDLIKNAVNYGADQRYVTDEKITELADDVLNRLADFRL 791

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (86%), Gaps = 1/30 (3%)

Query: 33 RDDSDDENMLGPPKLSNFGSALL-SDKENV 61
          +DDSDDE + G PKLSNFGSALL S+KEN+
Sbjct: 43 QDDSDDEQITGFPKLSNFGSALLTSEKENI 72

>Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/820 (44%), Positives = 485/820 (59%), Gaps = 86/820 (10%)

Query: 32  ARDDSDDENMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETF 91
           AR  SDDE    PPKLSNFGSALLS  E       S +Q +SN       P        F
Sbjct: 18  ARQFSDDEEFTTPPKLSNFGSALLSHTEKT-----SVSQELSNKNDKIANP-------VF 65

Query: 92  GAVREFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHN--QQSMTTFNP-ETPSEQGKP 148
                 SS +   S  G  ++ H+   S ST+F     N  Q SMTT N  +     G  
Sbjct: 66  EETNRSSSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLKNNHQTSMTTMNTNDIEINVGNS 125

Query: 149 EDMYLEKSRSRVKSMQQTLR-DEXXXXXXXXXXXXXXXXXXXXLGPAKRASSNTGTPNHS 207
               L+KS  +++S++Q ++ D                     LGPAKRAS+ T   +  
Sbjct: 126 ----LDKSFEKIRSLRQNMKEDITSKYTERRSKRFLISNRTTKLGPAKRASTLTNVFDD- 180

Query: 208 ELADESNVSQQEANFSHSSSAGATAHQNEYNVFYESQNSSSPQKDSAAPTDHTSINYDNI 267
              D  N S Q  +    ++       +E   F E++ +S               +Y++I
Sbjct: 181 ---DVPNSSNQLISNLRETTESPLDDPSETE-FKETKKNS---------------DYESI 221

Query: 268 EFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLTSASL 327
            FGDLNP QY+KKHN+PT++LP IS++YF++Q+ ENR+ ALRK+ + +   + R +S  L
Sbjct: 222 NFGDLNPIQYIKKHNLPTSDLPMISQIYFDKQREENRQAALRKHSSRELLSKNRSSSTPL 281

Query: 328 SNSPLLKHVDLIKREQSIPKR---QPRRKISDHATNNDXXXXXXXXXXXKGLKTAPSRDG 384
           SNS       L+ ++ SI      QPRRKIS  ++              K LK     D 
Sbjct: 282 SNS-----YSLVNKDHSITSNSNSQPRRKISTGSS-----SSKSSIEIRKVLKENIDTDN 331

Query: 385 TSPRASEMYENIERPERDTFGSIRRREALSNININSNYH----QLQNKRTKYSTENLEEA 440
            S   S + +      R+      +REAL NI+IN+++     Q  NKR K S   L++A
Sbjct: 332 YSNLKSPINKIYRESSRNKDSDSEKREALRNISINTSHADSGLQQDNKRLKRS---LDDA 388

Query: 441 RGIHRPPFEHSVQEERFANHG-FKHRSPPAVPERKHVEIVEPLKTTESIPLKPPATSGDS 499
             IH          E   N   F HR  P  P  K VEIVEP+K+              S
Sbjct: 389 -IIH--------DNENMKNQDVFYHRPAPKPPVTKKVEIVEPIKSA-------------S 426

Query: 500 YNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFK 559
            +  +  I VN ++YEK+ELLGRGGSS               LKRVSFD FDDSS++GFK
Sbjct: 427 LSNSRNIITVNDSQYEKIELLGRGGSSRVYKVKGAGNKVYA-LKRVSFDAFDDSSVDGFK 485

Query: 560 GEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHS 619
           GEIELL+KL+ + RV++L+D+EM  G+LY +MECGDHDLS  L  RS M LD  F+RF++
Sbjct: 486 GEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMSLDFNFIRFYA 545

Query: 620 QEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPN 679
           +EML+C+KVVHD+GIVHSDLKPANFV VKGILKIIDFGIANAVPEHTVNIYRETQIGTPN
Sbjct: 546 KEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPN 605

Query: 680 YMAPEALVAMNYTQGQPAEQ--NRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 737
           YMAPEALVAMNYTQ     Q  N+WKVG+PSD+WSCGCI+YQMIYG+PPYG FQGQNRLL
Sbjct: 606 YMAPEALVAMNYTQTNENRQEGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLL 665

Query: 738 AIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHF 797
           AIMNP+VKI +P+ TSN + +PK+AI+ MKACL RNP+KRW+VD+VL+  F++P  ++  
Sbjct: 666 AIMNPDVKIPFPDHTSNNERIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGS 725

Query: 798 FIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837
            + DLI+N+V+YG+ + +IS++ + ++ E V  + AD+++
Sbjct: 726 IMEDLIRNAVRYGSEKPQISHDDLNDVVETVLRKFADYKI 765

>TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.162
           YDL028C
          Length = 774

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/841 (42%), Positives = 475/841 (56%), Gaps = 109/841 (12%)

Query: 24  RRTSVQSLARDDSDDENMLGPPKLSNFGSALLSDK-ENVEPYPYSRNQSVSNAKRYSQPP 82
           R  ++Q+   D   DE +   PKLSNFGSAL+S+K EN+     + N S+S +  Y+Q  
Sbjct: 16  RNDTIQTYNNDSDSDEKLTVLPKLSNFGSALISEKNENITRNSLT-NSSISMSSNYNQIN 74

Query: 83  RAAARPETFGAVREFSSSNTNNS-VAGP------------YSTFHSEEHSDSTMFATSKH 129
                 E  G +    +SN NN  +A P             +  H+E      +F   + 
Sbjct: 75  TLTKNNE-IGTI----NSNFNNGQIASPKFKGIKNLIDQEMTVKHNERRKGRRIFRKIEL 129

Query: 130 NQQSMT-------TFNPETPSEQGKPEDMYLEKSRSRVKSMQQTLRDEXXXXXXXXXXXX 182
           N            T  P   +E     D Y E      +SM     D             
Sbjct: 130 NSLGKAKRTNLDYTIAPSHMTEVNY--DQYQENDHKTFESMNDMENDIPKYKTTTDSI-- 185

Query: 183 XXXXXXXXLGPAKRASSNTGTPNHSELADESNVSQQEANFSHSSSAGATAHQNEYNVFYE 242
                          S+N  T N +    +++V+   ++F      G+T + +  N F +
Sbjct: 186 --------------LSNNKSTDNLAGKNSKNHVTTPSSSF------GSTLYSSTTNPFTD 225

Query: 243 SQNSSSPQKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGE 302
           S  ++    +++ P  +T I+Y+ IE GDLNP+Q LKK+N+P+TEL  IS+LYFE+QK E
Sbjct: 226 S--NTYNHSNTSLP--NTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEE 281

Query: 303 NRKTALRKNIAAKDAFQTRLTSASLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATNND 362
           NRK  ++K   +K+ F T ++S S                      +  R+ S H T N+
Sbjct: 282 NRKNIMKKRSVSKEGFMTSISSNS-------------------VSSKISRQSSFHTTTNN 322

Query: 363 XXXXXXXXXXXKGLKTAPSRDGTSPRASEMYE---NIERPERDTFGSIRRREALSNININ 419
                      K    A   + TS R+ E      N   P+R    SI       +IN N
Sbjct: 323 ----RHSSMVSKQDTNAILMNTTSTRSDEKVMKPLNEYEPDRKVLASI-------DINKN 371

Query: 420 SNYHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHR-SPPAVPERKHV-- 476
            N + ++ KR                 P EH    E+   H  + R S  +  E+ H   
Sbjct: 372 INVNAIEKKR-----------------PVEHQYSYEKSKIHISESRESQSSTVEKPHTFQ 414

Query: 477 EIVEPLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXX 536
           +  E  K  + + +  P TS  +    K  + VN  EYE++ELLGRGGSS          
Sbjct: 415 DNKEGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNN 474

Query: 537 XXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDH 596
                LKRV FDEFDD+S++ FKGEIELLKKLE + RVVKLI ++MD+GVLY VMECGDH
Sbjct: 475 NRVYALKRVVFDEFDDTSVDAFKGEIELLKKLENEKRVVKLIQYQMDNGVLYLVMECGDH 534

Query: 597 DLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDF 656
           DLS  L  R+ M LDV+F+R++S+EMLKCVKVVHD+GIVHSDLKPANFV VKGILKIIDF
Sbjct: 535 DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDF 594

Query: 657 GIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCI 716
           GIANAVP+HTVNIYR+TQIGTPNYMAPEALVA+N       ++NRW+VGKPSDIWSCGCI
Sbjct: 595 GIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEV-SNVEKKNRWRVGKPSDIWSCGCI 653

Query: 717 IYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEK 776
           +YQM YGRPPYG FQ QNRLLAIMNPEVKIV+ EKTS  + VPK+A+DTMKACL R+PEK
Sbjct: 654 MYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEK 713

Query: 777 RWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFR 836
           RW+ DE+L+  F+ P+ VT + +RDLI+N+V YG++Q ++S +KI ELA+DV +RLADFR
Sbjct: 714 RWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFR 773

Query: 837 L 837
           L
Sbjct: 774 L 774

>Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON}
           YDL028C (REAL)
          Length = 769

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/818 (44%), Positives = 488/818 (59%), Gaps = 78/818 (9%)

Query: 32  ARDDSDDENMLGPPKLSNFGSALLSDKENV---EPYPYSRNQSVSNAKRYSQPPRAAARP 88
            R  SDDE    PPKLSNFGSALLS  E     E    ++N  ++N              
Sbjct: 18  TRQLSDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDKIANP------------- 64

Query: 89  ETFGAVREFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHN--QQSMTTFNPETPSEQG 146
             F  +   SS +   S  G  ++ H+   S ST+F     N  Q SMTT N    S+  
Sbjct: 65  -VFEEMNRSSSRSHPPSSMGNLTSGHTSTSSQSTLFGRYLRNSHQTSMTTMNT---SDIE 120

Query: 147 KPEDMYLEKSRSRVKSMQQTLR-DEXXXXXXXXXXXXXXXXXXXXLGPAKRASSNTGTPN 205
                 L+KS  R+K+++Q ++ D                     LGPAKRA++     +
Sbjct: 121 MSVGNSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD 180

Query: 206 HSELADESNVSQQEANFSHSSSAGATAHQNEYNVFYESQNSSSPQKDSAAPTDHTSINYD 265
             ++AD SN   Q  + S  ++    A        Y++    + +KD         + Y+
Sbjct: 181 -DDVADSSN---QLISISRETTESPLADS------YQAGFRGTRKKD---------MKYE 221

Query: 266 NIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLTSA 325
           +I+F DLNP QY+KKHN+ T++LP IS++YF+RQ+ EN++ ALRK+ + +   + R +S 
Sbjct: 222 SIDFEDLNPIQYIKKHNLSTSDLPIISQIYFDRQREENKQAALRKHSSRELLSRNRSSST 281

Query: 326 SLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATNNDXXXXXXXXXXXKGLKTAPSRDGT 385
           SLS+   L + D      S    QPRRK+S  + +             K    A + +  
Sbjct: 282 SLSSGNSLANKDASITFNS--SSQPRRKVSTGSFS--SKSSVEIRKTFKENVNASNINSP 337

Query: 386 SPRASEMYENIERPERDTFGSIRRREALSNININSNYH----QLQNKRTKYSTENLEEAR 441
           +    ++Y+ I R  +D      +RE L NI+IN+N+     Q +NKR K S ++     
Sbjct: 338 NGPVHKIYKEISR-NKDP--DCEKREVLRNISINANHADNILQQENKRLKRSLDD----- 389

Query: 442 GIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVEPLKTTESIPLKPPATSGDSYN 501
            I     + +V+ +      F HR  P  P  K VEIVEP +T         ATS  + N
Sbjct: 390 AIINENEDVNVKNQEV----FYHRPAPKPPVTKKVEIVEPART---------ATSSSNRN 436

Query: 502 RRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGE 561
                I VN ++YEK+ELLGRGGSS               LKRVSFD FDDSSI+GFKGE
Sbjct: 437 ----MITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYA-LKRVSFDAFDDSSIDGFKGE 491

Query: 562 IELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQE 621
           IELL+KL+ + RV++L+D+EM  G+LY +MECGDHDLS  L  R  M LD  FVRF+++E
Sbjct: 492 IELLEKLKDEKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKE 551

Query: 622 MLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 681
           ML+C+KVVHD+GIVHSDLKPANFV VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM
Sbjct: 552 MLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 611

Query: 682 APEALVAMNYTQGQPA--EQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 739
           APEALVAMNYTQ      + N+WKVG+PSD+WSCGCI+YQMIYG+PPYG FQGQNRLLAI
Sbjct: 612 APEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI 671

Query: 740 MNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFI 799
           MNP+VKI +PE TSN + +PK+AI+ MKACL RNP+KRW+VD+VLN  F++P  ++   +
Sbjct: 672 MNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIM 731

Query: 800 RDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837
            DLI+N+V+YG+ + +IS++ + ++ E V  + AD+++
Sbjct: 732 EDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769

>YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}
           MPS1Dual-specificity kinase required for spindle pole
           body (SPB) duplication and spindle checkpoint function;
           substrates include SPB proteins Spc42p, Spc110p, and
           Spc98p, mitotic exit network protein Mob1p, and
           checkpoint protein Mad1p
          Length = 764

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/820 (44%), Positives = 486/820 (59%), Gaps = 87/820 (10%)

Query: 32  ARDDSDDENMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETF 91
            R  SDDE    PPKLSNFGSALLS  E           S S         + A R E  
Sbjct: 18  TRQFSDDEEFTTPPKLSNFGSALLSHTEKT---------SASEILSSHNNDKIANRLEEM 68

Query: 92  GAVREFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHN--QQSMTTFNP-ETPSEQGKP 148
                 SS +      G  ++ H+   S ST+F     N  Q SMTT N  +     G  
Sbjct: 69  DRS---SSRSHPPPSMGNLTSGHTSTSSHSTLFGRYLRNNHQTSMTTMNTSDIEINVGNS 125

Query: 149 EDMYLEKSRSRVKSMQQTLR-DEXXXXXXXXXXXXXXXXXXXXLGPAKRASSNTGTPNHS 207
               L+KS  R+++++Q ++ D                     LGPAKRA + T   +  
Sbjct: 126 ----LDKSFERIRNLRQNMKEDITAKYAERRSKRFLISNRTTKLGPAKRAMTLTNIFDE- 180

Query: 208 ELADESNVSQQEANFSHSSSAGA-TAHQNEYNVFYESQNSSSPQKDSAAPTDHTSINYDN 266
              D  N   Q  N   +       +HQ  +             K++   TD     YD+
Sbjct: 181 ---DVPNSPNQPINARETVELPLEDSHQTNF-------------KETKRNTD-----YDS 219

Query: 267 IEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLTSAS 326
           I+FGDLNP QY+KKHN+PT++LP IS++YF++Q+ ENR+ ALRK+ + +  +++R +S+S
Sbjct: 220 IDFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKHSSRELLYKSRSSSSS 279

Query: 327 LSNSPLLKHVDLIKREQSIPKR---QPRRKISDHATNNDXXXXXXXXXXXKGLKTAPSRD 383
           LS++ LL       ++ SI      QPRRK+S  ++++            + + T+ + +
Sbjct: 280 LSSNNLLA-----NKDNSITSNNGSQPRRKVSTGSSSS-KSSIEIRRALKENIDTSNNSN 333

Query: 384 GTSPRASEMYENIERPERDTFGSIRRREALSNININSNYH----QLQNKRTKYSTENLEE 439
             SP   ++Y+ I R  +D+     +RE L NI+IN+N+     Q +NKR K S ++   
Sbjct: 334 FNSP-IHKIYKGISR-NKDS--DSEKREVLRNISINANHADNLLQQENKRLKRSLDDAIT 389

Query: 440 ARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVEPLKTTESIPLKPPATSGDS 499
              I+    E            F HR  P  P  K VEIVEP K+              S
Sbjct: 390 NENINSKNLE-----------VFYHRPAPKPPVTKKVEIVEPAKSA-------------S 425

Query: 500 YNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFK 559
            +  +  I VN ++YEK+ELLGRGGSS               LKRVSFD FDDSSI+GFK
Sbjct: 426 LSNNRNIITVNDSQYEKIELLGRGGSSRVYKVKGSGNRVYA-LKRVSFDAFDDSSIDGFK 484

Query: 560 GEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHS 619
           GEIELL+KL+ + RV++L+D+EM  G+LY +MECGDHDLS  L  RSGM LD  FVRF++
Sbjct: 485 GEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSGMPLDFNFVRFYT 544

Query: 620 QEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPN 679
           +EML C+KVVHD+GIVHSDLKPANFV VKGILKIIDFGIANAVPEHTVNIYRETQIGTPN
Sbjct: 545 KEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPN 604

Query: 680 YMAPEALVAMNYTQG--QPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 737
           YMAPEALVAMNYTQ      E N+WKVG+PSD+WSCGCIIYQMIYG+PPYG FQGQNRLL
Sbjct: 605 YMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLL 664

Query: 738 AIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHF 797
           AIMNP+VKI +PE TSN + +PK+AI+ MKACL RNP+KRW+VD+VL+  F++P  ++  
Sbjct: 665 AIMNPDVKIPFPEHTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGS 724

Query: 798 FIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837
            + DLI+N+V+YG+ +  IS + + ++ + V  + AD+++
Sbjct: 725 IMEDLIRNAVRYGSEKPHISQDDLNDVVDTVLRKFADYKI 764

>Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/820 (44%), Positives = 478/820 (58%), Gaps = 88/820 (10%)

Query: 33  RDDSDDENMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETFG 92
           R  SDDE    PPKLSNFGSALLS  E             S  +  S             
Sbjct: 19  RQFSDDEEFTTPPKLSNFGSALLSHSE-----------KTSAPETLSSHKTNKMTNHVLE 67

Query: 93  AVREFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHN--QQSMTTFNP-ETPSEQGKPE 149
            +   SS +   S  G  ++ H+   S ST+F     N  Q SMTT N  +     G   
Sbjct: 68  EMDRSSSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLRNNHQTSMTTMNTNDIEINVGNS- 126

Query: 150 DMYLEKSRSRVKSMQQTLR-DEXXXXXXXXXXXXXXXXXXXXLGPAKRASSNTGTPNHSE 208
              L+KS  R+++++Q ++ D                     LGPAKRA++ T   +  E
Sbjct: 127 ---LDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFDE-E 182

Query: 209 LADESNV-----SQQEANFSHSSSAGATAHQNEYNVFYESQNSSSPQKDSAAPTDHTSIN 263
           + + SN+        E     S+ +G          F ES+                +++
Sbjct: 183 VPNSSNLPINPRETIETLLEDSNKSG----------FRESK---------------KNMD 217

Query: 264 YDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLT 323
           Y++IEFGDLNP QY+KKHN+PT++LP IS++YF++Q+ ENR+ ALRK+ + +  ++ R +
Sbjct: 218 YESIEFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKHSSRELLYKNRSS 277

Query: 324 SASLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATNNDXXXXXXXXXXXKGLKTAPSRD 383
           S SLS++ LL   D       I    PRRKIS  ++              + LK      
Sbjct: 278 STSLSSNNLLPSKD--NSITFINSSLPRRKISTGSS-----SSKSSIEIRRALKENIDTS 330

Query: 384 GTSPRASEMYENIERPERDTFGSIRRREALSNININSNYH----QLQNKRTKYSTENLEE 439
             S   S ++   +   R+      +R  L NI+IN+N+     Q  NKR K S +++  
Sbjct: 331 NNSSFNSPIHNIHKEISRNKDSDSEKRGVLRNISINANHADNILQQDNKRLKRSLDDV-- 388

Query: 440 ARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVEPLKTTESIPLKPPATSGDS 499
              I        +QE       F HR  P  P  K VEIVEP K+  S           S
Sbjct: 389 ---ITNENENKKIQE------VFYHRPAPKPPVTKKVEIVEPAKSASS-----------S 428

Query: 500 YNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFK 559
            NR    I VN ++YEK+ELLGRGGSS               LKRVSFD FDDSS++GFK
Sbjct: 429 NNR--SMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYA-LKRVSFDAFDDSSVDGFK 485

Query: 560 GEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHS 619
           GEIELL+KL+ + RV++L+D+EM  G+LY +MECGDHDLS  L  RS M LD  FVRF++
Sbjct: 486 GEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYT 545

Query: 620 QEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPN 679
           +EML C+KVVHD+GIVHSDLKPANFV VKGILKIIDFGIANAVPEHTVNIYRETQIGTPN
Sbjct: 546 KEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPN 605

Query: 680 YMAPEALVAMNYTQGQPA--EQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 737
           YMAPEALVAMNYTQ      E N+WKVG+PSD+WSCGCIIYQMIYG+PPYG FQGQNRLL
Sbjct: 606 YMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLL 665

Query: 738 AIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHF 797
           AIMNP+VKI +PE TSN + +PK+AI+ MKACL RNP+KRW+VD+VL+  F++P  ++  
Sbjct: 666 AIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGS 725

Query: 798 FIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837
            + DLIKN+V+YG+ + +IS++ + ++ E V  + +D+++
Sbjct: 726 IMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765

>KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.162
           YDL028C
          Length = 747

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/815 (41%), Positives = 465/815 (57%), Gaps = 113/815 (13%)

Query: 39  ENMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETFGAVREFS 98
           EN++GPPKLSNFGSALL++ +N         Q  S        P + +R  ++G+     
Sbjct: 30  ENIIGPPKLSNFGSALLTENDNSGTTSRFHTQFRSLNGNSVHSPISLSRNNSYGS----- 84

Query: 99  SSNTNNSVAGPYSTFHSEEHSDSTMFATSKHNQ-QSMTTF-NPETPSEQGKPEDMYLEKS 156
                      Y    +E+   +++FAT+ +N+  SMTT  N    S      +   E S
Sbjct: 85  -----------YGI--AEQSPQTSIFATTINNRPISMTTIQNGSADSNVTNNVNDKYESS 131

Query: 157 RSRVKSMQQTLRDEXXXXXXXXXXXXXXXXXXXXLGPAKRASSNTGTPNHSELADESNVS 216
            +++  +QQ+++DE                    LGPAKRAS+        ++   +N  
Sbjct: 132 YNKINKIQQSIKDELTSRHTGRIKRFLNTNRMNKLGPAKRASTM-----EVDIPLPAN-- 184

Query: 217 QQEANFSHSSSAGATAHQ--NEYNVFYESQNSSSPQKDSAAPTDHTSINYDNIEFGDLNP 274
               N S++SS+   + Q   E N   E QN                 +Y NI FGDLNP
Sbjct: 185 ---TNDSYNSSSDVFSGQAIEEANDIKEVQN----------------YDYSNINFGDLNP 225

Query: 275 YQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLTSASLSNSPLLK 334
           +Q+L+K+N+PTTELPNIS++YFERQK ENR + L+K         T   + + +N   +K
Sbjct: 226 FQFLRKYNLPTTELPNISKIYFERQKEENRLSILKK--------HTNNNTGAKTNGNDIK 277

Query: 335 HVDLIKREQSIPKRQPRRKISDHATNNDXXXXXXXXXXXKGLKTAPSRDGTSPRASEMYE 394
              + K   S  K   +  ++                    L +  +    SP++ +  E
Sbjct: 278 DFSISKNLTSEDKTDLKNTVNTGLV--------SRTLLNSTLSSRKTNSSLSPKSKDNNE 329

Query: 395 ----NIERPE-----RDTFGSIRRREALSNININSNYHQLQNKRTKYSTENLEEARGIHR 445
               ++E P+      D     +RRE L  +++++N  + + KR K   EN +    I+ 
Sbjct: 330 FNSLDVEEPKHLTSNNDEIRPNKRREPL--VDLSTNRKEPELKRFKTFEENKKRDEIINE 387

Query: 446 PPFEHSVQEERFANHGFKHRSPPAVPE-RKHVEIVEPLKTTESIPLKPPATSGDSYNRRK 504
              E+ VQ+               VP+  K VEI+EP  +                +R++
Sbjct: 388 K--ENVVQD---------------VPKSMKRVEIMEPKMS----------------HRQR 414

Query: 505 PTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIEL 564
             I VN TEYEK+ELLGRGGSS               LKRV FDEFDDSSI GFKGEI+L
Sbjct: 415 NVINVNETEYEKIELLGRGGSSKVYKVKGPSNKVFA-LKRVVFDEFDDSSINGFKGEIKL 473

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGL--DVEFVRFHSQEM 622
           L KL  + RVVKL D+EM+ G+LY +MECGD DLS  L  +  + L  D+EF+R++++EM
Sbjct: 474 LNKLRNENRVVKLFDYEMNQGLLYLIMECGDVDLSQILNQKINLNLPFDIEFIRYYTREM 533

Query: 623 LKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 682
           +KCVKVVHD+GIVHSDLKPANFV VKG+LKIIDFGIA+AVP+HTVNIYRETQ GTPNYMA
Sbjct: 534 IKCVKVVHDNGIVHSDLKPANFVLVKGVLKIIDFGIADAVPDHTVNIYRETQTGTPNYMA 593

Query: 683 PEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 742
           PE L+AMNYT    A+  +WKVGKPSD+WSCGCIIYQMIYG+ PY GFQGQ+R+ AIMN 
Sbjct: 594 PETLIAMNYTNN-GAKDLKWKVGKPSDVWSCGCIIYQMIYGKAPYAGFQGQHRIFAIMNS 652

Query: 743 EVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDL 802
           +VKIVYPEKT+  +++PKT ++ MK CL R+P KRW+VD++L+  F+ PI  +  FIRDL
Sbjct: 653 DVKIVYPEKTNEEELIPKTMVELMKNCLRRDPGKRWTVDDILSSTFLNPIVTSQSFIRDL 712

Query: 803 IKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837
           IKN++ +G+ Q+ +S +KI +L  DV  RL +F++
Sbjct: 713 IKNAITFGSQQKIVSEDKINDLTNDVLTRLQEFKM 747

>CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa]
           {ON} similar to uniprot|P54199 Saccharomyces cerevisiae
           YDL028c Serine/threonine protein kinase
          Length = 774

 Score =  521 bits (1342), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 334/841 (39%), Positives = 464/841 (55%), Gaps = 110/841 (13%)

Query: 28  VQSLARDDSDDENMLGPPKLSNFGSALLSDK-ENVEPYPYSRNQSVSNAKRYSQPPRAAA 86
           +  ++  DSDD  +  PPKLSNFGS L+SD  EN+ P       + S+ K  S+  R   
Sbjct: 12  IWRISSQDSDDGEIGNPPKLSNFGSELISDAIENINP-------NRSDKKLISEETRIHE 64

Query: 87  RPETFGAVREFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHNQQ-SMTTFNPETPSEQ 145
                       S+   +S + P    + E+ S STMF  S+ + Q S TT++  +    
Sbjct: 65  SHSQQLNTDINQSTRVTHSASSP---LYFEDTSPSTMFVQSQASAQPSATTYDISSQD-- 119

Query: 146 GKPEDMYLEKSRS--RVKSMQQTLRDEXXXXXXXXXXX--XXXXXXXXXLGPAKR--ASS 199
                 Y + S+S  ++KS Q TL+ E                      LGPA R   S 
Sbjct: 120 ------YSDSSKSFIKLKSKQDTLKQELTTRYSERRTRRFLHATNRTTKLGPALRNLTSP 173

Query: 200 NTGTPNHSELADESNVSQQEANFSHSSSAGATAHQNEYNVFYESQNSSSPQKDSAAPTDH 259
                +++ + ++ N + +  +   +++A    HQ + ++ Y S    +  KD+      
Sbjct: 174 ALAINDNNSIDNKMNETSKVNSSFDTNNAYVDFHQTKQDI-YTSGEEHNNTKDNGKIGAT 232

Query: 260 TSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQ 319
              +Y +I   + NP QY+K HN+PT+EL  IS+ YFE+QK ENRK AL KN+  K +  
Sbjct: 233 QQNDYSDINIHECNPIQYMKMHNLPTSELSKISKAYFEKQKEENRKKAL-KNVNMKQSL- 290

Query: 320 TRLTSASLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATNNDXXXXXXXXXXXKGLKT- 378
                          + DL     S P       I     NN            +G  T 
Sbjct: 291 ---------------NYDLKHYSNSFP------SIESGKENNLIHNTEIEDFNGRGHSTN 329

Query: 379 -----APSRDGTSPRASEMYEN----IERP-------ERDTFGSIRRREALSNININSNY 422
                  S   + P +++  E+    +E+P         D++   +R EAL NI++NSN 
Sbjct: 330 NHSSSYLSNSHSHPVSTQFVESANIELEKPTLKKSLSNADSYRHTQR-EALQNIDVNSNV 388

Query: 423 HQ--LQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVE 480
               +  KR K + ++ E         F+  + ++++   G            K VEIVE
Sbjct: 389 RDGAIDYKRQKIALKDSE---------FDGILDKKKY--RGI-----------KRVEIVE 426

Query: 481 PLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXX 540
           P  +T     +PP+        RK  + VNGTEYE++ELLGRGGSS              
Sbjct: 427 PPTST-----RPPS--------RKNVVSVNGTEYERVELLGRGGSS-NVYKVRGLKNRVY 472

Query: 541 XLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSH 600
            LK+VSFDEFD+SS+EGFKGEI LLK+L+ + RVV+L D EM  GVLY +MECGD+DLS 
Sbjct: 473 ALKKVSFDEFDESSVEGFKGEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMECGDYDLSQ 532

Query: 601 TLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIAN 660
            L  R+    D+EF+R+H++EM+ CVKVVHD+GIVHSDLKPANFVFVKGILKIIDFGIAN
Sbjct: 533 VLHQRANQPFDMEFIRYHAREMVTCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIAN 592

Query: 661 AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPA----EQNRWKVGKPSDIWSCGCI 716
           AVP+HTVNIYR+ QIGTPNYMAPEALVA NYT         + N+WK+GKP+DIWSCGCI
Sbjct: 593 AVPDHTVNIYRDMQIGTPNYMAPEALVANNYTADNDGKYDQKTNKWKIGKPADIWSCGCI 652

Query: 717 IYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEK 776
           IYQMIYG+PPY  +QGQ RLL+IM+P VKI Y E   +  V+P  A++ M+ CL RNPE+
Sbjct: 653 IYQMIYGKPPYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVIPSLALELMQYCLMRNPEE 712

Query: 777 RWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFR 836
           RWS  ++L+ PF+ P+ V+  FI++LI  +V YGA + ++S  ++E L + V  RLADFR
Sbjct: 713 RWSALQILDSPFLNPLMVSQDFIKNLITTAVSYGAREGDVSPSRLEALTDSVLARLADFR 772

Query: 837 L 837
           +
Sbjct: 773 M 773

>NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa]
           {ON} 
          Length = 747

 Score =  491 bits (1265), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 240/444 (54%), Positives = 313/444 (70%), Gaps = 34/444 (7%)

Query: 399 PERDTFGSIR--RREALSNININSNYHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEER 456
           P  D +G I+   R+ L++++IN+      + +  Y  +       I +P   ++V+   
Sbjct: 333 PPTDKYGPIQYSSRDVLTSLDINNQSPSKADHKFGYDIQ-------IGKP---YTVKTP- 381

Query: 457 FANHGFKHRSPPAVPERKHVEIVEPLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEK 516
             N  +K  SP     +K VEI+EP    +         +G     +K +I VNG +YEK
Sbjct: 382 -LNESYKRLSP-----KKKVEIIEPFIYAQK------KKTG-----KKLSITVNGIDYEK 424

Query: 517 LELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVK 576
           +ELLGRGGSS               LKRVSFDEFDDSSI GFKGEIELL+KL  +PRVV+
Sbjct: 425 IELLGRGGSSKVYKVKNDQNKIFA-LKRVSFDEFDDSSIAGFKGEIELLEKLCKEPRVVR 483

Query: 577 LIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVH 636
           L D++M  GVLY +MECGD+DLS  L  R G  LD++F+R+H +E+LKCVK VHD+GIVH
Sbjct: 484 LFDYQMSSGVLYLIMECGDNDLSQVLNQRMGFPLDMDFLRYHVRELLKCVKAVHDAGIVH 543

Query: 637 SDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQP 696
           SDLKPANFVF+KG+LK+IDFGIAN +P+HTVN+YRE+QIGTPNYMAPE L+A N++  Q 
Sbjct: 544 SDLKPANFVFIKGLLKLIDFGIANVIPDHTVNVYRESQIGTPNYMAPETLIATNHSIEQS 603

Query: 697 ---AEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTS 753
               E ++WKVGKPSD+WSCGCIIYQMIYGRPPY GFQGQNRLLAIMNPEVK+++ E+T+
Sbjct: 604 DLNKEMSKWKVGKPSDVWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPEVKVIFSERTA 663

Query: 754 NGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQ 813
             + +P + ID MKACL R+P KRWS+D++L  PF  PI VT FFI+DLIKN+VKYG +Q
Sbjct: 664 KDEKIPTSLIDLMKACLLRDPAKRWSIDKLLCSPFFNPIIVTPFFIKDLIKNAVKYGTDQ 723

Query: 814 REISNEKIEELAEDVWHRLADFRL 837
           + +++ KIEEL+ DV  RL DF++
Sbjct: 724 KTVTDAKIEELSNDVLERLNDFKM 747

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 85/289 (29%), Positives = 143/289 (49%), Gaps = 47/289 (16%)

Query: 35  DSDDENMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETFGAV 94
           DSDDE +  PPKLS F SAL S K++     +S N + +                T G +
Sbjct: 25  DSDDEPLSDPPKLSTFASALFSVKDSSNQLDFSENYNST----------------TNGPI 68

Query: 95  REFS-----SSNTNNSVAGPYSTFHSEEHSD-STMFA-TSKHNQQSMTTFNPETPSEQGK 147
            +++     S+N ++++    + F  ++HS  ST+FA T+   Q S+TT N   P +   
Sbjct: 69  NKYAGLKNVSANESHNITNNATQF--DDHSSISTIFAHTNLPRQPSITTTNNNVPGDDDN 126

Query: 148 PE------DMYLEKSRSRVKSMQQTLRDEXXXXXXXXXXXXXXXXXXXXLGPAKRASSNT 201
                   ++ +E +  R+K +QQ++++E                    LGPAKRASS  
Sbjct: 127 ARLAESYNELEMESNLQRIKVLQQSMKEELTSRYVERRNRRFLTSRLTRLGPAKRASS-- 184

Query: 202 GTPNHSELADESNVSQQEANFSHSSSAGATAHQNEYNVFYESQNSSSPQKDSAAPTDHTS 261
                  ++++  +   + N  H        H    +V  + + S+ P+  SAA     +
Sbjct: 185 ------AVSEKDILRSIDNNTQH---LLPEYHTPPLSVLDQKEISTVPE--SAA---RGN 230

Query: 262 INYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRK 310
           I+Y +I+FG L P++YLKK  +PT+ELP+IS+ YF++QK E+ +  L+K
Sbjct: 231 IDYSSIDFGRLKPFEYLKKKKLPTSELPSISKAYFQKQKEESLQNTLKK 279

>TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.162
           YDL028C
          Length = 980

 Score =  480 bits (1235), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 228/369 (61%), Positives = 284/369 (76%), Gaps = 19/369 (5%)

Query: 473 RKHVEIVEPLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXX 532
           RK VEI+EP                  +N +KP I VN  EYEK+ LLGRGGSS      
Sbjct: 627 RKKVEIIEP--------------EAKIHNYQKPIIIVNNIEYEKVALLGRGGSSKVYKVK 672

Query: 533 XXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME 592
                    LKRV FDEFDDSSIEGFKGEIELLKKLE + RVV+L D++M++G L+ +ME
Sbjct: 673 GPKNSYYA-LKRVLFDEFDDSSIEGFKGEIELLKKLEHEERVVRLFDYKMENGTLHLIME 731

Query: 593 CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILK 652
           CGD DLS  L  RS   LD+EF+R++S+EMLKCV+VVH++ IVHSDLKPANFV V  +LK
Sbjct: 732 CGDLDLSRILHQRSKQPLDLEFIRYYSREMLKCVQVVHNNDIVHSDLKPANFVLVGSVLK 791

Query: 653 IIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT--QGQPAEQ--NRWKVGKPS 708
           IIDFGIANAVP+HTVNIYRE QIGTPNYMAPEALV+MN T  + + A++  NRWKVGKPS
Sbjct: 792 IIDFGIANAVPDHTVNIYRECQIGTPNYMAPEALVSMNLTSNENENAQKPVNRWKVGKPS 851

Query: 709 DIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKA 768
           D+WSCGCI+YQM YG+PPYG +QGQNRLLAIMNPEV+I YPE T N + +P++AIDTMKA
Sbjct: 852 DVWSCGCILYQMFYGKPPYGHYQGQNRLLAIMNPEVEIKYPEFTPNNEPIPRSAIDTMKA 911

Query: 769 CLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDV 828
           CL R+P KR++++E+LN PF  PI VT FF++DLIKNSV+YG +++ ISNE++E++++DV
Sbjct: 912 CLYRDPSKRFTIEELLNNPFFSPIMVTPFFLQDLIKNSVRYGIDRKNISNEELEKMSDDV 971

Query: 829 WHRLADFRL 837
            +RL +F L
Sbjct: 972 LNRLREFIL 980

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 45/66 (68%)

Query: 263 NYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRL 322
           +Y +IEF  LNP QY +KH++P +ELP +++ Y ++Q+ ENRK  L++   ++     ++
Sbjct: 319 DYSSIEFNGLNPMQYWRKHDLPPSELPKLNKAYLQKQREENRKAVLKQRSTSRMILSNKM 378

Query: 323 TSASLS 328
           T+++ S
Sbjct: 379 TNSTSS 384

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 2/28 (7%)

Query: 34 DDSDDENML--GPPKLSNFGSALLSDKE 59
          DDSDDE+ +  GPPKLSNFGSALLS++E
Sbjct: 30 DDSDDEDNIERGPPKLSNFGSALLSNQE 57

>KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3.162
           YDL028C
          Length = 765

 Score =  417 bits (1073), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 217/431 (50%), Positives = 282/431 (65%), Gaps = 52/431 (12%)

Query: 407 IRRREALSNININSNYHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRS 466
           IR+RE L+N+N+N    +L  K+ K + E L++                           
Sbjct: 387 IRKREVLANLNVNQKEPEL--KKPKNNLEQLDK--------------------------- 417

Query: 467 PPAVPERKHVEIVEPLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSS 526
            PA+ +R  VEI EP         KP        +++  +I +N  EYEK+ELLG GGSS
Sbjct: 418 -PAIIKR--VEIQEP---------KP--------SKKNTSIVINNEEYEKIELLGSGGSS 457

Query: 527 XXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGV 586
                          LKRV+ D F++SS+E FKGEI LL+KL+ + RVV+L ++ ++  V
Sbjct: 458 KVYKVRDSSKKVFA-LKRVAIDMFEESSVESFKGEIALLEKLKNQERVVQLYNYALESSV 516

Query: 587 LYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF 646
           LY +MECGD+DLS  L  R    LD EFVR++++E+  CVKVVHD GIVHSDLKPANF+F
Sbjct: 517 LYLIMECGDYDLSVMLRERLNKPLDTEFVRYYAREISHCVKVVHDVGIVHSDLKPANFIF 576

Query: 647 VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGK 706
           VKG LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT G+ +  +RWKVGK
Sbjct: 577 VKGTLKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTNGE-SNVSRWKVGK 635

Query: 707 PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTM 766
           PSD+WS GCIIYQM+YG+PPY  FQG +R+ AI+ P VKI YP     G  VP + I+ +
Sbjct: 636 PSDVWSLGCIIYQMVYGKPPYASFQGNDRIRAIIKPSVKIEYPS-VKEGVTVPNSIIELI 694

Query: 767 KACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAE 826
           K CL R+P KR  VD +LN  F+ PI V+  F+RDL+KN+V+YG  Q ++S   I+ LA 
Sbjct: 695 KVCLNRDPNKRVDVDGMLNSTFLSPILVSEAFVRDLVKNAVEYGIKQGDVSITTIDALAN 754

Query: 827 DVWHRLADFRL 837
           DV  +L+++R+
Sbjct: 755 DVIEKLSEYRI 765

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 85/292 (29%), Positives = 128/292 (43%), Gaps = 56/292 (19%)

Query: 40  NMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETFGA------ 93
           N++GPPKLS+FGS LL++  N     +S   +       +  PR   R +  G       
Sbjct: 44  NIIGPPKLSDFGSNLLNESAN-----HSGTFTKFRGLGMAHSPRVTQRIDGPGGNNIVSH 98

Query: 94  --------VREFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHNQQSMTTFN---PETP 142
                      F S+  N +     +T ++ +H DS+  +T K++  + T        T 
Sbjct: 99  RNGSSPSSSSIFGSTVYNPARPSSMTTVNNLKHEDSSRISTVKNDVLNRTLERRRLSRTA 158

Query: 143 SEQGKP---EDMYLEKSRSRVKSMQQTLRDEXXXXXXXXXXXX-XXXXXXXXLGPAKRAS 198
           S    P     + L+     ++ ++QT+RDE                     LGPAKR +
Sbjct: 159 SSLSNPPTVNSIDLKDHEVNIEKIKQTIRDETTSKLLERRAKRFLNLERRNRLGPAKR-T 217

Query: 199 SNTGTPNHSELADESNVSQQEANFSHSSSAGATAHQNEYNVFYESQNSSSPQKDSAAPTD 258
           S T +   SE+ D   + Q++A        G    Q+            +PQ D      
Sbjct: 218 SMTSSLITSEMDDL--LIQRDA-------KGEVEQQDR---------EMTPQVD------ 253

Query: 259 HTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRK 310
                Y NI FGDLNP+QY+ K+NIP  ELP IS++Y E++K ENR+ ALRK
Sbjct: 254 -----YSNIVFGDLNPFQYVNKYNIPMEELPQISKVYIEKRKEENRRVALRK 300

>NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {ON}
           Anc_3.162
          Length = 641

 Score =  328 bits (841), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 151/329 (45%), Positives = 217/329 (65%), Gaps = 3/329 (0%)

Query: 509 VNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKL 568
           +   E   +ELLG+GGSS               LK++  +E D++     + EIELLK+L
Sbjct: 316 ITDEELSIVELLGKGGSSKVYKVQDRTGKYYA-LKQILLEELDENLKTDLEREIELLKRL 374

Query: 569 ETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKV 628
             + RVVKLI++++D  ++  +MECG+ DLSH L  R     D+ FVR  S+EM++C+K 
Sbjct: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434

Query: 629 VHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 688
           VHDS IVHSDLKPANF+FVKG LK+IDFGIAN + ++T+N+YR TQ+GTPNYMAPE L++
Sbjct: 435 VHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLIS 494

Query: 689 MNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 748
            NY+         WK+GKPSDIWS GCI+YQM YG PPY  F G +RLLAIMNP ++I Y
Sbjct: 495 QNYSNN--NNNLLWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDY 552

Query: 749 PEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVK 808
           P ++  G  VP++ +  +K CL R+P+ R + DE+ +  F  P+ ++  F+  LI N++ 
Sbjct: 553 PNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAIN 612

Query: 809 YGANQREISNEKIEELAEDVWHRLADFRL 837
           YG   + I+ ++I+ L+ +V  +L+   L
Sbjct: 613 YGIENQNITQDRIKLLSNEVVSKLSTLNL 641

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 4/60 (6%)

Query: 268 EFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLTSASL 327
           E G+LNP+QYLKK+N+PT EL  +++LY  R+  E R     K   A DA +   +S  L
Sbjct: 134 ELGELNPFQYLKKNNLPTKELSRLTKLYCNRKLDETRS----KKTQAIDAHEMNSSSDQL 189

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 133/293 (45%), Gaps = 27/293 (9%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           + + E++G+G                  +K ++ D  D+  +E  + EI+ L  L+  P 
Sbjct: 41  FRRTEVIGKGKFGVVYKGYNLRTKHVYAIKVLNLDS-DEDEVEDVQREIQFLASLKQLPN 99

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           V +     + +  L+ +ME C    L     LR G  +D +++    +E+L  +K +H  
Sbjct: 100 VTRYYGSYLKNTSLWIIMEYCAGGSLRS--LLRPGK-IDEKYIGVIMRELLVALKFIHKD 156

Query: 633 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            I+H D+K AN +   +G +K+ DFG+A  + + T  + R+T  GTP +MAPE ++   Y
Sbjct: 157 NIIHRDIKAANVLITNEGGVKLCDFGVAAQLNQRT--LRRQTMAGTPYWMAPEVIMEGVY 214

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +             DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 215 YDTK------------VDIWSLGITAYEISTGNPPYCDVEALRAMQLITKSK-----PPR 257

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVT-HFFIRDLI 803
               +  P    + +  CL+ +P +R S DE+L   F+K    T    +++LI
Sbjct: 258 LEGRNYTPLIK-EFIALCLDEDPNERLSADELLKSKFIKAHKTTPTIVLKELI 309

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 131/279 (46%), Gaps = 26/279 (9%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           +++ E++GRG                  +K ++ D  +D  +E  + EI+ L  L+  P 
Sbjct: 16  FKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDE-VEDVQREIQFLASLKQIPN 74

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           + +     +    L+ +ME C    L     LR G  +D +++    +E+L  +KV+H  
Sbjct: 75  ITRYYGSYLRGTSLWIIMEYCAGGSLRS--LLRPGK-IDEKYIGVIMRELLVALKVIHKD 131

Query: 633 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            ++H D+K AN +   +G +K+ DFG+A  +  +  ++ R+T  GTP +MAPE ++   Y
Sbjct: 132 NVIHRDIKAANVLITNEGQVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIMEGVY 189

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +             DIWS G   Y++  G PPY   +    +  I+  +     P +
Sbjct: 190 YDTK------------VDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSK-----PPR 232

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
               +  P+   + +  CL+ +P++R S +E+L   F+K
Sbjct: 233 LEERNYTPQLK-EFIALCLDEDPQERLSAEELLKTKFIK 270

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 128/279 (45%), Gaps = 26/279 (9%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           +++ E++GRG                  +K ++ D  D   +E  + EI+ L  L+  P 
Sbjct: 23  FKRTEVVGRGKFGVVYKGYNVKTRRVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQMPN 81

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           + +     +    L+ +ME C    L   L  R G  +D +++    +E+L  +K +H  
Sbjct: 82  ITRYYGSYLKDTSLWILMEYCAGGSLRSLL--RPG-KIDEKYIGVIMRELLVALKCIHKD 138

Query: 633 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNEGSVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVY 196

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +             DIWS G   Y++  G PPY   +    +  I+  +     P +
Sbjct: 197 YDTK------------VDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSK-----PPR 239

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
              G     +  + +  CL+ +P++R S D++L   F+K
Sbjct: 240 LE-GRSYSSSLKEFIALCLDEDPKERLSADDLLRSKFIK 277

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score =  101 bits (251), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 82/304 (26%), Positives = 139/304 (45%), Gaps = 34/304 (11%)

Query: 498 DSYNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEG 557
           D YN+++P+     T Y   + +GRG                  +K V+  E  D  IE 
Sbjct: 10  DLYNQKRPS-----TIYSIQDCVGRGNFGDVYKAIDKLTGEIVAIKVVNL-ESSDEDIEL 63

Query: 558 FKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVR 616
              EI  L +L++ P +   I   ++   ++ VME CG    S  +      GL  + V 
Sbjct: 64  IAQEIFFLAELKS-PYITNYITTMLEDVSMWIVMEYCGGGSCSDLIRYHYNEGLHEDKVA 122

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI 675
           F ++ +L+ ++ +H+   +H D+K AN +    G++K+ DFG++  +        R T +
Sbjct: 123 FITKNVLRGLQYLHEQRKIHRDVKAANVLLTDDGLVKLADFGVSGQLRSTA---KRNTFV 179

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           GTP +MAPE  +  N + G           + +DIWS G  +Y+++ G PPY  +     
Sbjct: 180 GTPYWMAPE--IISNSSHGY---------NEKADIWSLGITVYELLKGCPPYAKYDAGKV 228

Query: 736 LLAIMNPEVKIVYPEKTSNGDVV--PKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIA 793
           +  I         P+K     +V     A   + ACL ++P++R +  E+L  PFVK I 
Sbjct: 229 MRNI---------PKKNLQDCMVSFSDAAKLFISACLIKDPDERPTATELLQQPFVKNIK 279

Query: 794 VTHF 797
           +T  
Sbjct: 280 ITDL 283

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 136/293 (46%), Gaps = 27/293 (9%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           + + E++GRG                  +K ++ D  D+  +E  + EI+ L  L+  P 
Sbjct: 42  FRRTEVIGRGKFGIVYKGYHVKTKQIYAIKVLNLDS-DEDEVEDVQREIQFLASLKQLPN 100

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           + +     +    L+ +ME C    L  TL LR G  +D +++   ++E+L  +K +H  
Sbjct: 101 ITRYYGSYLKDTSLWIIMEYCAGGSL-RTL-LRPG-KIDEKYIGVITREILIALKYIHKD 157

Query: 633 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            I+H D+K AN +   +G +K+ DFG+A  + + T    R+T  GTP +MAPE ++   Y
Sbjct: 158 NIIHRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKR--RQTMAGTPYWMAPEVIMEGVY 215

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +             DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 216 YDTK------------VDIWSLGITTYEIATGNPPYCEIEALRAMQLITKSK-----PPR 258

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHF-FIRDLI 803
               +  P    + +  CL+ +P++R S +++L   F+K   +T    +++LI
Sbjct: 259 LEGRNYSPLLK-EFVALCLDEDPKERMSAEDLLKTKFIKAHKLTPVSILKELI 310

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score =  102 bits (255), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 132/286 (46%), Gaps = 30/286 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRV------SFDEFDDSSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V      S DE   S +E  K E+  LK 
Sbjct: 1146 WIKGEIIGKGSFGSVYLGLNVTTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKD 1205

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E  + V    +E        +L +R     D + +RF + ++L+ + 
Sbjct: 1206 LD-HVNIVQYLGFENKNHVYSLFLEYVAGGSVGSL-IRLFGRFDEDLIRFLAVQVLRGLA 1263

Query: 628  VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  V GI KI DFGI+    + + NIY  + +   GT  +MAP
Sbjct: 1264 YLHSKGILHRDMKADNLLLDVDGICKISDFGIS----KKSNNIYSNSDMTMRGTVFWMAP 1319

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GC++ +M  G+ P+  F+    +  I   +
Sbjct: 1320 EMV---DTKQGYSAK---------VDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFK 1367

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
                 PE T    ++   A   + AC E +PEKR + D++L+ PF 
Sbjct: 1368 SAPPIPEDTQK--LLSAEAKSFLDACFEIDPEKRPTADDLLSHPFC 1411

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 150/344 (43%), Gaps = 54/344 (15%)

Query: 483 KTTESIPLKPPATSGDSYN----RRKPTIYVNGTE----------YEKLELLGRGGSSXX 528
           KTT ++P K    S +       R K  +Y   TE          Y  L  +G+G S   
Sbjct: 575 KTTPTVPAKASRRSNEKKKEERERNKKLLYAKLTEICSPGDPKSKYRDLIKIGQGASGGV 634

Query: 529 XXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK-PRVVKLIDHEMDHGVL 587
                        +K+++ ++      E    EI +++  E+K   +V  ID  +  G L
Sbjct: 635 YIAHDTESEDSVAIKQMNLEK--QPKKELILNEILVMR--ESKHSNIVNFIDSYLAKGDL 690

Query: 588 YEVMECGDHD-----LSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPA 642
           + VME  +       ++H L     +G          +E LK ++ +H  G++H D+K  
Sbjct: 691 WIVMEYMEGGSLTDVVTHCLLSEGQIGAVC-------RETLKGLQFLHSKGVLHRDIKSD 743

Query: 643 NFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNR 701
           N +  +KG +K+ DFG    + E+  N+ R T +GTP +MAPE +             +R
Sbjct: 744 NILLSLKGNIKLTDFGFCAQINEN--NLKRTTMVGTPYWMAPEVV-------------SR 788

Query: 702 WKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVKIVYPEKTSNGDVVPK 760
            + G   DIWS G +I +MI G PPY        L L   N   K+  PE  S+      
Sbjct: 789 KEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPEALSD------ 842

Query: 761 TAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
           T    +  CL+ +P +R +  E+L+ PF+  IA  +  +  L+K
Sbjct: 843 TLTKFLDWCLKVDPSERATATELLDDPFITEIAEDNSSLSPLVK 886

>KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]
           {ON} similar to uniprot|P38070 Saccharomyces cerevisiae
           YBR028C Hypothetical ORF
          Length = 556

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 87/282 (30%), Positives = 127/282 (45%), Gaps = 45/282 (15%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDV 612
           IE    E  +L +LE  P +VKL     D+  LY V++   G     H   L+    LD 
Sbjct: 225 IERTFAERTILSQLE-HPNIVKLFYSFHDNHKLYLVLQYIPGGELFYH---LKEQGTLDE 280

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIAN-------AVPE 664
             V F++ E+   +K +H  GIV+ DLKP N +   +G L + DFG++        A PE
Sbjct: 281 GTVAFYAAELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPE 340

Query: 665 HTVNIYR-ETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYG 723
              N+ +  + IGTP Y APE L       G+P  QN        D +S GC++Y M+ G
Sbjct: 341 EGENVNQLYSIIGTPEYCAPEILA------GEPYTQN-------CDWYSLGCLVYDMLIG 387

Query: 724 RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
           +PP+ G   +  L  I   +     P   S+G        D + A L ++P KRW VD+ 
Sbjct: 388 KPPFTGVNHKIILNKIKQEKTGARIPSYLSDG------FKDYLGALLRKDPTKRWDVDKY 441

Query: 784 L--NGPFVKPIA---------VTHFFIRDLIKNSVKYGANQR 814
              +GP  K            + HF  R +I   +  G  Q+
Sbjct: 442 WAQDGPKTKKKKAGQAKTTNYIGHFIFRKIIWKQLLSGDLQK 483

>KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944)
           [915 bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 142/311 (45%), Gaps = 53/311 (17%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE +G G  +               LK V  D  + +     + EI L+K+L+  
Sbjct: 5   SQFKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALR----SGMGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D+DL   +  R    S  GL+++ V++   ++L+ V 
Sbjct: 63  DNIVRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQGVA 122

Query: 628 VVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +   +G LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALV-AMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI---M 740
            L+ + NY                 DIWSCGCI+ +MI G+P + G   + +L  I   M
Sbjct: 179 VLMGSRNYCTS-------------IDIWSCGCILAEMIMGKPLFPGSNDEEQLKLIFDTM 225

Query: 741 NPEVKIVYPEKT-----------------------SNGDVVPKTAIDTMKACLERNPEKR 777
              V+  +P+ T                       +  +V+    +D +   L+ NP+ R
Sbjct: 226 GTPVEQTWPQVTQLAKYNPLLPPHMPRDLKQLLQNNTEEVLDDNVVDLLHGLLQLNPDAR 285

Query: 778 WSVDEVLNGPF 788
            S  + LN P+
Sbjct: 286 LSAKDALNHPW 296

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 138/305 (45%), Gaps = 37/305 (12%)

Query: 515 EKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRV 574
           ++ E++GRG                  +K ++ D  D   +E  + EI+ L  L+  P +
Sbjct: 45  KRTEVIGRGKFGVVYKGYHLKTKHVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQVPNI 103

Query: 575 VKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSG 633
            +     +    L+ +ME C    L  TL LR GM +D +++    +E+L  ++ +H   
Sbjct: 104 TRYYGSYLQDTNLWIIMEYCAGGSL-RTL-LRPGM-IDEKYIGVIMRELLTALQCIHKDN 160

Query: 634 IVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT 692
           ++H D+K AN +   +G +K+ DFG+A  +  +  ++ R+T  GTP +MAPE ++   Y 
Sbjct: 161 VIHRDIKAANVLITNEGKVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIMEGVYY 218

Query: 693 QGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKT 752
             +             DIWS G   Y++  G PPY   +    +  I   +   +   + 
Sbjct: 219 DTK------------VDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRQY 266

Query: 753 SNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK-----PIAVT------HFFIRD 801
           S+G        + +  CL+ +P++R S +E+    F+K     P A+       +   RD
Sbjct: 267 SSG------LKEFIALCLDEDPKERLSAEELQKSKFIKAHKSSPTAILKELISRYLLFRD 320

Query: 802 LIKNS 806
             K+S
Sbjct: 321 KTKSS 325

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score =  100 bits (250), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 126/279 (45%), Gaps = 26/279 (9%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           +++ E++GRG                  +K ++ D  D   +E  + EI+ L  L+    
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTRRVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQISN 81

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           + +     +    L+ +ME C    L     LR G  +D +++    +E+L  +K +H  
Sbjct: 82  ITRYYGSYLKDTSLWIIMEYCAGGSLRS--LLRPGK-IDEKYIGVIMRELLVALKCIHKD 138

Query: 633 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVY 196

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +             DIWS G   Y++  G PPY   +    +  I+  +     P +
Sbjct: 197 YDTK------------VDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSK-----PPR 239

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                  P    + +  CL+ +P++R S D++L   F+K
Sbjct: 240 LEGRSYSPSLK-EFIALCLDEDPKERLSADDLLRSKFIK 277

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score =  100 bits (250), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 128/288 (44%), Gaps = 38/288 (13%)

Query: 518 ELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIE------------GFKGEIELL 565
           E LG G +                +K +S   F+++S +            G + EI ++
Sbjct: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREI-II 80

Query: 566 KKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKC 625
            KL   P V++L D    +  LY V+E  +      L +  G   + E +RF  Q ++  
Sbjct: 81  MKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQ-IIIG 139

Query: 626 VKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPE 684
           +   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET  G+P+Y APE
Sbjct: 140 ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKL---LETSCGSPHYAAPE 196

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--QNRLLAIMNP 742
            +  + Y             G  SD+WSCG I++ ++ GR P+    G  +N LL + + 
Sbjct: 197 IVSGIPYH------------GFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244

Query: 743 EVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
           E ++       + D +   A D +   L  +PEKR    ++L  P ++
Sbjct: 245 EFEM------PSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 86/298 (28%), Positives = 137/298 (45%), Gaps = 36/298 (12%)

Query: 513 EYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKP 572
           +Y  L  +GRGGS+               +K+++ ++     +     EI ++KK +  P
Sbjct: 612 KYANLVKIGRGGSALVYTAYEVGTNLSVAIKQINLEKQPRKQL--ILNEIIVMKKSQ-HP 668

Query: 573 RVVKLIDHEMDHG---VLYEVMECGD-HDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKV 628
            +V  ID  +  G   V+ E ME G   D+     LR G       +    +E+LK +  
Sbjct: 669 NIVNFIDSYLVDGKLWVIMEYMEAGSLTDVVTRCILREGQ------IGAVCREVLKGLVF 722

Query: 629 VHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 687
           +H  G++H D+K  N +  + G +K+ DFG    +  + +++ R T +GTP +MAPE + 
Sbjct: 723 LHSKGVIHRDIKSDNVLLSMDGDIKLTDFGFCAQL--NDIHLKRNTMVGTPYWMAPEIVE 780

Query: 688 AMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVKI 746
             +Y           KV    DIWS G +I +MI G PPY        L L   N   K+
Sbjct: 781 KKHYCP---------KV----DIWSLGVMIIEMIEGEPPYLNEPPLRALYLIATNGTPKL 827

Query: 747 VYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
             PEK S      +T  + +  CL  +PE R +  E+LN  F+  IA  +  +  L+K
Sbjct: 828 KDPEKLS------ETLSEFINCCLFVDPELRKTAAELLNHRFITEIAGPNKSLSHLVK 879

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  100 bits (250), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 116/237 (48%), Gaps = 29/237 (12%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++K L + P V+ L++   +   LY V+E  D        +  G   + E V 
Sbjct: 172 GIEREIVIMK-LISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVH 230

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG--ILKIIDFGIANA-VPEHTVNIYRET 673
           + +Q +++ V   H   I H DLKP N +  K   ++KI DFG+A   +P    N   ET
Sbjct: 231 YFTQ-IIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELP----NKLLET 285

Query: 674 QIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 733
             G+P+Y +PE ++      G+P        G PSD+WSCG I++ ++ G  P+     +
Sbjct: 286 SCGSPHYASPEIVM------GKPYH------GGPSDVWSCGIILFALLTGHLPFNDDNIK 333

Query: 734 NRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
             LL +     ++  P   +N       A D +   L  NPEKR +++E+LN P +K
Sbjct: 334 KLLLKVQAGRFQL--PPYLTND------AKDLITRILVTNPEKRLTINEILNHPLIK 382

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 134/299 (44%), Gaps = 38/299 (12%)

Query: 513 EYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKP 572
           +Y  L  +G+G S                +K+++ ++      E    EI ++K     P
Sbjct: 550 KYTNLVKIGQGASGGVYTAYEVGTDASVAIKQMNLEK--QPKKELIINEIIVMKD-SKHP 606

Query: 573 RVVKLIDHEMDHG---VLYEVMECGDHD--LSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            +V  ID  +  G   V+ E ME G     ++H +     +G          +E L+ ++
Sbjct: 607 NIVNFIDSFLLKGDLWVIMEFMEGGSLTDVVTHCILTEGQIGTVC-------RETLRGLQ 659

Query: 628 VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 686
            +H +G++H D+K  N +  +KG +K+ DFG    + EH  N+ R T +GTP +MAPE +
Sbjct: 660 FLHSNGVIHRDIKSDNILLSMKGDIKLTDFGFCAQINEH--NLKRTTMVGTPYWMAPEVV 717

Query: 687 VAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVK 745
                        +R + G   DIWS G +I +MI   PPY        L L   N   K
Sbjct: 718 -------------SRKEYGPKVDIWSLGIMIIEMIESEPPYLNETPLRALYLIATNGTPK 764

Query: 746 IVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
           +  PE  S  DV+     D +  CL+ NP++R S   +L  PF+   +  +  +  L+K
Sbjct: 765 LKEPELLS--DVLN----DFLSWCLKVNPDERASASTLLEDPFITEYSEPNVSLAPLVK 817

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score =  100 bits (249), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 83/322 (25%), Positives = 147/322 (45%), Gaps = 35/322 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEF---DDSSI---EGFKGEIELLKK 567
            + K E++G+G                  +K+V+  EF   D+S+I   E  K E+  LK 
Sbjct: 1038 WIKGEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKD 1097

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L     +V+ +  E  +G+    +E        +L +R     D + +R  ++++L+ + 
Sbjct: 1098 LN-HVNIVQYLGFEEKNGIYSLFLEYVAGGSVGSL-IRMYGRFDDQLIRHLTKQVLEGLA 1155

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +    G+ KI DFGI+      + NIY  + +   GT  +MAP
Sbjct: 1156 YLHSKGILHRDMKADNLLLDNDGVCKISDFGIS----RKSNNIYSNSDMTMRGTVFWMAP 1211

Query: 684  EAL-VAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 742
            E +  A  Y+          KV    DIWS GC++ +M  G+ P+  F+    +  I   
Sbjct: 1212 EMVDTAHGYSA---------KV----DIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKS 1258

Query: 743  EVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHF---FI 799
            +     P+ T   D+V       +  C E +PE R + D ++  PF K  +   F    +
Sbjct: 1259 KTAPPIPDDTK--DLVSPAGQSFLDQCFEIDPEMRPTADSLVGHPFCKTSSSFDFPKTKL 1316

Query: 800  RDLIKNSVKYGANQREISNEKI 821
               IK++ K  +++  IS++++
Sbjct: 1317 AQFIKSNDKLNSSRLRISSQEL 1338

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 131/305 (42%), Gaps = 36/305 (11%)

Query: 501 NRRKPTIYVNGTEYEKL-ELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIE--- 556
           N+  PTI  +     K+ E LG G +                +K +S   F DS++    
Sbjct: 4   NKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMV 63

Query: 557 ----------GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRS 606
                     G + EI ++K L     V++L D    +  LY V+E  +      L +  
Sbjct: 64  DNTTPDALPYGIEREIVIMKLL-NHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVER 122

Query: 607 GMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEH 665
           G   + E +RF  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A    E 
Sbjct: 123 GPLPENEAIRFFRQ-IIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED 181

Query: 666 TVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRP 725
            +    ET  G+P+Y APE +  + Y             G  SD+WSCG I+Y ++ GR 
Sbjct: 182 KL---LETSCGSPHYAAPEIVSGIPYH------------GFASDVWSCGVILYALLTGRL 226

Query: 726 PYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLN 785
           P+    G  R L +     +   PE     D + K A + +   L  NP +R +  ++L 
Sbjct: 227 PFDEEDGNIRNLLLKVQAGQFEMPE----DDEISKEAQNLISKILVVNPAERITARDILK 282

Query: 786 GPFVK 790
            P ++
Sbjct: 283 HPLLQ 287

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 127/254 (50%), Gaps = 27/254 (10%)

Query: 543 KRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHT 601
           KR   D+FD     G K E+++L+KL   PR+VKL D   D+   Y +ME     DL   
Sbjct: 225 KRKVMDKFD-----GVKRELDVLQKL-NHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDF 278

Query: 602 LALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGI 658
           +A    +G D    R  ++++L+ VK +HD GI H DLKP N +  +    ++KI DFG+
Sbjct: 279 VAAHGTVGEDAG--REITRQVLEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGL 336

Query: 659 ANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQ--NRWKVGKPSDIWSCGCI 716
           A    ++T   +  T  GT  Y+APE +       G+ AE   NR       D+WS GC+
Sbjct: 337 AKVQNQNT---FLNTFCGTLAYVAPEVI------DGKNAEDKTNRDLYSSLVDMWSIGCL 387

Query: 717 IYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEK 776
           +Y ++ G  P+ G Q QN L   +    +  Y E       + + A + +   L  +P++
Sbjct: 388 VYVILTGHLPFSG-QSQNELFKQIK---RGSYHEGPLKDYRISEEARNFIDCLLNVDPKE 443

Query: 777 RWSVDEVLNGPFVK 790
           R +  + L  P++K
Sbjct: 444 RMNAGKALQHPWMK 457

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 114/242 (47%), Gaps = 26/242 (10%)

Query: 552 DSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLD 611
           DS   G + EI ++ KL   P V++L D       LY V+E  +      L +  G   +
Sbjct: 72  DSLPYGIEREI-IIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130

Query: 612 VEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIY 670
            E +RF  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A    E  +   
Sbjct: 131 NEAIRFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKL--- 186

Query: 671 RETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGF 730
            ET  G+P+Y APE +  + Y             G  +D+WSCG I++ ++ GR P+   
Sbjct: 187 LETSCGSPHYAAPEIISGLPYH------------GLETDVWSCGIILFALLTGRLPFDEE 234

Query: 731 QG--QNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
            G  +N LL + + + ++         D + + A D +   L  +P+KR    E+L  P 
Sbjct: 235 DGNIRNLLLKVQSGQFEM------PGNDEISREAQDLISKILTVDPKKRIKTREILKHPL 288

Query: 789 VK 790
           V+
Sbjct: 289 VQ 290

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 116/249 (46%), Gaps = 24/249 (9%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL   P V++L D    +  LY V+E  +      L +  G   + E +R
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  V   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET  
Sbjct: 136 FFRQ-IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETSC 191

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  R
Sbjct: 192 GSPHYAAPEIVSGIPYQ------------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 736 LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK--PIA 793
            L +   + +   P    + D + + A D +   L  +PE+R    ++L  P ++  P  
Sbjct: 240 ALLLKVQKGEFELP----SDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSI 295

Query: 794 VTHFFIRDL 802
                IRDL
Sbjct: 296 RDSKSIRDL 304

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 112/235 (47%), Gaps = 22/235 (9%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL   P V++L D    +  LY V+E  +      L +  G   + E +R
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  V   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET  
Sbjct: 136 FFRQ-IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETSC 191

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  R
Sbjct: 192 GSPHYAAPEIVSGIPYQ------------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 736 LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
            L +   + +   P    + D + + A D ++  L  +PE+R    ++L  P ++
Sbjct: 240 TLLLKVQKGEFEMP----SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 109/230 (47%), Gaps = 25/230 (10%)

Query: 564 LLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEML 623
           ++ KL   P V++L D    +  LY V+E  +      + +  G   + E VR   Q ++
Sbjct: 81  IIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQ-II 139

Query: 624 KCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 682
             +   H  G+VH DLKP N +    + +KI DFG+A    E  +    ET  G+P+Y A
Sbjct: 140 IGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDKL---LETSCGSPHYAA 196

Query: 683 PEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--QNRLLAIM 740
           PE +  + Y             G  SD+WSCG I++ ++ GR P+    G  +N LL + 
Sbjct: 197 PEIISGLPYE------------GFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQ 244

Query: 741 NPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
             E ++       + D + K A D +   L  +P KR ++ E+L  P ++
Sbjct: 245 KGEFEM------PDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/316 (23%), Positives = 142/316 (44%), Gaps = 27/316 (8%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           + + E++GRG                  +K ++ D  D+  +E  + E++ L  L+  P 
Sbjct: 37  FRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDS-DEDEVEDVQREVQFLSSLKQIPN 95

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           + +     +    L+ +ME C    L     LR G  +D +++    +E+L  +K +H  
Sbjct: 96  ITRYYGSYLKDTSLWIIMEYCAGGSLRS--LLRPG-KIDEKYIGVIMRELLVALKYIHKD 152

Query: 633 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            ++H D+K AN +   +G +K+ DFG+A  + + T  + R+T  GTP +MAPE ++   Y
Sbjct: 153 NVIHRDIKAANVLITNEGSVKLCDFGVAAQLNQST--LRRQTMAGTPYWMAPEVIMEGVY 210

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +             DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 211 YDTK------------VDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSK-----PPR 253

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHF-FIRDLIKNSVKYG 810
             +    P    + +  CL+ +P++R S +E+    F+K   +T    +++LI   + + 
Sbjct: 254 LESRSYTPLLK-EFIALCLDEDPKERLSAEELSKTKFIKAHKLTPVSILKELISRYLLFR 312

Query: 811 ANQREISNEKIEELAE 826
              +  S E+   +AE
Sbjct: 313 DRNKASSKEEDGMVAE 328

>SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915
           bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 136/310 (43%), Gaps = 51/310 (16%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSG----MGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D+DL   +  R+      GL +  V++   ++L+ V 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRAVGNTPQGLALPLVKYFEWQLLQGVA 122

Query: 628 VVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---- 740
            L+                     DIWSCGCI+ +MI G+P + G   + +L  I     
Sbjct: 179 VLMGSR------------TYSTSIDIWSCGCILVEMITGKPLFPGTSDEEQLKLIFETMG 226

Query: 741 ----------------NPEVKIVYPE------KTSNGDVVPKTAIDTMKACLERNPEKRW 778
                           NP   I  P+      ++   + +    +D +   L+ NPE R 
Sbjct: 227 TPTERTWPGISSLPKYNPNFPIHLPKDLRAFLQSQTRESLDNNVVDLLHGLLQLNPEMRL 286

Query: 779 SVDEVLNGPF 788
           S  + LN P+
Sbjct: 287 SAKQALNHPW 296

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 129/286 (45%), Gaps = 30/286 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRV------SFDEFDDSSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V      S DE   S +E  + E+  LK 
Sbjct: 1146 WIKGEMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKD 1205

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E  + V    +E        +L +R     D   +RF + ++L+ + 
Sbjct: 1206 LD-HTNIVQYLGFENKNYVYSLFLEYVAGGSVGSL-IRLYGKFDENLIRFLAVQVLRGLS 1263

Query: 628  VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H   I+H D+K  N +  V GI KI DFGI+    + + NIY  + +   GT  +MAP
Sbjct: 1264 YLHSKKILHRDMKADNLLLDVDGICKISDFGIS----KKSNNIYSNSDMTMRGTVFWMAP 1319

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GC++ +M  G+ P+   +    +  I   +
Sbjct: 1320 EMV---DTKQGYSAKV---------DIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFK 1367

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
                 PE T    ++     + + AC E NPEKR + DE+L+ PF 
Sbjct: 1368 SAPPIPEDTQK--IISAEGKEFLDACFEINPEKRPTADELLSHPFC 1411

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 111/235 (47%), Gaps = 22/235 (9%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL   P V++L D    +  LY V+E  +      L +  G   + E +R
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNLLVERGPLPENEAIR 135

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  V   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET  
Sbjct: 136 FFRQ-IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETSC 191

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  R
Sbjct: 192 GSPHYAAPEIVSGIPYQ------------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 736 LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
            L +   + +   P    + D + + A D +   L  +PE+R    ++L  P ++
Sbjct: 240 TLLLKVQKGEFELP----SDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQ 290

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 126/279 (45%), Gaps = 26/279 (9%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           +++ E++GRG                  +K ++ D  D   +E  + EI+ L  L+    
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTRRVFAIKVLNLDS-DSDEVEDVQREIQFLASLKQIHN 81

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           + +     +    L+ +ME C    L     LR G  +D +++    +E+L  +K +H  
Sbjct: 82  ITRYYGSYLKDTSLWIIMEYCAGGSLRS--LLRPGK-IDEKYIGVIMREVLVALKCIHKD 138

Query: 633 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVY 196

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +             DIWS G   Y++  G PPY   +    +  I+  +     P +
Sbjct: 197 YDTK------------VDIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSK-----PPR 239

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                  P    + +  CL+ +P++R S D++L   F+K
Sbjct: 240 LEGRSYSPSLK-EFIALCLDEDPKERLSADDLLKSKFIK 277

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 114/241 (47%), Gaps = 27/241 (11%)

Query: 551 DDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGL 610
           D+S+  G + EI ++K L + P V+ L +   +   LY V+E  D        +  G   
Sbjct: 200 DNSNRYGIEREIVIMK-LVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLT 258

Query: 611 DVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVN 668
           ++E VR+  Q +++ V+  H   I H DLKP N +  K   ++KI DFG+A        N
Sbjct: 259 ELEAVRYFKQ-IIRGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMA---ALQVSN 314

Query: 669 IYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYG 728
              +T  G+P+Y +PE ++   Y  G            PSD+WSCG I++ ++ G  P+ 
Sbjct: 315 TLLKTSCGSPHYASPEIVMGKTYNGG------------PSDVWSCGIILFALLTGHLPFN 362

Query: 729 GFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
               +  L+ + N   ++         + + K A D +   L  NP+ R + +++L  P 
Sbjct: 363 DDSIKKLLIKVQNGRYQM--------PNYLSKDAKDLISRILLVNPKARLTTEQILEHPL 414

Query: 789 V 789
           +
Sbjct: 415 I 415

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 127/282 (45%), Gaps = 26/282 (9%)

Query: 511 GTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLET 570
           G+ +++ E++GRG                  +K ++ D  D+  +E  + E++ L  ++ 
Sbjct: 23  GSIFKRTEIIGRGKFGVVYKGYHSRTKQVFAIKVLNLDS-DEDEVEDVQREVQFLASMKQ 81

Query: 571 KPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVV 629
            P + +     +    L+ ++E C    L  TL LR G  +D +++    +E+L  +K +
Sbjct: 82  VPNITQYYGSYLKDTTLWIIIEYCAGGSL-RTL-LRPGK-IDEKYIGVIMRELLIALKFI 138

Query: 630 HDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 688
           H   ++H DLK AN +    G +K+ DFG+A  + +   N  R T  GTP +MAPE ++ 
Sbjct: 139 HRDNVIHRDLKAANVLITNDGQVKLCDFGVAAQLNQS--NSRRHTMAGTPYWMAPEVIME 196

Query: 689 MNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 748
             Y   +             DIWS G   Y+   G PPY   +    +  I   +     
Sbjct: 197 GVYYDTK------------VDIWSLGITTYEAATGNPPYCEVEALRAMQLITKSK----- 239

Query: 749 PEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
           P +       P    + +  CL+ +P++R S +E+L   F+K
Sbjct: 240 PPRLEGRSYSPLLK-EFIALCLDEDPKERLSAEELLKTKFIK 280

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 140/297 (47%), Gaps = 17/297 (5%)

Query: 518 ELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKL 577
           E++G+G  +               +K +S  +   S+++G   E+E+L++L+  PR+V+L
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGSNMDGVSRELEVLQRLD-HPRIVRL 264

Query: 578 IDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVH 636
                DH   Y +ME     DL   +A    +G D    R  S+++L+ +K +H  GI H
Sbjct: 265 KGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAG--REISRQILEAIKYIHSMGISH 322

Query: 637 SDLKPANFVFVKG---ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN--- 690
            DLKP N +  +    ++KI DFG+A      T   + +T  GT  Y+APE +   N   
Sbjct: 323 RDLKPDNILIEQDDPVLVKITDFGLAKVQDNGT---FMKTFCGTLAYVAPEIISGKNDGE 379

Query: 691 YTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPE 750
             +   A   R +     D+WS GC++Y ++ G  P+ G   Q +L   ++   +  Y E
Sbjct: 380 LRENADANSERNEYSSLVDMWSMGCLVYVILTGHLPFSG-STQKQLYKQIS---RGSYHE 435

Query: 751 KTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSV 807
                  +   A D + + L+  P  R + ++ L  P++K    +  F+++   NSV
Sbjct: 436 GPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIKMAQFSQSFVKNNSVNSV 492

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 128/281 (45%), Gaps = 26/281 (9%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           T +++ E++GRG                  +K ++ D  DD  +E  + EI+ L  L+  
Sbjct: 17  TLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDE-VEDVQKEIQFLSSLKQV 75

Query: 572 PRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVH 630
           P +       ++   L+ +ME C    L  TL LR G  +  +++    +E+L  +  +H
Sbjct: 76  PNITHYYGSYLNDTKLWVIMEYCAGGSL-RTL-LRPG-KIGEQYIGVIMRELLTALMHIH 132

Query: 631 DSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
             G++H D+K AN +    G +K+ DFG+A  + +    I R+T  GTP +MAPE ++  
Sbjct: 133 KDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQ--TKIRRQTMAGTPYWMAPEVIMEG 190

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
            Y   +             DIWS G   Y++  G PPY   +    +  I   +   +  
Sbjct: 191 VYYDTK------------VDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEG 238

Query: 750 EKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
            + S+         + +  CL+ +P++R S +++L   F+K
Sbjct: 239 RQHSSA------LKEIIALCLDEDPKERPSAEDLLKTKFIK 273

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 114/242 (47%), Gaps = 26/242 (10%)

Query: 552 DSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLD 611
           DS   G + EI ++ KL   P V++L D    +  LY V+E  +      L +  G   +
Sbjct: 70  DSLSYGIEREI-IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPE 128

Query: 612 VEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIY 670
            E +RF  Q ++  +   H  GIVH DLKP N +    + +KI DFG+A    E  +   
Sbjct: 129 NEAIRFFRQ-IIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKL--- 184

Query: 671 RETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGF 730
            ET  G+P+Y APE +  + Y             G  +D+WSCG I++ ++ GR P+   
Sbjct: 185 LETSCGSPHYAAPEIVSGLPYH------------GLETDVWSCGVILFALLTGRLPFDEE 232

Query: 731 QG--QNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
            G  +N LL +   E ++         D + K A D +   L  +PEKR    E+L  P 
Sbjct: 233 DGNIRNLLLKVQKGEFEM------PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPL 286

Query: 789 VK 790
           ++
Sbjct: 287 LQ 288

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 128/280 (45%), Gaps = 28/280 (10%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           +++ E++GRG                  +K ++ D  D   +E  + EI+ L  L+    
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQISN 81

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           + +     +    L+ +ME C    L     LR G  +D +++    +E+L  +K +H  
Sbjct: 82  ITRYYGSYLKDTSLWIIMEHCAGGSLRS--LLRPGK-IDEKYIGVIMRELLVALKCIHKD 138

Query: 633 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVY 196

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +             DIWS G   Y++  G PPY   +    +  I+  +     P +
Sbjct: 197 YDTK------------VDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSK-----PPR 239

Query: 752 TSNGDVVPKTAIDTMKA-CLERNPEKRWSVDEVLNGPFVK 790
               D    T++    A CL+ +P++R S D++L   F++
Sbjct: 240 LE--DRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIR 277

>TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON}
           Anc_8.482 YPL031C
          Length = 305

 Score = 93.6 bits (231), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 137/310 (44%), Gaps = 51/310 (16%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 6   SQFKQLEKLGNGTYATVYKGLNKTTGIFVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 64

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALR----SGMGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D DL + +  R    S  GL++  V++   ++ + V 
Sbjct: 65  -NIVRLYDVIHTENKLTLVFEYMDKDLKNYMDSRTSGNSTRGLELSLVKYFQWQLFEGVT 123

Query: 628 VVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    T++ T  Y AP+
Sbjct: 124 FCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----TEVVTLWYRAPD 179

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL---LAIMN 741
            L+                     D+WSCGCI+ +MI G+P + G   + +L     IM 
Sbjct: 180 VLMGSR------------SYSTSIDMWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMG 227

Query: 742 PEVKIVYPEKTS-----------------------NGDVVPKTAIDTMKACLERNPEKRW 778
              + ++P  TS                         ++V    ID +   L+ NP+ R 
Sbjct: 228 TPDEQLWPAVTSLPKYNRNLPKKEPKDLKKLLQAHTKEIVDDQVIDLVTGLLQLNPDARL 287

Query: 779 SVDEVLNGPF 788
           +  + L+ P+
Sbjct: 288 TAKQALHHPW 297

>KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 302
           aa] {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 302

 Score = 93.6 bits (231), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 138/310 (44%), Gaps = 51/310 (16%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGIYVALKEVKLDSEEGTPSTAVR-EISLMKELKHE 63

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALR----SGMGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D+DL   +  R    +  G ++  V++   ++L+ V 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQLLQGVA 122

Query: 628 VVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---- 740
            L+                     DIWSCGCI+ +MI GRP + G   + +L  I     
Sbjct: 179 VLMGSR------------TYSTSIDIWSCGCILAEMITGRPLFPGTNDEEQLKLIFETMG 226

Query: 741 ----------------NPEVKIVYPE------KTSNGDVVPKTAIDTMKACLERNPEKRW 778
                           NP +    P+      ++   + +  T ID +   L+ NP++R 
Sbjct: 227 TPTERTWPGVSTLPKYNPRLPQHLPKDLGALLQSQTREKMELTLIDLLYGLLQLNPDRRL 286

Query: 779 SVDEVLNGPF 788
           S  + LN P+
Sbjct: 287 SAKQALNHPW 296

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 87/307 (28%), Positives = 130/307 (42%), Gaps = 38/307 (12%)

Query: 501 NRRKPTIYVNGTEYEKL-ELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFD------DS 553
           NR  PT+  N     KL E LG G +                +K +S   F+      DS
Sbjct: 6   NRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDS 65

Query: 554 SIE---------GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLAL 604
           S+          G + EI ++ KL   P V++L D    +  LY V+E         L +
Sbjct: 66  SVAASTPDSLPYGIEREI-IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124

Query: 605 RSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVP 663
             G   + E +RF  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A    
Sbjct: 125 ERGPLPEKEAIRFFRQ-IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 183

Query: 664 EHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYG 723
           E  +    ET  G+P+Y APE +  + Y             G  SD+WSCG I++ ++ G
Sbjct: 184 EDKL---LETSCGSPHYAAPEIVSGIPYH------------GFASDVWSCGVILFALLTG 228

Query: 724 RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
           R P+    G  R L +     +   P      D +   A D +   L  +PE+R    ++
Sbjct: 229 RLPFDDEDGNIRNLLLQVQSGRYEMP----GDDEISPDAQDLIARILTVDPEQRIKARDI 284

Query: 784 LNGPFVK 790
           L  P ++
Sbjct: 285 LKHPLLQ 291

>KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {ON}
           Anc_3.229 YBR028C
          Length = 502

 Score = 96.3 bits (238), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 113/238 (47%), Gaps = 46/238 (19%)

Query: 564 LLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRFHSQE 621
           +L KLE  P VVKL     DH  LY +++   G     H   L+    LD + V F++ E
Sbjct: 180 ILSKLE-HPNVVKLFYSFHDHSKLYLILQYIPGGELFFH---LKERGTLDEDTVAFYAAE 235

Query: 622 MLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTV-----------NI 669
           +   +K +HD+GIV+ DLKP N +   +G L + DFG++    ++             +I
Sbjct: 236 ISVALKFLHDNGIVYRDLKPENCLLSQRGHLVLTDFGLSKEAVDNVSDNESTELNSPEDI 295

Query: 670 YR-ETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYG 728
           Y   + IGTP Y APE L      QG P  +N        D +S GC+++ M+ G+PPY 
Sbjct: 296 YTLHSIIGTPEYAAPEIL------QGLPYNKN-------CDWYSLGCLLFDMLVGKPPYT 342

Query: 729 GFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMK----ACLERNPEKRWSVDE 782
           G           N +V +   +K   G  +P    D MK      L+++  KRW VD+
Sbjct: 343 G----------TNHKVILNKIQKDKQGPRIPFYLSDGMKDMLNWLLKKDKTKRWDVDK 390

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 127/282 (45%), Gaps = 30/282 (10%)

Query: 513 EYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKP 572
           ++ +  ++GRG                  +K ++ D  D+  +E  + EI+ L  L+  P
Sbjct: 34  KFRRTNVIGRGKFGVVYKGYHLNTKHVYAIKVLNLDS-DEDEVEDVQKEIQFLASLKQLP 92

Query: 573 RVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHD 631
            + +     + +  L+ +ME CG   L     LR G  +D +++    +E+L  +K +H 
Sbjct: 93  NITRYYGSYLKNTSLWIIMEYCGGGSLRS--LLRPG-KIDEKYIGVIMREILIALKYIHK 149

Query: 632 SGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 690
             ++H D+K AN +    G +K+ DFG+A  +  +     R+T  GTP +MAPE ++   
Sbjct: 150 DNVIHRDIKAANVLINNDGSIKLCDFGVAAQL--NQTKSRRQTMAGTPYWMAPEVIMEGV 207

Query: 691 YTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPE 750
           Y   +            +DIWS G   Y++  G PPY   +    +  I   +     P 
Sbjct: 208 YYDTK------------ADIWSTGITAYEVTTGNPPYCDVEALRAMQLIAKSK-----PP 250

Query: 751 KTS--NGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
           +    N   + K  I T   CL+ +P +R + DE+L   F+K
Sbjct: 251 RLEGRNYSALIKEFIAT---CLDEDPSERPTADELLKTAFIK 289

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 97.4 bits (241), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 130/286 (45%), Gaps = 30/286 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSS------IEGFKGEIELLKK 567
            + K E++G+G                  +K++    +   S      +E  K E+  LK 
Sbjct: 1135 WMKGEMIGKGSFGAVFLSLNITTGEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKD 1194

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  EM H +    +E        +L +R     D + +R  + ++L+ + 
Sbjct: 1195 LD-HLNIVQYLGFEMKHNIYSLFLEYVAGGSVGSL-IRMYGRFDDKLIRHLTNQVLEGLS 1252

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + GI KI DFGI+    + + +IY  +++   GT  +MAP
Sbjct: 1253 YLHSQGILHRDMKADNLLLDQDGICKISDFGIS----KKSEDIYSNSEMTMRGTVFWMAP 1308

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GC++ +M  G+ P+  F+    +  I   +
Sbjct: 1309 EMV---DTKQGYNAK---------VDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIGQSK 1356

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
                 PE T   D++  TA + +  C   +P++R +  ++L  PF 
Sbjct: 1357 SAPPIPEDTK--DLISPTAKNFLNQCFHIDPKERPTAGQLLEHPFC 1400

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 110/231 (47%), Gaps = 34/231 (14%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L+KL     + KL     D   LY ++E   H     L  + G  L+    R+++ +++ 
Sbjct: 177 LQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYG-SLNETCARYYASQIID 235

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVN---------IYRETQ 674
            V  +H+ GI+H D+KP N +  K + +K+ DFG A  +PE   N         +Y +++
Sbjct: 236 AVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSK 295

Query: 675 --IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 732
             +GT  Y++PE L+  NYT  +             DIW+ GCI+YQM+ G+PP   F+ 
Sbjct: 296 SFVGTAEYVSPE-LLNDNYTDSR------------CDIWAFGCILYQMLAGKPP---FKA 339

Query: 733 QNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
            N  L      +KI Y          P+   D +K  L R+P  R ++ ++
Sbjct: 340 ANEYLTFQK-VMKIQYAFTAG----FPQIVKDLVKKLLVRDPNDRLTIKQI 385

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 129/281 (45%), Gaps = 26/281 (9%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           T +++ E++GRG                  +K ++ D  DD  +E  + E++ L  L+  
Sbjct: 17  TLFKRTEVIGRGKFGIVYKGYYIKTNRVCAIKVLNLDSADDE-VEDVQKEVQFLSSLKQV 75

Query: 572 PRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVH 630
           P +       +++  L+ +ME C    L  TL LR G  +  +++    +E+L  +  +H
Sbjct: 76  PNITHYYGSYLNNTELWVIMEYCAGGSL-RTL-LRPG-KIGEQYIGVIMRELLIALMHIH 132

Query: 631 DSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
             G++H D+K AN +    G +K+ DFG+A  + +    I R+T  GTP +MAPE ++  
Sbjct: 133 KDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQ--TKIRRQTMAGTPYWMAPEVIMEG 190

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
            Y   +             DIWS G   Y++  G PPY   +    +  I   +   +  
Sbjct: 191 VYYDTK------------VDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEG 238

Query: 750 EKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
            + S+         + +  CL+ +P++R S +E+L   F++
Sbjct: 239 RQHSSA------LKEFIALCLDEDPKERPSAEELLKTKFIR 273

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 111/235 (47%), Gaps = 22/235 (9%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL   P V++L D    +  LY V+E  +      L +  G   + E +R
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  V   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET  
Sbjct: 136 FFRQ-IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETSC 191

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  R
Sbjct: 192 GSPHYAAPEIVSGIPYQ------------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 736 LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
            L +   + +   P    + D V + A D +   L  +P++R    ++L  P ++
Sbjct: 240 TLLLKVQKGQFELP----SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 97.1 bits (240), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 134/300 (44%), Gaps = 42/300 (14%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
            Y  L  +G+G S                +K+++ ++      E    EI ++K+ + K  
Sbjct: 1027 YRNLVKIGQGASGGVYTAYEVGTNASVAVKQMNLEK--QPKTELIINEIIVMKESKHK-N 1083

Query: 574  VVKLIDHEMDHGVLYEVMECGDHD-----LSHTLALRSGMGLDVEFVRFHSQEMLKCVKV 628
            +V  ID  +  G L+ VME  +       ++H +     +G          +E L  +K 
Sbjct: 1084 IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAVC-------RETLNGLKF 1136

Query: 629  VHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 687
            +H  G++H D+K  N +  ++G +K+ DFG    + E  V++ R T +GTP +MAPE + 
Sbjct: 1137 LHSKGVIHRDIKSDNILLSMQGDIKLTDFGFCAQINE--VHLKRTTMVGTPYWMAPEVV- 1193

Query: 688  AMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPEV 744
                        +R + G   DIWS G +I +MI G PPY        L  I     PE+
Sbjct: 1194 ------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPEL 1241

Query: 745  KIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
            K   PEK S+         + + ACL+ +PE R +  E+L    +  +A  +  +  L+K
Sbjct: 1242 K--EPEKLSS------ILHNFLDACLKVDPEVRATATELLETELITEVASENISLAPLVK 1293

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 133/298 (44%), Gaps = 38/298 (12%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           Y+ L  +G+G S                +K+++ ++      E    EI L+ K      
Sbjct: 698 YKNLIKIGQGASGGVYTAYELGTNASVAIKQMNLEK--QPKKELIVNEI-LVMKGSKHNN 754

Query: 574 VVKLIDHEMDHGVLYEVMECGDHD-----LSHTLALRSGMGLDVEFVRFHSQEMLKCVKV 628
           +V  ID  +  G L+ VME  +       ++H +     +G         S+E LK ++ 
Sbjct: 755 IVNFIDSYLFRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGA-------VSRETLKGLQF 807

Query: 629 VHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 687
           +H  G++H D+K  N +  + G +K+ DFG    + E  VN+ R T +GTP +MAPE + 
Sbjct: 808 LHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQINE--VNLKRTTMVGTPYWMAPEVV- 864

Query: 688 AMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVKI 746
                       +R + G   DIWS G +I +MI G PPY        L L   N   K+
Sbjct: 865 ------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKL 912

Query: 747 VYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
             P     G++  K A+  +  CL  +PE R +  ++L  PF+  IA  +  +  L+K
Sbjct: 913 KDP-----GNLSHKMAM-FLNWCLMVDPEDRGTAADLLEDPFITEIAEENTSLAPLVK 964

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/251 (30%), Positives = 115/251 (45%), Gaps = 28/251 (11%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL     V++L D    +  LY V+E  +      L +  G   + E VR
Sbjct: 89  GIEREI-IIMKLLNHTNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLAENEAVR 147

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET  
Sbjct: 148 FFRQ-IIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADFGMAALETEDKL---LETSC 203

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--Q 733
           G+P+Y APE +  + Y             G  +DIWSCG I++ ++ GR P+    G  +
Sbjct: 204 GSPHYAAPEIVSGLPYN------------GLETDIWSCGVILFALLTGRLPFDEEDGNIR 251

Query: 734 NRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK--P 791
           N LL +   E ++         D +   A D +   L  NP++R    E+L  P ++  P
Sbjct: 252 NLLLKVQKGEFEM------PGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLLQKYP 305

Query: 792 IAVTHFFIRDL 802
                  IRDL
Sbjct: 306 NIKDSKTIRDL 316

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 126/279 (45%), Gaps = 26/279 (9%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           Y++ E++GRG                  +K ++ D  +D  +E  + EI+ L  L+  P 
Sbjct: 26  YKRTEVIGRGKFGVVYKGYHIRTKQICAIKVLNLDTSEDE-VEDVQKEIQFLSSLKQVPN 84

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           +       +    L+ +ME C    L  TL LR G  +D +++    +E+L  +  +H  
Sbjct: 85  ITHYYGSYLYDTKLWIIMEYCAGGSL-RTL-LRPG-KIDEKYIGVIMRELLVALLYIHKD 141

Query: 633 GIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            ++H D+K AN +    G +K+ DFG+A  + +   N+ R+T  GTP +MAPE ++   Y
Sbjct: 142 NVIHRDIKAANVLITNDGRVKLCDFGVAAQLTQS--NVRRQTMAGTPYWMAPEVIMEGVY 199

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +             DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 200 YDTK------------VDIWSLGITTYEITTGNPPYCDVEALRAMQLITKSK-----PPR 242

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                  P    + +  CL+ +P++R + +++L   F+K
Sbjct: 243 LEGRQYSPLLK-EFIALCLDEDPKERLAAEDLLKTRFIK 280

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 126/289 (43%), Gaps = 42/289 (14%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           Y+ L  +G+G S                +K+++ ++      E    EI L+ K      
Sbjct: 666 YKSLIKIGQGASGGVYTAYEVGTNASVAIKQMNLEK--QPKKELIINEI-LVMKASKHAN 722

Query: 574 VVKLIDHEMDHGVLYEVMECGDHD-----LSHTLALRSGMGLDVEFVRFHSQEMLKCVKV 628
           +V  ID  +  G L+ VME  +       ++H +     +G         S+E LK ++ 
Sbjct: 723 IVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGA-------VSRETLKGLQF 775

Query: 629 VHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 687
           +H  G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GTP +MAPE + 
Sbjct: 776 LHSKGVIHRDIKSDNILLSMTGEIKLTDFGFCAQINE--INLKRTTMVGTPYWMAPEVV- 832

Query: 688 AMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPEV 744
                       +R + G   DIWS G +I +MI G PPY        L  I     PE+
Sbjct: 833 ------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPEL 880

Query: 745 KIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIA 793
           K        + D +       +  CL  +P++R +  E+L+ PF+   A
Sbjct: 881 K--------DADSLSDDLKGFLGWCLHVDPDERATASELLSDPFIATYA 921

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 126/289 (43%), Gaps = 42/289 (14%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           Y+ L  +G+G S                +K+++ ++      E    EI L+ K      
Sbjct: 667 YKNLIKIGQGASGGVYTAYEVGTNASVAIKQMNLEK--QPKKELIINEI-LVMKASKHAN 723

Query: 574 VVKLIDHEMDHGVLYEVMECGDHD-----LSHTLALRSGMGLDVEFVRFHSQEMLKCVKV 628
           +V  ID  +  G L+ VME  +       ++H +     +G         S+E LK ++ 
Sbjct: 724 IVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGA-------VSRETLKGLQF 776

Query: 629 VHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 687
           +H  G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GTP +MAPE + 
Sbjct: 777 LHSKGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQINE--INLKRTTMVGTPYWMAPEVV- 833

Query: 688 AMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPEV 744
                       +R + G   DIWS G +I +MI G PPY        L  I     PE+
Sbjct: 834 ------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPEL 881

Query: 745 KIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIA 793
           K        + D +       +  CL  NP++R +  ++L+ PF+   A
Sbjct: 882 K--------DADSLSDDLKSFLGWCLHVNPDERATASQLLSDPFISTYA 922

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 136/295 (46%), Gaps = 27/295 (9%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           + + + E++GRG                  +K ++ D   D  +E  + E++ L  L+  
Sbjct: 44  SSFRRTEVIGRGKFGVVYKGYHVKTQQVYAIKVLNLDSESDE-VEDVQREVQFLSSLKQF 102

Query: 572 PRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVH 630
           P +++     +    L+ +M+ C    +  TL LR G  +D +++    +E+L  ++ +H
Sbjct: 103 PNIIRYFGSYLKDTNLWIIMDYCAGGSI-RTL-LRPG-KIDEKYIGIIMREILIALQYIH 159

Query: 631 DSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
              ++H D+K AN +   +G +K+ DFG+A  + +    + R+T  GTP +MAPE ++  
Sbjct: 160 KDNVIHRDIKAANVLVTNEGKVKLCDFGVAAQLNQ--TKLRRQTMAGTPYWMAPEVIMEG 217

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
            Y   +            +DIWS G   Y++  G PPY   +    +  I   +     P
Sbjct: 218 AYYDTK------------ADIWSLGITAYEIATGNPPYCEIEALRAMQLITKSK-----P 260

Query: 750 EKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPI-AVTHFFIRDLI 803
            +   G     +  + +  CL+ +P++R S +E+    F+K   AV    +++LI
Sbjct: 261 ARLE-GRSYSTSLKEFIALCLDEDPKERLSAEELQKTKFIKSQRAVPTTILKELI 314

>KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {ON}
           
          Length = 508

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 120/249 (48%), Gaps = 41/249 (16%)

Query: 548 DEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALR 605
           D+ D+ +IE    E  +L +LE  P +VKL     D   LY +++   G     H   L+
Sbjct: 177 DKPDNKNIERTFAEKTILSELE-HPNIVKLFYSFHDVSKLYLILQYVPGGELFFH---LK 232

Query: 606 SGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIA----- 659
               LD + V F++ E+   +K +HD GIV+ DLKP N +   +G L + DFG++     
Sbjct: 233 EHGTLDEDTVSFYAAEISCALKFLHDKGIVYRDLKPENCLLNDRGHLVLTDFGLSKKSLE 292

Query: 660 -NAVPEHTVNIYR-ETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCII 717
            N +     +++   + IGTP Y APE L      QG P  +N        D +S GC++
Sbjct: 293 DNDMSNQVDDVFTLHSIIGTPEYAAPEIL------QGLPYNKN-------CDWYSLGCLL 339

Query: 718 YQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMK----ACLERN 773
           + M+ G+PPY G           N +V I   +K  NG  +P    + MK      L+++
Sbjct: 340 FDMLVGKPPYTG----------TNHKVIINKIQKDKNGPKIPYYLSEGMKDMLNWLLKKD 389

Query: 774 PEKRWSVDE 782
             KRW VD+
Sbjct: 390 KLKRWQVDK 398

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 114/248 (45%), Gaps = 35/248 (14%)

Query: 564 LLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHD-----LSHTLALRSGMGLDVEFVRFH 618
           L+ K      +V  ID  +  G L+ VME  +       ++H +     +G         
Sbjct: 376 LVMKGSKHSNIVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAVC------ 429

Query: 619 SQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGT 677
            +E LK ++ +H  G++H D+K  N +  + G +K+ DFG    + E  VN+ R T +GT
Sbjct: 430 -RETLKGLQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQINE--VNLKRTTMVGT 486

Query: 678 PNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 737
           P +MAPE +             +R + G   DIWS G +I +MI G PPY        L 
Sbjct: 487 PYWMAPEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALY 533

Query: 738 AI-MNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTH 796
            I  N   K+  PE  S+      T  + +  CL+ +PE R +  E+L+G F+   A  +
Sbjct: 534 LIATNGTPKLKDPENLSD------TLKEFLGWCLKVDPEDRANAAELLSGTFISTYAEKN 587

Query: 797 FFIRDLIK 804
             +  L+K
Sbjct: 588 ECLAPLVK 595

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 115/237 (48%), Gaps = 37/237 (15%)

Query: 561  EIELLKKLETKPR--VVKLIDHEMDHGVLYEVM----ECGDHDLSHTLALRSGMGLDVEF 614
            EI+++  L   P   +++L+D   D    Y       E G  DL   +  ++ M  +VE 
Sbjct: 1090 EIQIMSTLNKHPHDNILRLLDFFEDDDYYYIETPMHGETGCIDLFDLIEFKTNMS-EVE- 1147

Query: 615  VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRET 673
             +    +++  +K +HD GIVH D+K  N +   +G +K+IDFG A  V     +++   
Sbjct: 1148 TKLIFMQVVSSIKFLHDQGIVHRDIKDENVIVDSQGFIKLIDFGSAAYVKSGPFDVF--- 1204

Query: 674  QIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 733
             +GT +Y APE L       G+P       VGKP DIW+ G ++Y +I+   P+      
Sbjct: 1205 -VGTIDYAAPEVL------GGEPY------VGKPQDIWAIGILLYTIIFKENPFYNID-- 1249

Query: 734  NRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                 I+  E+K      TS G    +  +D +K  L RNP KR ++DE+ N  +++
Sbjct: 1250 ----EILEAELKF----NTSTG--ACEDCVDLIKRILTRNPTKRPTIDEIYNDKWLQ 1296

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 113/237 (47%), Gaps = 26/237 (10%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL   P V+ L D    +  LY ++E  +      L +  G   + E +R
Sbjct: 76  GIEREI-IIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLPEKEAIR 134

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  +   H  GIVH DLKP N +    + +KI DFG+A      T +   ET  
Sbjct: 135 FFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAAL---ETKDKMLETSC 190

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--Q 733
           G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  +
Sbjct: 191 GSPHYAAPEIVSGVPYH------------GFQSDVWSCGVILFALLTGRLPFDEEDGNIR 238

Query: 734 NRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
           N LL + + E ++       + D + K A D +   L  +PE+R    ++L  P ++
Sbjct: 239 NLLLKVQSGEYEM------PDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQ 289

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 110/231 (47%), Gaps = 34/231 (14%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L+KL     +++L     D   LY ++E   H     L  + G  L+ +  R+++ +++ 
Sbjct: 177 LQKLNGTKGIIRLFFTFQDEASLYFLLEYASHGDFLGLIKKYG-SLNEKCARYYASQIID 235

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVN---------IYRETQ 674
            V  +H  GI+H D+KP N +  K + +K+ DFG A  +PE   N         +Y  ++
Sbjct: 236 AVDSLHAIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSK 295

Query: 675 --IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 732
             +GT  Y++PE L+  +YT  +             DIW+ GCI+YQM+ G+PP   F+ 
Sbjct: 296 SFVGTAEYVSPE-LLNDSYTDSR------------CDIWAFGCILYQMVAGKPP---FKA 339

Query: 733 QNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
            N  L      +KI Y          P  A D +K  L R P  R +V+++
Sbjct: 340 ANEYLTFQK-VMKIQYAFTAG----FPLIAKDLVKKLLVREPNDRLTVEQI 385

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 115/246 (46%), Gaps = 39/246 (15%)

Query: 552  DSSIEGFKGEIELLKKLETKPR--VVKLIDHEMDHGVLYEVM----ECGDHDLSHTLALR 605
            D  +     EI+++  L  KP   +++L+D   D    Y       E G  DL   +   
Sbjct: 1165 DRKLGTIPSEIQIMATLNKKPHENILRLLDFFEDDEYYYIETPVHGETGSIDLFDLIEFT 1224

Query: 606  SGMGLDVEF-VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVP 663
            S M    EF ++   ++++  VK +HD GIVH D+K  N +   KG +KIIDFG A  V 
Sbjct: 1225 SNM---TEFEIKLLFKQVVSGVKHLHDQGIVHRDIKDENIIVDNKGFIKIIDFGSAAYVK 1281

Query: 664  EHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYG 723
                +++    +GT +Y APE L       G P E      GKP DIW+ G ++Y +++ 
Sbjct: 1282 SGPFDVF----VGTIDYAAPEVL------GGNPYE------GKPQDIWALGILLYTIVFK 1325

Query: 724  RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
              P+           I+  ++K   PE  S      +  I+ +K  L RN  KR ++D++
Sbjct: 1326 ENPFYNID------EILEGDLKFNDPENIS------QDCIELIKLILNRNVFKRPTIDDI 1373

Query: 784  LNGPFV 789
             N  ++
Sbjct: 1374 YNDKWL 1379

>Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa]
           {ON} (32671..32687,32861..33767) [924 nt, 308 aa]
          Length = 307

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 136/311 (43%), Gaps = 53/311 (17%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALR----SGMGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D DL   +  R    S  GL++  V++   ++ + + 
Sbjct: 63  DNIVRLYDVIHTENKLTLVFEYMDKDLKKYMDSRTTGNSPQGLELSLVKYFQWQLFEGIS 122

Query: 628 VVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN--- 741
            L+                     D+WSCGCI+ +M+ G+P + G   + +L  I +   
Sbjct: 179 VLMGSR------------SYSTSIDMWSCGCILAEMLTGKPLFPGTNDEEQLKLIFDMMG 226

Query: 742 -------PEVKIVYPEKTSNGDV-VPK----------------TAIDTMKACLERNPEKR 777
                  P V  + P+  SN  + VPK                  ID +   L+ NP  R
Sbjct: 227 TPTESTWPTVTTL-PKYNSNFSIQVPKDLKKLLQPFTKEQLDDIVIDLLNGLLQLNPSMR 285

Query: 778 WSVDEVLNGPF 788
            S  + L+ P+
Sbjct: 286 LSAKQALHHPW 296

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 112/238 (47%), Gaps = 35/238 (14%)

Query: 574 VVKLIDHEMDHG---VLYEVMECGDHD--LSHTLALRSGMGLDVEFVRFHSQEMLKCVKV 628
           +V  ID  +  G   V+ E ME G     ++H L   + +G          +E L  ++ 
Sbjct: 707 IVNFIDSYLLKGDLWVIMEYMEGGSLTDVVTHCLLTEAQVGA-------VCRETLSGLQF 759

Query: 629 VHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 687
           +H  G++H D+K  N +  ++G +K+ DFG    + E  +N+ R T +GTP +MAPE + 
Sbjct: 760 LHSKGVIHRDIKSDNILLSMRGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWMAPEVV- 816

Query: 688 AMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVKI 746
                       +R + G   DIWS G +I +MI G PPY        L L   N    +
Sbjct: 817 ------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPSL 864

Query: 747 VYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
             PE  S+         + +  CL+ NP++R S  ++L  PF+  IA ++  +  L+K
Sbjct: 865 KEPEALSDA------LNNFLGWCLKVNPDERASAKDLLLDPFITEIADSNESLAPLVK 916

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 111/235 (47%), Gaps = 27/235 (11%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL T P ++ L +   +   LY V+E  +        +  G   + E + 
Sbjct: 110 GIEREI-IIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIH 168

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRETQ 674
           +  Q +++ V   H+  I H DLKP N +  K    +KI DFG+A      T N   ET 
Sbjct: 169 YFKQ-IVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAAL---ETTNRLLETS 224

Query: 675 IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 734
            G+P+Y +PE ++   Y             G PSD+WSCG I++ ++ G  P+     + 
Sbjct: 225 CGSPHYASPEIVMGQKYH------------GSPSDVWSCGIILFALLTGHLPFNDDNVRK 272

Query: 735 RLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
            LL + +   ++      SN   V K A D +   L  +PEKR +VD++L  P +
Sbjct: 273 LLLKVQHGRYQM-----PSN---VSKEAKDLISKILVVDPEKRITVDKILEHPLL 319

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 111/231 (48%), Gaps = 34/231 (14%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L+KL     +++L     D   LY ++E   H     L  + G  L+    R+++ +++ 
Sbjct: 177 LQKLNGTKGIIRLFFTFQDEASLYFLLEYAPHGDFLGLIKKYG-SLNEICARYYASQIID 235

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVN---------IYRETQ 674
            V  +H  GI+H D+KP N +  K + +K+ DFG A  +PE   N         +Y +++
Sbjct: 236 AVDSLHSIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSK 295

Query: 675 --IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 732
             +GT  Y++PE L+  +YT  +             DIW+ GCI+YQM+ G+PP   F+ 
Sbjct: 296 SFVGTAEYVSPE-LLNDSYTDSR------------CDIWAFGCILYQMLAGKPP---FKA 339

Query: 733 QNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
            N  L      +KI Y          P+   D +K  L R+P  R +++++
Sbjct: 340 ANEYLTFQKV-MKIQYAFTAG----FPQIVKDLVKKLLVRDPNDRLAIEQI 385

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 95.1 bits (235), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 72/235 (30%), Positives = 107/235 (45%), Gaps = 22/235 (9%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL   P V++L D       LY V+E  +      L +  G   + E VR
Sbjct: 72  GIEREI-IIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVR 130

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  +   H  GIVH DLKP N +   K  +K+ DFG+A      + +   ET  
Sbjct: 131 FFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAAL---ESKDKLLETSC 186

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           G+P+Y APE +  + Y             G  SD+WSCG I+Y ++ GR P+    G  R
Sbjct: 187 GSPHYAAPEIVSGLPYH------------GFESDVWSCGVILYALLTGRLPFDEEDGNIR 234

Query: 736 LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
            L +     K   P      D +   A D +   L  +PE+R    E+L  P ++
Sbjct: 235 NLLLKVQSGKFEMP----GDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLR 285

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 107/235 (45%), Gaps = 22/235 (9%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL   P V++L D    +  LY V+E  +      L + +G   + E V 
Sbjct: 78  GIEREI-IIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNLLVENGPLPENEAVC 136

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  V   H  GIVH DLKP N +    + +KI DFG+A      T +   ET  
Sbjct: 137 FFRQ-IIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAAL---ETEDKLLETSC 192

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           G+P+Y APE +  + Y             G  SDIWSCG I + ++ GR P+    G  R
Sbjct: 193 GSPHYAAPEIVSGIPYH------------GFASDIWSCGVIFFALLTGRLPFDEEDGNIR 240

Query: 736 LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
            L +     K   P+     D +   A D +   L  +PE R    E+L  P ++
Sbjct: 241 NLLLKVQSGKFEMPDD----DEISPEAQDLLAKILTVDPECRIKPREILKHPLLQ 291

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 72/235 (30%), Positives = 107/235 (45%), Gaps = 22/235 (9%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++K L   P V++L D       LY V+E  +      L +  G   + E VR
Sbjct: 75  GIEREITIMKLL-NHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVR 133

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  +   H  GIVH DLKP N +   K  +K+ DFG+A      + +   ET  
Sbjct: 134 FFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETSC 189

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           G+P+Y APE +  + Y             G  SD+WSCG I+Y ++ GR P+    G  R
Sbjct: 190 GSPHYAAPEIVSGLPYH------------GFESDVWSCGVILYALLTGRLPFDEDDGNIR 237

Query: 736 LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
            L +     +   P+K    D +   A D +   L  +P  R    E+L  P +K
Sbjct: 238 KLLLKVQSGEFEMPDK----DEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288

>NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa]
           {ON} Anc_2.496
          Length = 893

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 109/235 (46%), Gaps = 39/235 (16%)

Query: 564 LLKKLETKPRVVKLIDHEM---DHGVLYEVMECGDHD--LSHTLALRSGMGLDVEFVRFH 618
           L+ K    P +V  ID  +   D  V+ E ME G     ++H +     +G         
Sbjct: 658 LVMKGSRHPNIVNFIDSYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVC------ 711

Query: 619 SQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGT 677
            +E L  ++ +H  G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GT
Sbjct: 712 -RETLSGLQFLHSKGVLHRDIKSDNILLSISGDIKLTDFGFCAQINE--INLKRTTMVGT 768

Query: 678 PNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 737
           P +MAPE +             +R + G   DIWS G +I +MI G PPY        L 
Sbjct: 769 PYWMAPEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALY 815

Query: 738 AIM---NPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
            I     PE+K   PE   N   V +  +D    CL+ +PE+R S  ++LN  F+
Sbjct: 816 LIATNGTPELK--EPE---NLSAVLRNFLD---WCLKVDPEQRASATDLLNDVFI 862

>KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON}
           Anc_8.482 YPL031C
          Length = 302

 Score = 90.1 bits (222), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 84/310 (27%), Positives = 139/310 (44%), Gaps = 51/310 (16%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALR----SGMGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D+DL   +  R    +  GL++  V++   ++L+ + 
Sbjct: 63  DNIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRIVGNTPRGLELHLVKYFQWQLLEGLA 122

Query: 628 VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI---MN 741
            L+                     DIWSCGCI+ +MI G+P + G   + +L  I   M 
Sbjct: 179 VLMGSR------------TYSTSIDIWSCGCILAEMITGKPLFLGSNDEEQLKLIFDTMG 226

Query: 742 PEVKIVYPEKTS----NGDV---VPK----------------TAIDTMKACLERNPEKRW 778
              +  +P  TS    N +    +PK                T ID +   L+ NP+ R 
Sbjct: 227 TPNEATWPGVTSLPKYNANFQQRLPKDLKMILQPYCESPLDDTVIDLLHGLLQLNPDMRL 286

Query: 779 SVDEVLNGPF 788
           S  + L+ P+
Sbjct: 287 SAKQALHHPW 296

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 132/299 (44%), Gaps = 38/299 (12%)

Query: 513 EYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKP 572
           +Y  L  +G+G S                +K+++ ++      E    EI L+ K    P
Sbjct: 598 KYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEK--QPKKELIINEI-LVMKGSKHP 654

Query: 573 RVVKLIDHEMDHG---VLYEVMECGDHD--LSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            +V  ID  +  G   V+ E ME G     ++H +     +G          +E L  +K
Sbjct: 655 NIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVC-------RETLSGLK 707

Query: 628 VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 686
            +H  G++H D+K  N +  ++G +K+ DFG    + E  +N+ R T +GTP +MAPE +
Sbjct: 708 FLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWMAPEVV 765

Query: 687 VAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVK 745
                        +R + G   DIWS G +I +MI G PPY        L L   N   K
Sbjct: 766 -------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 812

Query: 746 IVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
           +  PE  S+     K  +D    CL   PE+R S  E+L+  ++  IA  +  +  L+K
Sbjct: 813 LKEPENLSSSL---KKFLD---WCLCVEPEERASATELLHDEYITEIAEANSSLAPLVK 865

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 94.4 bits (233), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 129/289 (44%), Gaps = 38/289 (13%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDD------SSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V   ++         ++E  + E+  LK 
Sbjct: 1275 WMKGEMIGKGSFGAVYLCLNLTTGEMMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKD 1334

Query: 568  LETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCV 626
            L+    +V+ +  E DH +    +E  G   +   + L      D   +RF + ++L+ +
Sbjct: 1335 LD-HLNIVQYLGFENDHDIYSLFLEYVGGGSVGSLIRLYGR--FDEALIRFLTVQVLEGL 1391

Query: 627  KVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMA 682
              +H  GI+H D+K  N +  + G+ KI DFGI+      + +IY  + +   GT  +MA
Sbjct: 1392 AYLHSKGILHRDMKADNLLLDLDGVCKISDFGIS----RKSKDIYSNSDMTMRGTVFWMA 1447

Query: 683  PEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 742
            PE +   +  QG  A+          DIWS GC++ +M  G+ P+   +    +  I   
Sbjct: 1448 PEMV---DTKQGYSAK---------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKN 1495

Query: 743  EVKIVYPEKTSNGDVVPKTAIDT---MKACLERNPEKRWSVDEVLNGPF 788
            +     PE     D +P  + D    + AC E +P+ R + D++L+ PF
Sbjct: 1496 KSAPPIPE-----DTLPLISQDGRQFLNACFEIDPDLRPTADKLLSHPF 1539

>TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3.177
           YAR019C
          Length = 1295

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 133/296 (44%), Gaps = 30/296 (10%)

Query: 500 YNRRKPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFK 559
           +NR + T +V   +Y  + ++G+G                  +K+V++D  +D  +    
Sbjct: 65  HNRTESTEFVTKAQYGLINVIGKGSFGVVYKAVNRQTNQVIAIKQVNYD--NDEELNDIM 122

Query: 560 GEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFH 618
            EI LLK L  K  +VK          LY ++E C    L + ++  S  G+  +  + +
Sbjct: 123 SEINLLKNLNHK-HIVKYHGFMQKSDTLYILLEYCAHGSLKNLIS--SSKGIPEKDAQQY 179

Query: 619 SQEMLKCVKVVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGT 677
             + L  +  +H  G++H D+K AN +  K   +K+ DFG++  V   T+ +   T  G+
Sbjct: 180 IIQTLYGLVYLHAQGVIHRDIKAANILLDKDNTVKLADFGVSTRVGNATMAM---TLAGS 236

Query: 678 PNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 737
            N+MAPE L       G             SDIWS G  + ++I G PP+      N   
Sbjct: 237 LNWMAPEIL-------GNKG------ASTLSDIWSLGATVVELITGNPPFHNLVDINIYY 283

Query: 738 AIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIA 793
           AI N     + PE         +TAID +  C ++N  +R +  ++LN  +++P+ 
Sbjct: 284 AIENDNY--IPPE-----GAFSETAIDFLNLCFKKNMYRRPTAQQLLNHKWLQPMT 332

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 113/239 (47%), Gaps = 34/239 (14%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L+KL   P VV+L     D   LY ++E   +    +L  + G  LD    R+++ +++ 
Sbjct: 231 LQKLNNSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYG-SLDETCARYYAAQIID 289

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGILKI--IDFGIA-------NAV--PEHTVNIYRET 673
            +  +H +GI+H D+KP N + + G +KI   DFG A       N+V  PE+ ++   ++
Sbjct: 290 AIDYLHSNGIIHRDIKPEN-ILLDGEMKIKLTDFGTAKLLNPTNNSVSKPEYDLSTRSKS 348

Query: 674 QIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 733
            +GT  Y++PE L             N        DIW+ GCI++QMI G+PP   F+  
Sbjct: 349 FVGTAEYVSPELL-------------NDSFTDYRCDIWAFGCILFQMIAGKPP---FKAT 392

Query: 734 NRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPI 792
           N  L      +K+ Y          P    D +K  L +N ++R ++ ++    F K +
Sbjct: 393 NEYLTFQK-VMKVQYAFTPG----FPLIIRDLVKKILVKNLDRRLTISQIKEHHFFKDL 446

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 113/242 (46%), Gaps = 26/242 (10%)

Query: 552 DSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLD 611
           DS   G + EI ++ KL     V+ L D    +  LY ++E  +      L +  G   +
Sbjct: 75  DSLPYGIEREI-IIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPE 133

Query: 612 VEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIY 670
            E VRF  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A    E  +   
Sbjct: 134 KEAVRFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKL--- 189

Query: 671 RETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGF 730
            ET  G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+   
Sbjct: 190 LETSCGSPHYAAPEIVSGIPYH------------GFESDVWSCGVILFALLTGRLPFDEE 237

Query: 731 QG--QNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
            G  +N LL + + + ++       + D + + A D +   L  +P KR    E+L  P 
Sbjct: 238 DGNIRNLLLKVQSGQFEM------PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPL 291

Query: 789 VK 790
           ++
Sbjct: 292 LQ 293

>Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 139/310 (44%), Gaps = 51/310 (16%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSG----MGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D+DL   +  R+      GL++  V++   ++L+ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLA 122

Query: 628 VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H+S I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHESKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL---LAIMN 741
            L+                     DIWSCGCI+ +MI G+P + G   + +L     IM 
Sbjct: 179 VLMGSR------------TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMG 226

Query: 742 PEVKIVYPEKTS----NGDVVPKT-------------------AIDTMKACLERNPEKRW 778
              + ++P  T     N ++  +T                    +D +   L+ NP+ R 
Sbjct: 227 TPNESLWPGVTKLPKYNPNIQQRTPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRL 286

Query: 779 SVDEVLNGPF 788
           S  + L+ P+
Sbjct: 287 SAKQALHHPW 296

>NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 bp,
           311 aa] {ON} Anc_8.482
          Length = 311

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 135/310 (43%), Gaps = 51/310 (16%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGAYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALR----SGMGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D+DL   +  R    S  GL++  V++   ++L+ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEGLA 122

Query: 628 VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI---MN 741
            L+                     DIWSCGCI+ +MI G+P + G   + +L  I   M 
Sbjct: 179 VLMGSR------------TYSTSIDIWSCGCILAEMITGKPLFPGSNDEEQLKLIFETMG 226

Query: 742 PEVKIVYPEKTSNGDVVPK-----------------------TAIDTMKACLERNPEKRW 778
              +  +P  ++     P                          ID +   L+ NP+ R 
Sbjct: 227 TPTEATWPGVSALPKYNPNFPQRLPKDLRMVLQPYCKEPLDDNVIDLLHGLLQLNPDMRL 286

Query: 779 SVDEVLNGPF 788
           S  + L+ P+
Sbjct: 287 SAKQALHHPW 296

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 115/237 (48%), Gaps = 37/237 (15%)

Query: 561  EIELLKKLETKPR--VVKLIDHEMDHGVLYEVM----ECGDHDLSHTLALRSGMGLDVEF 614
            EI+++  L   P   +++L+D   D    Y       E G  DL   +  +S M  + E 
Sbjct: 1160 EIQIMTTLNKSPHENIMQLLDFFEDDDYYYIETPLHGETGCIDLFDLIEFKSNMT-ESE- 1217

Query: 615  VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRET 673
             R    +++  +K +HDS IVH D+K  N +   KG +K+IDFG A  V     +++   
Sbjct: 1218 ARLIFIQVVLGIKHLHDSNIVHRDVKDENVIVDAKGFVKLIDFGSAAYVNSGPFDVF--- 1274

Query: 674  QIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 733
             +GT +Y APE L       G+P       +GKP DIW+ G ++Y +++   P+      
Sbjct: 1275 -VGTIDYAAPEVL------SGEPY------LGKPQDIWAIGILLYTIMFKENPFYNID-- 1319

Query: 734  NRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                 I+  E+KI      +N     +  ID +K  L +NP KR ++DE++N  ++K
Sbjct: 1320 ----EILEAELKI------NNTSDASQDCIDLIKRILTKNPNKRPTIDEIVNDKWLK 1366

>Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 89.7 bits (221), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 139/310 (44%), Gaps = 51/310 (16%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSG----MGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D+DL   +  R+      GL++  V++   ++L+ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLA 122

Query: 628 VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL---LAIMN 741
            L+                     DIWSCGCI+ +MI G+P + G   + +L     IM 
Sbjct: 179 VLMGSR------------TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMG 226

Query: 742 PEVKIVYPEKTS----NGDVVPKT-------------------AIDTMKACLERNPEKRW 778
              + ++P  T     N +V  +T                    +D +   L+ NP+ R 
Sbjct: 227 TPSESLWPAVTKLPKYNPNVQHRTPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRL 286

Query: 779 SVDEVLNGPF 788
           S  + L+ P+
Sbjct: 287 SAKQALHHPW 296

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 112/228 (49%), Gaps = 33/228 (14%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECG-DHDLSHTLALRSGMG-LDVEFVRFHSQEM 622
           L++L     +++L     D   LY ++E   + DL   L+L    G L+ E   ++  ++
Sbjct: 226 LQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDL---LSLMKKFGSLNEECCCYYGAQI 282

Query: 623 LKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIA----NAVPEHTVNIYRETQ--I 675
           +  +K +H  GI+H D+KP N +  K + +KI DFG A    N  P  + ++   ++  +
Sbjct: 283 IDAIKFMHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFV 342

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           GT  Y++PE L+  NYT  +            SDIW+ GCI++QMI G+PP   F+  N 
Sbjct: 343 GTAEYVSPE-LLNDNYTDAR------------SDIWAFGCIVFQMIAGKPP---FKATNE 386

Query: 736 LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
            L      +K+ Y          P    D +K  L + PE+R +++ +
Sbjct: 387 YLTFQK-VMKVQYAFTAG----FPTVVRDLVKRILIKAPEQRLTIEAI 429

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 132/299 (44%), Gaps = 38/299 (12%)

Query: 513 EYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKP 572
           +Y  L  +G+G S                +K+++ ++      E    EI L+ K    P
Sbjct: 621 KYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEK--QPKKELIINEI-LVMKGSRHP 677

Query: 573 RVVKLIDHEMDHG---VLYEVMECGDHD--LSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            +V  ID  +  G   V+ E ME G     ++H +     +G          +E L  +K
Sbjct: 678 NIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVC-------RETLSGLK 730

Query: 628 VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 686
            +H  G++H D+K  N +  ++G +K+ DFG    + E  +N+ R T +GTP +MAPE +
Sbjct: 731 FLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWMAPEVV 788

Query: 687 VAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVK 745
                        +R + G   DIWS G +I +MI G PPY        L L   N   K
Sbjct: 789 -------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 835

Query: 746 IVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
           +  PE  S+     K  +D    CL   PE+R S  E+L+  ++  IA  +  +  L+K
Sbjct: 836 LKEPENLSSSL---KKFLD---WCLCVEPEERASATELLHDEYITEIAEANSSLAPLVK 888

>Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON}
            similar to Ashbya gossypii AFR092W
          Length = 1397

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 131/287 (45%), Gaps = 30/287 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRV------SFDEFDDSSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V      S D+   +++E    E+  LK 
Sbjct: 1098 WIKGEIIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDQITVTNVEALISEVSTLKN 1157

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E  +G+    +E        +L +R     D + +RF ++++L+ + 
Sbjct: 1158 LD-HLNIVQYLGFENKNGIYSLFLEYVAGGSVGSL-IRLYGHFDEQLIRFLTKQVLEGLA 1215

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +    G+ KI D GI+      + NIY   ++   GT  +MAP
Sbjct: 1216 YLHRRGILHRDMKADNLLLDNNGVCKISDLGIS----RKSNNIYSNAEMTMRGTVFWMAP 1271

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   + TQG  A+          DIWS GC++ +M  G+ P+   +    +  I   +
Sbjct: 1272 EMV---DTTQGYSAK---------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSK 1319

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                 PEKT    ++ K     +  C + +PEKR + D +L+ PF +
Sbjct: 1320 TAPPIPEKTL--PLISKDGRVFIDDCFKIDPEKRPTADTLLSHPFCQ 1364

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 122/241 (50%), Gaps = 17/241 (7%)

Query: 554 SIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDV 612
           +I+G   E+E+L++L   PR+V+L     D    Y +ME     DL   +A    +G D 
Sbjct: 227 NIDGVTRELEVLRRL-NHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDA 285

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVNI 669
              R  ++++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      T   
Sbjct: 286 G--REITKQVLEAVKYIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGT--- 340

Query: 670 YRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 729
           + +T  GT  Y+APE +   N    +   QN+ K     D+WS GC++Y ++ G  P+ G
Sbjct: 341 FMKTFCGTLAYVAPEVISGKN---SEDKSQNKNKYSSLVDMWSIGCLVYVILTGHLPFSG 397

Query: 730 FQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
              Q++L   ++   +  Y E       +   A + + + L+ NP+ R + ++ L+ P++
Sbjct: 398 -STQDQLYKQIS---RGSYHEGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWI 453

Query: 790 K 790
           K
Sbjct: 454 K 454

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 132/300 (44%), Gaps = 38/300 (12%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           T+Y  L  +G+G S                +K+++ ++      E    EI L+ K    
Sbjct: 618 TKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEK--QPKKELIINEI-LVMKGSKH 674

Query: 572 PRVVKLIDHEMDHG---VLYEVMECGDHD--LSHTLALRSGMGLDVEFVRFHSQEMLKCV 626
           P +V  ID  +  G   V+ E ME G     ++H +     +G          +E L  +
Sbjct: 675 PNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVC-------RETLSGL 727

Query: 627 KVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEA 685
           + +H  G++H D+K  N +  ++G +K+ DFG    + E  +N+ R T +GTP +MAPE 
Sbjct: 728 EFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWMAPEV 785

Query: 686 LVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEV 744
           +             +R + G   DIWS G +I +MI G PPY        L L   N   
Sbjct: 786 V-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTP 832

Query: 745 KIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
           K+  PE  S+     K  +D    CL   PE R S  E+L+  ++  IA  +  +  L+K
Sbjct: 833 KLKEPENLSSS---LKKFLD---WCLCVEPEDRASATELLHDEYITEIAEANSSLAPLVK 886

>TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {ON}
           Anc_3.229 YBR028C
          Length = 629

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 115/256 (44%), Gaps = 51/256 (19%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDV 612
           IE    E  +L +LE  P +VKL     D   LY +++   G     H   L+    LD 
Sbjct: 224 IERTFAERTILSELE-HPNIVKLFYSFRDDSKLYLLLQYIPGGELFYH---LKEQGTLDE 279

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGI------------- 658
           + V F++ E+   +K +H+ GIV+ DLKP N +   KG L + DFG+             
Sbjct: 280 DTVAFYAAEISCALKFLHEKGIVYRDLKPENCLLNEKGHLVLTDFGLSKKSLSESRTPSA 339

Query: 659 ----ANAVPEHTVNIYRETQ--------IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGK 706
               A  +     +I  E +        IGTP Y APE L+      GQP  QN      
Sbjct: 340 VDLKAKLISNEDYSIVSEEEDVVALHSIIGTPEYCAPEILM------GQPYTQN------ 387

Query: 707 PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTM 766
             D +S GC+IY M+ G+PP+ G   +  L  I   +V    P   S+G        D +
Sbjct: 388 -CDWYSLGCLIYDMLVGKPPFTGNNHKVILNKIQKEKVGPKIPYYLSDG------MKDML 440

Query: 767 KACLERNPEKRWSVDE 782
            A L+++  KRW+VD+
Sbjct: 441 GALLKKDNSKRWNVDK 456

>Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {ON}
           YBR028C - Hypothetical ORF [contig 184] FULL
          Length = 515

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 135/308 (43%), Gaps = 58/308 (18%)

Query: 564 LLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRFHSQE 621
           +L +LE  P +VKL     DH  LY +++   G     H   L+    LD + V F++ E
Sbjct: 190 ILSQLE-HPNIVKLFYSFHDHHKLYLILQFIPGGELFYH---LKEQGTLDEDTVAFYAAE 245

Query: 622 MLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIA------NAVPEHTVN------ 668
           +   ++ +H  G+V+ DLKP N +   +G L + DFG++      ++     VN      
Sbjct: 246 ISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDSADGGDVNTNGHEG 305

Query: 669 ---IYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRP 725
                  + IGTP Y APE L      +G+P  QN        D +S GC+I+ M+ G+P
Sbjct: 306 ESVCTLHSIIGTPEYCAPEIL------EGKPYTQN-------CDWYSLGCLIFDMLIGKP 352

Query: 726 PYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLN 785
           PY G   +  L  I+  ++  + P   S G        D + A L+++  KRW VD+  N
Sbjct: 353 PYTGVNHKVILNKILKDKIPKI-PSYLSEG------MKDFLAALLKKDVTKRWDVDKFWN 405

Query: 786 --GPFVKPIAV---------THFFIRDLIKNSVKYGANQREISNEKI-----EELAEDVW 829
             GP +K              HF  R +    ++ G  QR      +      ELAE+  
Sbjct: 406 TDGPKLKKKKAGQAKTTSFQAHFVFRKISWLKMETGELQRNTEGPILPIITDWELAENFD 465

Query: 830 HRLADFRL 837
               + RL
Sbjct: 466 SEFTEMRL 473

>CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031c cyclin-dependent protein kinase
          Length = 302

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/316 (25%), Positives = 139/316 (43%), Gaps = 57/316 (18%)

Query: 509 VNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKL 568
           ++ +++++LE LG G  +               LK V  D  + +     + EI L+K+L
Sbjct: 1   MSSSQFKQLEKLGNGTYATVYKGLNKSTGVYVALKEVKLDSEEGTPSTAIR-EISLMKEL 59

Query: 569 ETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSG----MGLDVEFVRFHSQEMLK 624
           +    +V+L D       L  V E  D+DL   +  R+      GL++  V++   ++L+
Sbjct: 60  K-HDNIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLE 118

Query: 625 CVKVVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANA--VPEHTVNIYRETQIGTPNYM 681
            +   H++ I+H DLKP N +  K G LK+ DFG+A A  +P +T +    +++ T  Y 
Sbjct: 119 GLAFCHENKILHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYR 174

Query: 682 APEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 741
           AP+ L+                     DIWSCGCI+ +MI G+P + G   + +L  I +
Sbjct: 175 APDVLMGSR------------TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFD 222

Query: 742 PEVKIVYPEKTSNGDV--VPK---------------------------TAIDTMKACLER 772
              K+  P +T+   V  +PK                             ID +   L+ 
Sbjct: 223 ---KMGTPNETTWPGVTSLPKYNPNFQQRLPKDLKAELQPYVKEPLDDNVIDLLHGLLQL 279

Query: 773 NPEKRWSVDEVLNGPF 788
           NP+ R S  + L  P+
Sbjct: 280 NPDMRLSAKQALLHPW 295

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 129/285 (45%), Gaps = 30/285 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDD------SSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V   ++        S++E  + E+  LK 
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1234

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E  + +    +E        +L +R     D   ++  + ++LK + 
Sbjct: 1235 LD-HLNIVQYLGFENKNNIYSLFLEYVAGGSVGSL-IRMYGRFDEPLIKHLTTQVLKGLA 1292

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + GI KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1293 YLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1348

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GCI+ +M  G+ P+   +    +  I   +
Sbjct: 1349 EMV---DTKQGYSAK---------VDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1396

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
                 PE T    ++ +   + + AC E NPEKR + +E+L+ PF
Sbjct: 1397 SAPPIPEDTL--PLISQIGRNFLDACFEINPEKRPTANELLSHPF 1439

>KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON}
           Anc_8.482 YPL031C
          Length = 306

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/312 (25%), Positives = 137/312 (43%), Gaps = 51/312 (16%)

Query: 510 NGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLE 569
           +G+++++LE LG G  +               LK V  D  + +     + EI L+K+L+
Sbjct: 3   SGSQFKQLEKLGNGTYATVYKGLNKTTGEFVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 570 TKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSG----MGLDVEFVRFHSQEMLKC 625
            +  +V+L D       L  V E  D DL   +  R+     +GL++  V++   ++L+ 
Sbjct: 62  HE-NIVRLYDVIHTENKLTLVFEYMDKDLKKYMDSRTVGNAPVGLELHLVKYFQWQLLEG 120

Query: 626 VKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 682
           +   H++ I+H DLKP N +   KG LKI DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHENKILHRDLKPQNLLINKKGQLKIGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 683 PEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN- 741
           P+ L+                     DIWSCGCI+ +MI G+P + G   + +L  I   
Sbjct: 177 PDVLMGSR------------TYSTSIDIWSCGCILAEMITGKPLFPGTNEEEQLKLIFET 224

Query: 742 ---------------PEVKIVYPE----------KTSNGDVVPKTAIDTMKACLERNPEK 776
                          P+    +P+          +      +  T I  +   L+ NP+ 
Sbjct: 225 MGTPNEQSWPGISSLPKYNPGFPQHLPKNLKSILQAHCASDLDDTLIALLHGLLQLNPDM 284

Query: 777 RWSVDEVLNGPF 788
           R S  + L+ P+
Sbjct: 285 RLSAKQALHHPW 296

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/300 (28%), Positives = 130/300 (43%), Gaps = 42/300 (14%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           Y  L  +G+G S                +K+++ ++      E    EI L+ K    P 
Sbjct: 627 YTNLVKIGQGASGGVYIANDVSTNESIAIKQMNLEK--QPKKELIINEI-LVMKGSKHPN 683

Query: 574 VVKLIDHEM---DHGVLYEVMECGDHD--LSHTLALRSGMGLDVEFVRFHSQEMLKCVKV 628
           +V  ID  +   D  V+ E ME G     ++H +     +G          +E L  ++ 
Sbjct: 684 IVNFIDSYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGA-------VCRETLSGLQF 736

Query: 629 VHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 687
           +H  G++H D+K  N +  + G +K+ DFG    V E T  + R T +GTP +MAPE + 
Sbjct: 737 LHSKGVLHRDIKSDNILLSINGNIKLTDFGFCAQVNETT--LKRTTMVGTPYWMAPEVV- 793

Query: 688 AMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPEV 744
                       +R + G   DIWS G +I +MI G PPY        L  I     PE+
Sbjct: 794 ------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPEL 841

Query: 745 KIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
           K    E+    DV+ K  +D    CL  NP++R S  E+L   F+   A  +  +  L+K
Sbjct: 842 K----EREKLSDVL-KHFLD---WCLSVNPDQRASATELLEDVFITEYADANESLAPLVK 893

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 129/279 (46%), Gaps = 26/279 (9%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           +++ E++GRG                  +K ++ D  +D  +E  + EI+ L  L+  P 
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVLNLDCPEDE-VEDVQKEIQFLASLKQVPN 83

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           + +     +    L+ +ME C    L  TL LR G  +D +++    +++L  +  +H  
Sbjct: 84  ITRYYGSYLYDTKLWVIMEYCAGGSL-RTL-LRPGK-IDEKYLGVIVRKLLIALVYIHKD 140

Query: 633 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            ++H D+K AN +   +G +K+ DFG+A  +     N  R+T  GTP +MAPE ++   Y
Sbjct: 141 NVIHRDIKAANVLITNEGHVKLCDFGVAAQL--TAANHKRQTMAGTPYWMAPEVIMEGVY 198

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +            +DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 199 YNTK------------ADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSK-----PPR 241

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
               +  P    + +  CL+ +PE+R + +++L+  FVK
Sbjct: 242 LEGRNYSPLLK-EFIALCLDEDPEERPTAEDLLSSKFVK 279

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 125/289 (43%), Gaps = 48/289 (16%)

Query: 513 EYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKP 572
           +Y  L  +G+G S                +K+++F++      E    EI L+ K     
Sbjct: 564 KYVNLIKIGQGASGGVYTATDVNTEASVAIKKMNFEK--QPKKELIVNEI-LVMKASRHE 620

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDV--------EFVRFHSQEMLK 624
            +V  ID    +G L+ +ME           ++ G   DV        + +   ++E L 
Sbjct: 621 NIVNFIDSYFLNGNLWVIMEY----------MKGGSLTDVVTHCILTEQQISTVTRETLN 670

Query: 625 CVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAP 683
            ++ +H  G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GTP +MAP
Sbjct: 671 GLRFLHSKGVIHRDIKSDNVLLSLSGDIKLTDFGFCAQINE--INLKRTTMVGTPYWMAP 728

Query: 684 EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM--- 740
           E +             +R + G   DIWS G +I +MI G PPY        L  I    
Sbjct: 729 EVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNG 775

Query: 741 NPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
            PE+K        + D + +     +  CL+ +P +R S  E+LN  F+
Sbjct: 776 TPELK--------DPDSLSECLKAFLDWCLKVDPHERASATELLNDRFI 816

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 134/301 (44%), Gaps = 30/301 (9%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDD------SSIEGFKGEIELLKK 567
            + K EL+G+G                  +K+V   EF        S++E  + E+ LLK 
Sbjct: 1338 WVKGELIGKGSFGSVYLSLNVTTGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEVTLLKD 1397

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E  + +    +E        +L +R     D   +R  + ++L  + 
Sbjct: 1398 LD-HINIVQYLGFEKKNNIYSLFLEYVAGGSIGSL-IRMYGRFDESLIRHSTTQILAGLS 1455

Query: 628  VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +   +GI KI DFGI+      + +IY  +++   GT  +MAP
Sbjct: 1456 YLHSKGILHRDMKADNILLDGEGICKISDFGIS----RKSKDIYSNSEMTMRGTVFWMAP 1511

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GCII +M  G+ P+   +    +  I   +
Sbjct: 1512 EMV---DTKQGYSAK---------VDIWSLGCIILEMFAGKRPWSNLEVVAAMFKIGQSK 1559

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLI 803
                 PE T    ++ +   D +  C + +PEKR + +++L+  F +      F   DL+
Sbjct: 1560 SAPPIPEDTL--PLISQDGRDFLDDCFKIDPEKRPTAEQMLDHLFSQVDPNFDFSSTDLV 1617

Query: 804  K 804
            K
Sbjct: 1618 K 1618

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 133/287 (46%), Gaps = 30/287 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSF------DEFDDSSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V        +E   ++++  + E+  LK 
Sbjct: 1140 WMKGEMIGKGSFGAVFLAMNITTGEMMAVKQVEVPKYGLQNETVVNTVDALRLEVSTLKD 1199

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E  +G+    +E        +L    G   D+  +R  + ++L+ + 
Sbjct: 1200 LD-HLNIVQYLGFEAKNGIYSLFLEYVAGGSVGSLIRMYGRFDDI-LIRHLTIQVLQGLS 1257

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + G+ KI DFGI+      + +IY  +++   GT  +MAP
Sbjct: 1258 YLHSRGILHRDMKADNLLLDQDGVCKISDFGIS----RKSNDIYSNSEMTMKGTVFWMAP 1313

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GCI+ +M  G+ P+  F+    +  I   +
Sbjct: 1314 EMV---DTKQGYSAKV---------DIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGQAK 1361

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                 PE T    ++ + A + +  C E +PEKR + D++L+ PF K
Sbjct: 1362 SAPPIPEDTL--PLISENAKEFLDCCFEIDPEKRPTADKLLSHPFSK 1406

>NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559)
           [2241 bp, 746 aa] {ON} Anc_2.352 YDL101C
          Length = 746

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 122/278 (43%), Gaps = 28/278 (10%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           Y KL+ +G G S                +K++  D      ++    E+ +LK+ +  P 
Sbjct: 469 YRKLKRIGEGASGIVYTAYEIGTDISVAIKQI--DLKIQPRLQMIWTEMLVLKEYQ-HPN 525

Query: 574 VVKLIDHEMDHGVLYEVMECGDHDLSHTLA-LRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           ++  I+  + H  L+ VME  D     +LA + S      E +    +E L  +  +H  
Sbjct: 526 IINFINSYLLHDTLWIVMEYMD---GGSLADIVSFFTPTEEQMATICRETLFGLNFLHSR 582

Query: 633 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
           GIVH D+K  N +  + G +KI DFG    + E   N  R T +GTP +MAPE + +  Y
Sbjct: 583 GIVHRDIKSDNILLSMNGDIKITDFGFCGQLTES--NTKRTTMVGTPYWMAPEVIASKEY 640

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
                        G   D+WS G +I +MI G PPY   +   R L ++    K +  E 
Sbjct: 641 -------------GPKVDVWSLGIMIIEMIEGEPPY-LHETPVRALYLITTNGKPILKEP 686

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
              G V+     + M  CL  +PE R S  ++L   F+
Sbjct: 687 EKVGPVLK----NFMDECLRVDPEARLSTPQLLKHEFI 720

>NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa]
           {ON} Anc_3.229
          Length = 509

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 116/250 (46%), Gaps = 49/250 (19%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDV 612
           IE    E  +L +LE  P +VKL     D+  LY +++   G     H   L+    LD 
Sbjct: 179 IERTFAEKSILAELE-HPNIVKLFYSFHDNSKLYLLLQYIPGGELFFH---LKEQGTLDE 234

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIA-NAVPEHTVNIY 670
           + V F++ E+   +K +HD GIV+ DLKP N +   KG L + DFG++  +V +++ N  
Sbjct: 235 DTVAFYAAEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPS 294

Query: 671 RETQ--------------IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCI 716
             T               IGTP Y APE L      QG P  +N        D +S GC+
Sbjct: 295 EVTSLNEPSEDLSTLHSIIGTPEYCAPEIL------QGLPYNKN-------CDWYSLGCL 341

Query: 717 IYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMK----ACLER 772
           IY M+ G+PPY G           N +V +   +K   G  +P    + MK      L++
Sbjct: 342 IYDMLSGKPPYTG----------ANHKVILNKIQKDKQGPKIPYYLSEGMKDMLNWLLKK 391

Query: 773 NPEKRWSVDE 782
           +  KRW VD+
Sbjct: 392 DQSKRWDVDK 401

>ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 304

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 137/310 (44%), Gaps = 51/310 (16%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSG----MGLDVEFVRFHSQEMLKCVK 627
             VV+L D       L  V E  D+DL   +  R+      GL++  V++   ++++   
Sbjct: 63  DNVVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELNLVKYFQWQLMEGAA 122

Query: 628 VVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN--- 741
            L+                     D+WSCGCI+ +M+ G+P + G   + +L  I +   
Sbjct: 179 VLMGSR------------TYSTSIDMWSCGCILAEMVTGKPLFPGTNDEEQLKLIFDIMG 226

Query: 742 -------------PEVKIVYPEK----------TSNGDVVPKTAIDTMKACLERNPEKRW 778
                        P+  + +P+K            + + +    ID +   L+ NP+ R 
Sbjct: 227 TPNESTWPGVSSLPKFNLNFPQKLPRDLRSILQVCSKEPLDDNLIDLLHGLLQLNPDMRL 286

Query: 779 SVDEVLNGPF 788
           S  + L+ P+
Sbjct: 287 SAKQALHHPW 296

>AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR073C
            (SSK22) and YNR031C (SSK2)
          Length = 1483

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/249 (28%), Positives = 117/249 (46%), Gaps = 27/249 (10%)

Query: 558  FKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVR 616
             + E+ +L+ L   P VV+    E+    +   ME C    L+  LA   G   D    +
Sbjct: 1237 IRDEMTVLEML-NHPNVVQYYGVEVHRDRVNIFMEYCEGGSLASLLA--HGRIEDEMVTQ 1293

Query: 617  FHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEH---TVNIYR- 671
             +S +ML+ +  +H+SG+ H D+KP N +    GI+K +DFG A  +  +    +N+ + 
Sbjct: 1294 VYSLQMLEGLAYLHESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQH 1353

Query: 672  ---ETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYG 728
               E  IGTP YM+PEA+    Y           K G   DIWS GC+I +M+ GR P+ 
Sbjct: 1354 MEGEKMIGTPMYMSPEAISGTGYG----------KFGS-DDIWSLGCVILEMVTGRRPWA 1402

Query: 729  GFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
                Q  ++  +      ++P K      + +  I  +  CL ++P +R +  E+L  P+
Sbjct: 1403 NLDNQWAIIYQVAAGQIPMFPSKNE----MSQAGIKFLSRCLIQDPNQRSTAVELLMDPW 1458

Query: 789  VKPIAVTHF 797
            +  I    F
Sbjct: 1459 IIEIRTIAF 1467

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 110/232 (47%), Gaps = 36/232 (15%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMG-LDVEFVRFHSQEML 623
           L+KL     +++L     D   LY ++E   H     LAL    G L+ +  R+++ +++
Sbjct: 176 LQKLNGTKGIIRLFFTFQDEASLYFLLEYAPH--GDFLALIKKYGSLNEQCARYYASQII 233

Query: 624 KCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEH-----------TVNIYR 671
             V  +H  GI+H D+KP N +  K + +K+ DFG A  +PE             +N   
Sbjct: 234 DAVDSLHTIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEEPSNDADGKPCFDLNARS 293

Query: 672 ETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQ 731
           ++ +GT  Y++PE L+  +YT  +             DIW+ GCI++QM+ G+PP   F+
Sbjct: 294 KSFVGTAEYVSPE-LLNDSYTDSR------------CDIWAFGCILFQMVAGKPP---FK 337

Query: 732 GQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
             N  L      +KI Y          P+   D +K  L + P  R +++++
Sbjct: 338 ASNEYLTFQKV-MKIQYAFTAG----FPQIIKDLVKKLLVKEPNDRLTIEQI 384

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 123/244 (50%), Gaps = 21/244 (8%)

Query: 553 SSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLD 611
            +++G   E+++L+KL+  PR+V+L     D    Y +ME     DL   +A    +G D
Sbjct: 231 GNMDGVTRELDVLRKLD-HPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGED 289

Query: 612 VEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 668
               R  ++++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      T  
Sbjct: 290 AG--REITRQILEAVKYIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT-- 345

Query: 669 IYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPS--DIWSCGCIIYQMIYGRPP 726
            + +T  GT  Y+APE +   N      AE+N  ++   S  D+WS GC++Y ++ G  P
Sbjct: 346 -FMKTFCGTLAYVAPEVIGGKN-----SAEENEDRIEYSSLVDMWSIGCLVYVILTGHLP 399

Query: 727 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNG 786
           + G   Q++L   +    +  Y E       +   A D + + L+ +P KR +  + LN 
Sbjct: 400 FSG-STQDQLYKQI---CRGSYHEGPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNH 455

Query: 787 PFVK 790
           P++K
Sbjct: 456 PWIK 459

>Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa]
           {ON} complement(128841..130379) [1539 nt, 513 aa]
          Length = 512

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 110/242 (45%), Gaps = 46/242 (19%)

Query: 560 GEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRF 617
            E  +L  LE  P +VKL     D   LY +++   G     H   L+    L  + V F
Sbjct: 187 AEKTILSDLE-HPNIVKLFYAFHDESKLYLLLQYIPGGELFFH---LKEHGTLQEDTVAF 242

Query: 618 HSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQ-- 674
           ++ E+   +K +H  GIV+ DLKP N +   +G L + DFG++    E   ++  + +  
Sbjct: 243 YTAEISCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKIAVEQNEDVGEDHEAE 302

Query: 675 ----------IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGR 724
                     IGTP Y APE L      QG P  QN        D +S GC+IY M+ G+
Sbjct: 303 GENITELYSIIGTPEYCAPEIL------QGLPYSQN-------CDWYSLGCLIYDMLIGK 349

Query: 725 PPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMK----ACLERNPEKRWSV 780
           PPY G          +N ++ +   +K   G  +P    D MK    A L++  +KRW V
Sbjct: 350 PPYTG----------VNHKIILNKIQKDKQGPKLPYYLSDGMKDVLGALLKKESKKRWDV 399

Query: 781 DE 782
           D+
Sbjct: 400 DQ 401

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 110/239 (46%), Gaps = 32/239 (13%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L++L     +VKL     D   LY ++E   +    ++  + G  L  +  R++S +++ 
Sbjct: 234 LQRLNNSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYG-SLSEDCTRYYSAQIID 292

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAV---------PEHTVNIYRETQ 674
            +K +H  GI+H D+KP N +  K + +KI DFG A  +         PE  +    ++ 
Sbjct: 293 GIKYLHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSF 352

Query: 675 IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 734
           +GT  Y++PE L             N   V    DIW+ GC+++QMI G+PP   F+  N
Sbjct: 353 VGTAEYVSPELL-------------NDSYVDARCDIWAFGCMVFQMIAGKPP---FKATN 396

Query: 735 RLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIA 793
             L      +K+ Y          P    D +K  L + PE+R ++ ++    F K I+
Sbjct: 397 EYLTFQKV-MKVQYAFTAG----FPVVVRDLVKRILLKVPEQRLTIPQIEKHHFYKDIS 450

>Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {ON}
           similar to Ashbya gossypii AEL083W
          Length = 537

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 112/242 (46%), Gaps = 40/242 (16%)

Query: 560 GEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRF 617
            E  +L +LE  P +VKL     DH  LY +++   G     H   L+    LD   V F
Sbjct: 213 AERSILSQLE-HPNIVKLFYSFHDHHRLYLLLQYIPGGELFYH---LKEQGTLDETTVAF 268

Query: 618 HSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANA--------VPEHTVN 668
           ++ E+   +K +H  GIV+ DLKP N +   +G L + DFG++          +   +VN
Sbjct: 269 YAAELSCALKFLHGKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVHQPDYPISGESVN 328

Query: 669 -IYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 727
            +Y  + IGTP Y APE L  + YTQ               D +S G + Y M+ G+PP+
Sbjct: 329 ELY--SIIGTPEYCAPEILEGLPYTQN-------------CDWYSLGSLAYDMLIGKPPF 373

Query: 728 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLN-- 785
            G      +L+ +  E  +  P   S+G        D + A L+++  KRW VD   N  
Sbjct: 374 TGIN-HKVILSKIQREKSVKLPSYLSDG------MKDYLNALLKKDTLKRWDVDIFWNKE 426

Query: 786 GP 787
           GP
Sbjct: 427 GP 428

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 111/237 (46%), Gaps = 26/237 (10%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL   P V++L D       LY V+E  +      L ++ G   + E VR
Sbjct: 74  GIEREI-IIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVR 132

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  +   H  GIVH DLKP N +   K  +K+ DFG+A      + +   ET  
Sbjct: 133 FFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETSC 188

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--Q 733
           G+P+Y APE +  + Y             G  SD+WSCG I+Y ++ GR P+    G  +
Sbjct: 189 GSPHYAAPEIVSGLPYH------------GFESDVWSCGVILYALLTGRLPFDEEDGNIR 236

Query: 734 NRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
           N LL + + + +I         D +   A D +   L   PE+R    E+L  P ++
Sbjct: 237 NLLLKVQSGKYEI------PGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 129/280 (46%), Gaps = 28/280 (10%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           +++ E++G G                  +K ++ D  D+  +E  + E++ L  ++  P 
Sbjct: 29  FKRTEVIGTGKFGVVYKGHHARTKQVYAIKVLNLDS-DEDEVEDVQREVQFLASMKQTPN 87

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           +       +    L+ ++E C    L  TL LR G  +D +++    +E+L  +K +H  
Sbjct: 88  ITHYYGSYLKDTTLWIIIEYCAGGSL-RTL-LRPG-KIDEKYIGIIMREVLIALKYIHKD 144

Query: 633 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV-AMN 690
            ++H D+K AN +   +G +K+ DFG+A  + + +  + R+T  GTP +MAPE ++  ++
Sbjct: 145 NVIHRDIKAANVLITNEGHVKLCDFGVAAQLNQSS--LKRQTMAGTPYWMAPEVIMEGVS 202

Query: 691 YTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPE 750
           Y           KV    DIWS G   Y++  G PPY   +    +  I   +     P 
Sbjct: 203 YDT---------KV----DIWSLGITTYEIATGNPPYCDVEALRAMQLITKSK-----PP 244

Query: 751 KTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
           +       P    + +  CL+ +P++R S D++L    +K
Sbjct: 245 RLEGRHYSPMLK-EFIALCLDEDPKERLSADDLLKSKLIK 283

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 131/286 (45%), Gaps = 33/286 (11%)

Query: 518 ELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKL 577
           E +GRG                  +K V  +  ++  +E    EI  L +L++ P ++  
Sbjct: 26  ECVGRGNFGDVYRAIDRTTNKVVAIKVVDLENTNER-LEVLAQEIFFLAELKS-PYIINY 83

Query: 578 IDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVH 636
           I   ++   ++ VME CG    S  L      GL  + V + ++E+LK ++ +H+   +H
Sbjct: 84  ITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLHEQKKIH 143

Query: 637 SDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQ 695
            D+K AN +   +G +K+ DFG++  +      + R T +GTP +MAPE           
Sbjct: 144 RDIKAANILLTEEGHVKLGDFGVSGQLKS---TLRRGTIVGTPYWMAPEV---------- 190

Query: 696 PAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN----PEVKIVYPEK 751
            A QN     +  DIWS G  +++++ G PP        R+LA ++    P ++  Y + 
Sbjct: 191 -ASQNIEGYDEKIDIWSLGITVFELLKGVPPLVKLDPI-RVLANLSRKSAPRLQGAYSD- 247

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHF 797
                     A   +  CL +NP +R +  ++L  PFV+ I VT+ 
Sbjct: 248 ---------AAKSFVALCLIKNPNERPAAVDLLKFPFVRFITVTNL 284

>Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON}
           YHL007C (REAL)
          Length = 980

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 132/299 (44%), Gaps = 38/299 (12%)

Query: 513 EYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKP 572
           +Y  L  +G+G S                +K+++ ++      E    EI L+ K    P
Sbjct: 660 KYASLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEK--QPKKELIINEI-LVMKGSKHP 716

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHD-----LSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            +V  ID  +  G L+ +ME  +       ++H +     +G          +E L  +K
Sbjct: 717 NIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVC-------RETLSGLK 769

Query: 628 VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 686
            +H  G++H D+K  N +  ++G +K+ DFG    + E  +N+ R T +GTP +MAPE +
Sbjct: 770 FLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWMAPEVV 827

Query: 687 VAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVK 745
                        +R + G   DIWS G +I +MI G PPY        L L   N   K
Sbjct: 828 -------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 874

Query: 746 IVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
           +  PE  S+     K  +D    CL   PE+R S  ++L+  ++  IA  +  +  L+K
Sbjct: 875 LKEPENLSS---YLKKFLD---WCLCVEPEERASATDLLHDEYITEIAEANSTLAPLVK 927

>KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3.92
           YDR490C
          Length = 1095

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 110/241 (45%), Gaps = 35/241 (14%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L+++   P VV+L     D   LY ++E   +    +L  + G  L+ +  +++S +++ 
Sbjct: 199 LQRVNDSPMVVRLFFTFQDEASLYFLLEFAPNGDFLSLMKKFG-SLNEDAAKYYSAQIID 257

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAV------------PEHTVNIYR 671
            +  +H  GIVH D+KP N +  K   +KI DFG A  +            PE+ +    
Sbjct: 258 AIGFLHSRGIVHRDMKPENILLDKNWKIKITDFGTAKILEKTAQQEAGGSGPEYNLLTRS 317

Query: 672 ETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQ 731
           ++ +GT  Y++PE L             N   V    DIW+ GCI+YQM+ G+PP   F+
Sbjct: 318 KSFVGTAEYVSPELL-------------NDSFVDYRCDIWAFGCIVYQMLAGKPP---FK 361

Query: 732 GQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKP 791
             N  L      +K+ Y          P    D +K  L ++ +KR +V ++    F K 
Sbjct: 362 ATNEYLTFQK-VMKVQYAFTAG----FPLVIRDLVKRILVKDLDKRLTVQQIQRHHFFKG 416

Query: 792 I 792
           +
Sbjct: 417 V 417

>YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,
           305 aa] {ON}  PHO85Cyclin-dependent kinase, with ten
           cyclin partners; involved in regulating the cellular
           response to nutrient levels and environmental conditions
           and progression through the cell cycle
          Length = 305

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 135/310 (43%), Gaps = 51/310 (16%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSG----MGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D+DL   +  R+      GL++  V++   ++L+ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLA 122

Query: 628 VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +  K G LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL---LAIMN 741
            L+                     DIWSCGCI+ +MI G+P + G   + +L     IM 
Sbjct: 179 VLMGSR------------TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMG 226

Query: 742 PEVKIVYPEKTSNGDVVPKT-----------------------AIDTMKACLERNPEKRW 778
              + ++P  T      P                          +D +   L+ NP+ R 
Sbjct: 227 TPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRL 286

Query: 779 SVDEVLNGPF 788
           S  + L+ P+
Sbjct: 287 SAKQALHHPW 296

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 130/298 (43%), Gaps = 38/298 (12%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           Y  L  +G+G S                +K+++ ++      E    EI ++K  + +  
Sbjct: 655 YLNLTKIGQGASGGVYTAYELGTNASVAIKQMNLEK--QPKKELIINEIMVMKGSKHR-N 711

Query: 574 VVKLIDHEMDHGVLYEVMECGDHD-----LSHTLALRSGMGLDVEFVRFHSQEMLKCVKV 628
           +V  ID  +  G L+ VME  +       ++H +     +G          +E L  ++ 
Sbjct: 712 IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAVC-------RETLAGLQF 764

Query: 629 VHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 687
           +H  G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GTP +MAPE + 
Sbjct: 765 LHSKGVIHRDIKSDNILLSMTGEIKLTDFGFCAQINE--INLKRTTMVGTPYWMAPEVV- 821

Query: 688 AMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVKI 746
                       +R + G   DIWS G +I +MI G PPY        L L   N   K+
Sbjct: 822 ------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKL 869

Query: 747 VYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
             P      D + +   + +  CL   P++R S  ++L  PFV  +A  +  +  L+K
Sbjct: 870 KEP------DNLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVTQVAEENSSLAPLVK 921

>Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {ON}
           YKL161C (REAL)
          Length = 508

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 89/331 (26%), Positives = 147/331 (44%), Gaps = 60/331 (18%)

Query: 542 LKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDH---GVL------YEVME 592
           +K++    F++ S +    E++LL+     P ++ L D ++     GVL       E+ME
Sbjct: 53  IKKIPSAFFNERSCKRTLRELKLLRHFRGHPNIIWLFDTDIVFYPSGVLNGVYLYEELME 112

Query: 593 CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI-L 651
           C   DLS  L  RSG  L+    +    + L  +K +H +G++H DLKP N +      L
Sbjct: 113 C---DLSQIL--RSGQHLEDSHYQSFIYQTLCALKYIHSAGVLHGDLKPKNLLVNSDCQL 167

Query: 652 KIIDFGIANAVPE--HTVNIYRETQIGTPNYMAPEALVA-MNYTQGQPAEQNRWKVGKPS 708
           K+ +FG++    E     N +    + +  Y+APE +++   YT             K  
Sbjct: 168 KVCNFGLSRGCSEDYEENNHFTTEFVASRCYIAPEIMLSHQGYT-------------KAV 214

Query: 709 DIWSCGCIIYQMIYGRPPYGG---FQGQNRLLAIMNPEVKIVYPEKTSNG---------- 755
           D+WS GCI+ +++ G+P + G       N +L I+    K +  E  S            
Sbjct: 215 DVWSTGCILAELLGGKPLFDGKDYVDQLNNILQILGTPSKEMLQEIGSQKIQSYILLFGH 274

Query: 756 -------DVVPKT---AIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKN 805
                   ++PK     +D +K  LE +P++R  VDE L  PF   ++V H  I D    
Sbjct: 275 IPGTPFESILPKANPKGLDLLKKMLEFDPKQRIVVDEALKHPF---LSVWH-DIDDEPSC 330

Query: 806 SVKYGANQREISNEKIEELAEDVWHRLADFR 836
              +      ISN  +EEL   V   ++DF+
Sbjct: 331 EKTFAFEFEHISN--MEELQSQVTREVSDFK 359

>NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa] {ON}
            
          Length = 1508

 Score = 92.0 bits (227), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 100/198 (50%), Gaps = 35/198 (17%)

Query: 616  RFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEH-TVNIYRET 673
            + ++ ++L+ +  +H+SGIVH D+KP N +    GI+K +DFG A  + ++ T  + RE 
Sbjct: 1310 QVYTLQLLEGLAYLHESGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRVVTREM 1369

Query: 674  -------------------QIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCG 714
                                IGTP YMAPEA+       G P + +   +G   DIW+ G
Sbjct: 1370 PDENDDENGKVVGRNNFNDIIGTPMYMAPEAIT------GSPKKGH---LG-ADDIWALG 1419

Query: 715  CIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNP 774
            C++ +MI G+ P+     +    AIM        P+  +N +V P   +  +K CL++NP
Sbjct: 1420 CVVLEMITGKRPWANLDNE---WAIMYHVAAGQIPQLPTNDEVSP-AGMHFLKRCLKQNP 1475

Query: 775  EKRWSVDEVLNGPFVKPI 792
             +R S  E+L  P++  I
Sbjct: 1476 AQRASAVELLMDPWIIEI 1493

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 109/237 (45%), Gaps = 26/237 (10%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL     V++L D       LY V+E  +      L +  G   + E VR
Sbjct: 85  GIEREI-IIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERGPLPENEAVR 143

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A      + +   ET  
Sbjct: 144 FFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ESKDKLLETSC 199

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           G+P+Y APE +  + Y             G  SD+WSCG I+Y ++ GR P+    G  R
Sbjct: 200 GSPHYAAPEIVSGLPYH------------GFESDVWSCGVILYALLTGRLPFDEDNGNIR 247

Query: 736 --LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
             LL + + E ++         D +   A D +   L  +P++R    E+L  P ++
Sbjct: 248 SLLLKVQSGEYEM------PGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQ 298

>TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 bp,
           304 aa] {ON} Anc_8.482 YPL031C
          Length = 304

 Score = 87.8 bits (216), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/312 (26%), Positives = 137/312 (43%), Gaps = 55/312 (17%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSG----MGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D+DL   +  R+      GL++  V++   ++L+ V 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELSLVKYFHWQLLEGVS 122

Query: 628 VVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H+S I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHESKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 744
            L+                     D+WSCGCI+ +MI G+P + G   + +L  I   E+
Sbjct: 179 VLMGSR------------TYSTSIDMWSCGCILAEMITGKPLFPGTNDEEQLKLIF--EI 224

Query: 745 KIVYPEKTSNG-DVVPK---------------------------TAIDTMKACLERNPEK 776
                E T +G   +PK                             I+ +   L+ NP+ 
Sbjct: 225 MGTPNESTWSGVSSLPKYNPNFSQKLPRDLRTILQPHTKEPLDDNLINLLHGLLQLNPDM 284

Query: 777 RWSVDEVLNGPF 788
           R S  + L+ P+
Sbjct: 285 RLSAKQALHHPW 296

>Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 aa]
           {ON} similar to Ashbya gossypii AGL242C 1-intron
          Length = 301

 Score = 87.8 bits (216), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 133/308 (43%), Gaps = 53/308 (17%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGM----GLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D+DL   +  R       GL++  V++   ++L+ V 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRVDREMPRGLELSLVKYFQWQLLQGVA 122

Query: 628 VVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---- 740
            L+                     DIWSCGCI+ +MI G+  + G     +L  I     
Sbjct: 179 VLMGSR------------SYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFETLG 226

Query: 741 ----------------NPEVKIVYPEKTSNGDVVPKT-------AIDTMKACLERNPEKR 777
                           NP++ + YP K     + P T        I  +   L+ NP+ R
Sbjct: 227 TPTEQMWPGASQLPDYNPQIPL-YPPKDLKQLLQPTTNEKISDILISLLHGLLQLNPDMR 285

Query: 778 WSVDEVLN 785
            S  + LN
Sbjct: 286 LSAQQALN 293

>SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 531

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 137/319 (42%), Gaps = 62/319 (19%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDV 612
           IE    E  +L +LE  P +VKL     D   LY V++   G     H   L+    LD 
Sbjct: 195 IERTFAERTILSQLE-HPNIVKLFYSFHDSHRLYLVLQYIPGGELFYH---LKEQGTLDE 250

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIA------------ 659
           + V F++ E+   +K +HD GIV+ DLKP N +   KG L + DFG++            
Sbjct: 251 QTVSFYAAEISCALKFLHDRGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVGEAGSPAA 310

Query: 660 -----NAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCG 714
                N   E    +Y  + IGTP Y APE L  + YTQ               D +S G
Sbjct: 311 TATETNHDGEPVTALY--SIIGTPEYCAPEILQGVPYTQ-------------ICDWYSLG 355

Query: 715 CIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNP 774
           C++Y M+ G+PPY G   +  L  I+  +   + P   S+G        D + A L+++ 
Sbjct: 356 CLVYDMLIGKPPYTGANHKVILHKIVKDKTPKI-PMYLSDG------MKDFLGALLKKDV 408

Query: 775 EKRWSVDEVL--NGPFVKPIAV---------THFFIRDLIKNSVKYGANQREISNEKI-- 821
            KRW VD     +GP  K              HF  R +   S++ G  QR  +   +  
Sbjct: 409 GKRWDVDRYWSEDGPRPKKKKAGQAKTTGFQKHFVFRKINWKSMETGDLQRSSTGPILPI 468

Query: 822 ---EELAEDVWHRLADFRL 837
               ELAE+  +   + RL
Sbjct: 469 ITDWELAENFDNEFTEMRL 487

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 113/237 (47%), Gaps = 37/237 (15%)

Query: 561  EIELLKKLETKPR--VVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFH 618
            EI+++  L  KP   ++ L+D   D    Y  +E   H  S ++ L   + +  +     
Sbjct: 1006 EIQIMATLNAKPHENILMLLDFFEDDDYYY--IETAVHGTSGSIDLFDLIEMKTDMTEHE 1063

Query: 619  SQEMLK----CVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRET 673
            +  + K     +K +HD+GIVH D+K  N +    G +KI+DFG A  V     +++   
Sbjct: 1064 AMLIFKQIASGIKNLHDNGIVHRDIKDENVIVDCNGFVKIVDFGSAAYVKSGPFDVF--- 1120

Query: 674  QIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 733
             +GT +Y APE L       G+P E      GKP DIW+ G ++Y +IY   P+      
Sbjct: 1121 -VGTIDYAAPEVL------GGEPYE------GKPQDIWAIGVLLYTIIYKENPFYNID-- 1165

Query: 734  NRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                 I++ ++++   E+ S+        I  ++  L R+  KR S+DE+ N  +++
Sbjct: 1166 ----EILDADLRVNSSERISDD------CIALIRKILNRSVSKRPSIDEICNHKWLE 1212

>TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1575

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 118/264 (44%), Gaps = 48/264 (18%)

Query: 558  FKGEIELLKKLETKPRVVKLIDHEMDH---GVLYEVMECGDHDLSHTLALRSGMGLDVEF 614
             K E+ +L+ L + P VV+    E+      +  E  E G    S    L  G   D   
Sbjct: 1309 IKEEMSVLEML-SHPNVVQYYGVEVHRDKVNIFMEYCEGG----SMASLLEHGRIEDEMV 1363

Query: 615  VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVN----- 668
             + ++ E+L+ +  +H SG+VH D+KP N +    GI+K +DFG A  + ++  +     
Sbjct: 1364 TQVYTLELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGAAKKIAKNGTDTRGFA 1423

Query: 669  --------------------IYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPS 708
                                +  +  +GTP YMAPE++       G P   N+ ++G   
Sbjct: 1424 RSVASDSSTGSADNTSEQDGLALQDMMGTPMYMAPESIT------GSP---NKGRLG-AD 1473

Query: 709  DIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKA 768
            DIWS GC+I +MI GR P+     +    AIM        P+  SN D V       ++ 
Sbjct: 1474 DIWSLGCVILEMITGRRPWAKLDNE---WAIMYHVAAGHIPQLPSN-DEVSSAGKKFLRR 1529

Query: 769  CLERNPEKRWSVDEVLNGPFVKPI 792
            CL+ NP KR S  E+L  P++  I
Sbjct: 1530 CLQENPFKRASAVELLMDPWIVQI 1553

>KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 519

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 119/250 (47%), Gaps = 52/250 (20%)

Query: 564 LLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRFHSQE 621
           +L +LE  P +VKL     DH  LY V++   G     H   L+    LD   V F++ E
Sbjct: 191 ILSQLE-HPNIVKLFYSFHDHHKLYLVLQFIPGGELFYH---LKEQGTLDENTVTFYAAE 246

Query: 622 MLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIA-----------------NAVP 663
           +   +K +H+ GIV+ DLKP N +   +G L + DFG++                 +A+ 
Sbjct: 247 ISCALKFLHERGIVYRDLKPENCLLDERGHLVLTDFGLSKKSAADSDTPERSDIDGDALN 306

Query: 664 EHT---VN-IYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQ 719
            H+   VN +Y  + IGTP Y APE L      +G+P  QN        D +S GC+++ 
Sbjct: 307 SHSGEPVNKLY--SIIGTPEYCAPEIL------EGKPYTQN-------CDWYSLGCLVFD 351

Query: 720 MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWS 779
           M+ G+PPY G   +  L  I+  +   + P   S G        D + A L+++  KRW 
Sbjct: 352 MLIGKPPYTGVNHKVILGKILKDKTPKI-PSYLSEG------MKDYLGALLKKDVTKRWD 404

Query: 780 VDEVL--NGP 787
           VD+    +GP
Sbjct: 405 VDKFWDSDGP 414

>NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa]
           {ON} 
          Length = 528

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 134/281 (47%), Gaps = 34/281 (12%)

Query: 561 EIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGD-HDLSHTLALRSGMGLDVEFVRFHS 619
           E+ L  K    P V++LID  + +  ++ VME  D  DL     +   +G+D E  +F+ 
Sbjct: 65  EVILHSKCSKHPNVLRLIDCNISNAYMWIVMEMADGGDLFD--KIEPDIGVDSEVAQFYF 122

Query: 620 QEMLKCVKVVHD-SGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNI-YRETQIG 676
           Q++++ +  +HD  GI H D+KP N +  + G LK+ DFG+A+    +   I     Q G
Sbjct: 123 QQLIRAISYLHDECGIAHRDIKPENILLDRNGNLKLADFGLASQFKRNDGTIRVASDQRG 182

Query: 677 TPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL 736
           +P YMAPE L    Y++G             +DIWS G +++ ++ G  P+         
Sbjct: 183 SPAYMAPEIL----YSKGG-------YYANSTDIWSIGILLFVLLTGEIPWE-------- 223

Query: 737 LAIMNPEVKIVYPEKTSNGDVVPKTAID-----TMKACLERNPEKRWSVDEVLNGP-FVK 790
           L +M  +    + +   N ++ P   ID      ++  L+ +P+KR S+  +   P F K
Sbjct: 224 LPVMEEKNFACFIQNNGNLNLGPWAKIDFSHLNLLRKMLQPDPKKRASLKILRTHPWFTK 283

Query: 791 PI--AVTHFFIRDLIKNSVKYGANQR-EISNEKIEELAEDV 828
            +  A +    +D    + K  +N R  +SNE  E   +DV
Sbjct: 284 GVRFANSEGLCKDPAVLAKKLLSNLRISLSNETYERFTQDV 324

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 109/280 (38%), Gaps = 66/280 (23%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGM----- 608
           +E  + EI +LKK+   P +VKLID E      Y +ME C   DL+  +  R  +     
Sbjct: 88  LENLEIEIAILKKI-NHPHIVKLIDCERTTTDFYLIMEYCALGDLTFLIKKRHELIKNHP 146

Query: 609 -----------------GLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG-- 649
                            GL   F+  + Q++   +K +    +VH D+KP N + +    
Sbjct: 147 LLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRSKNLVHRDIKPQNLLLLTPLI 206

Query: 650 --------------------ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
                               ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 207 NYNDSKAFKKLGFIGIYELPILKIADFGFARFLPNTSM---AETLCGSPLYMAPEIL--- 260

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
                     N  K    +D+WS G ++Y+M YG PP+           I     KI +P
Sbjct: 261 ----------NYQKYNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFP 310

Query: 750 EKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
               N   +       +   L  +P++R   DE  N   V
Sbjct: 311 ----NYIQIQNDMKILISKLLTFDPQRRIEFDEFFNNNLV 346

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 109/238 (45%), Gaps = 35/238 (14%)

Query: 574 VVKLIDHEMDHGVLYEVMECGDHD-----LSHTLALRSGMGLDVEFVRFHSQEMLKCVKV 628
           +V  ID  +  G L+ VME  +       ++H +     +G          +E L  +  
Sbjct: 735 IVNFIDSYLMKGDLWVVMEYMEGGSLTDVVTHCILTEGQIGTVC-------KETLGGLAF 787

Query: 629 VHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 687
           +H  G++H D+K  N +  + G +K+ DFG    + E  V++ R T +GTP +MAPE + 
Sbjct: 788 LHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQINE--VHLKRTTMVGTPYWMAPEVV- 844

Query: 688 AMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVKI 746
                       +R + G   DIWS G +I +MI G PPY        L L   N   ++
Sbjct: 845 ------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPQL 892

Query: 747 VYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
             PE    G+++ K     +  CL  NPE+R +  E+L+ PF+   A     +  L+K
Sbjct: 893 KDPENL--GEILKK----FLDWCLTVNPEERATALELLSHPFITDHADEKISLSPLVK 944

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 109/228 (47%), Gaps = 37/228 (16%)

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           +V+ ID   D   +Y ++E C +  L   L  R    L    VRF + +++  VK +H  
Sbjct: 138 IVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKV--LTEPEVRFFTTQIVGAVKYMHSR 195

Query: 633 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            ++H DLK  N  F K   LKI DFG+A  +       Y  T  GTPNY+APE L   + 
Sbjct: 196 RVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLTGKH- 252

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
             G   E          DIWSCG +IY ++ G+PP   FQ +         EV I+Y E+
Sbjct: 253 -TGHSYE---------VDIWSCGVMIYALLIGKPP---FQAK---------EVNIIY-ER 289

Query: 752 TSNGD-------VVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPI 792
              GD        + + A+  ++  L  +P +R S+DE+++  + + I
Sbjct: 290 IKCGDYVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGI 337

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 111/235 (47%), Gaps = 27/235 (11%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL + P V+ L +   +   L+ V+E  D        +  G   + E + 
Sbjct: 103 GIEREI-IIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIH 161

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRETQ 674
           +  Q +++     H   I H DLKP N +  K    +KI DFG+A      T N   ET 
Sbjct: 162 YFRQ-IIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAAL---QTSNKLLETS 217

Query: 675 IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 734
            G+P+Y +PE ++  NY             G PSD+WSCG I++ ++ G  P+     + 
Sbjct: 218 CGSPHYASPEIVMGKNYN------------GGPSDVWSCGIILFALLTGHLPFNDDNIKR 265

Query: 735 RLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
            LL +   + ++  P+  S+G      A D +   L  +P+KR S++E+L  P +
Sbjct: 266 LLLKVQAGKYQM--PQSVSSG------AQDLISRILVVDPDKRISINEILAHPLL 312

>Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 68/228 (29%), Positives = 105/228 (46%), Gaps = 45/228 (19%)

Query: 572 PRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVV 629
           P +VKL     D+  LY +++   G     H   L+    LD   V F++ E+   ++ +
Sbjct: 213 PNIVKLFYSFHDNSKLYLLLQYIPGGELFYH---LKEHGTLDETTVSFYAAEISCALRFL 269

Query: 630 HDSGIVHSDLKPANFVF-VKGILKIIDFGIANAV----------PEHTVNIYRETQIGTP 678
           H  G+V+ DLKP N +   +G L + DFG++             PE+   +Y  + IGTP
Sbjct: 270 HTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSANDSVVDEEDPENVNALY--SIIGTP 327

Query: 679 NYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLA 738
            Y APE L+   YTQ               D +S GC++Y M+ G+PPY G         
Sbjct: 328 EYCAPEILLGRAYTQN-------------CDWYSLGCLLYDMLVGKPPYTG--------- 365

Query: 739 IMNPEVKIVYPEKTSNGDVVP----KTAIDTMKACLERNPEKRWSVDE 782
             N +V I   ++   G  +P    +   D + A L+R   KRW+VD+
Sbjct: 366 -SNHKVIINKIQQNKQGPKIPFYLSEGMKDILNALLKRETSKRWNVDK 412

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 136/296 (45%), Gaps = 32/296 (10%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           + + E++GRG                  +K +S  E D   +   + EI+ L  L+  P 
Sbjct: 42  FRRTEIIGRGKFGVVYKGYHMKTKGVYAIKVLSL-ESDLDEVADIQREIQFLVSLKQVPN 100

Query: 574 VVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSG 633
           + +     +    L+ +ME        TL LR G  +D +++    +E+L  +  +H   
Sbjct: 101 ITRYYASYLKDTSLWIIMEYCAGGSVRTL-LRPG-KIDEKYIAVIMRELLVALHYIHKDN 158

Query: 634 IVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV-AMNY 691
           ++H D+K AN +   +G +K+ DFG+A  + ++T  + R+T  GTP +MAPE ++  ++Y
Sbjct: 159 VIHRDIKAANLLITNEGNVKLCDFGVAAQLNQNT--MRRQTMAGTPYWMAPEVIMEGISY 216

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
                           +DIWS G   Y++  G PP+   +    +  I   +     P +
Sbjct: 217 -------------DTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSK-----PAR 258

Query: 752 T--SNGDVVPKTAIDTMKACLERNPEKRWSVDEVLN-GPFVKPIAVTHF-FIRDLI 803
               N D + K  I     CL+ +P++R + D++L+   F+K    TH   +++LI
Sbjct: 259 LEGKNHDPLLKEFI---AMCLDEDPQERPTADKLLHESAFIKHYKNTHTSVLKELI 311

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 140/321 (43%), Gaps = 33/321 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRV------SFDEFDDSSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V      S DE   S +E  + E+  LK 
Sbjct: 1174 WIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDEATISVVEALRSEVSTLKN 1233

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E  + +    +E        +L    G   D   +RF + ++L+ + 
Sbjct: 1234 LD-HLNIVQYLGFENKNSIYSLFLEYVAGGSVGSLIRLYGR-FDESLIRFLTVQVLRGLS 1291

Query: 628  VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + G+ KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1292 YLHSRGILHRDMKADNLLLDLDGVCKISDFGIS----RKSNDIYCNSDMTMRGTVFWMAP 1347

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GC++ +M  G+ P+   +    +  I   +
Sbjct: 1348 EMV---DTKQGYSAK---------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSK 1395

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV---KPIAVTHFFIR 800
                 PE T    ++ K   + + AC E +PE+R + D +L   F    K        + 
Sbjct: 1396 TAPPIPEDTL--PLISKEGREFLDACFEIDPERRPTADTLLRHRFCEVEKSFDFKKTQVA 1453

Query: 801  DLIKNSVKYGANQREISNEKI 821
            D IK++ K   ++  + ++ I
Sbjct: 1454 DFIKSNDKLNYSKLRVGSQDI 1474

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 91.3 bits (225), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 123/293 (41%), Gaps = 81/293 (27%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGM----- 608
           +E  + EI +LKKL  K  +V LID + +      +ME C   DL+  +  R+ +     
Sbjct: 175 LENLEIEISILKKLNHK-HIVNLIDCQRNKNDFLLIMEYCSLGDLTFLIKKRNELIINHP 233

Query: 609 -----------------GLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF----- 646
                            GL++ FV  + Q++   +K +    ++H D+KP N +      
Sbjct: 234 LLNQIFQKFPSPNPDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYT 293

Query: 647 -----------------VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
                               ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 294 DYHDQQTFKKLGYIGISCLPILKIADFGFARFLPNTSL---AETLCGSPLYMAPEIL--- 347

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
                     N  K    +D+WS G ++Y+M+YG+PP+             N  ++++  
Sbjct: 348 ----------NYQKYNAKADLWSVGTVLYEMVYGKPPFKA-----------NNHLELLKK 386

Query: 750 EKTSNGDVVPKTAI---DTMKACLER----NPEKRWSVDEVL-NGPFVKPIAV 794
            K +N ++   + I   D MK  + R    +P KR S  E   N   +K +++
Sbjct: 387 IKRTNDNIPFPSYIEIDDDMKFLISRLLKFDPIKRMSFQEFFENNLILKDLSI 439

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 84/311 (27%), Positives = 145/311 (46%), Gaps = 26/311 (8%)

Query: 496 SGDSYN----RRKPTIYVNGTEYEKL----ELLGRGGSSXXXXXXXXXXXXXXXLKRVSF 547
           S DSYN    RR P   + G  Y+      E++G+G  +               +K ++ 
Sbjct: 162 SNDSYNSNGSRRTPESMLTGI-YKDFSIQDEVVGQGAFATVKKAVERTTGKTYAVKIINK 220

Query: 548 DEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRS 606
            +    +++G   E+E+LK+L   PR+V L     D+   Y VME     DL   +A   
Sbjct: 221 RKVM-GNLDGVTRELEVLKRL-NHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHG 278

Query: 607 GMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVP 663
            +G D    +  S+++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A    
Sbjct: 279 AVGEDAG--KEISRQILEAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQG 336

Query: 664 EHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYG 723
             T   + +T  GT  Y+APE + + +    +  E+N +      D+WS GC++Y ++ G
Sbjct: 337 NGT---FMKTFCGTLAYVAPEVIGSSSKYNEEDEERNEY--SSLVDMWSMGCLVYVILTG 391

Query: 724 RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
             P+ G   Q +L   ++   +  Y E       +   A D + + L+ +P  R +    
Sbjct: 392 HLPFSG-STQEQLYKQIS---RGSYHEGPLKDYRISDEARDFIDSLLQVDPSNRLTAARA 447

Query: 784 LNGPFVKPIAV 794
           L  P++K +++
Sbjct: 448 LEHPWIKMVSL 458

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 105/228 (46%), Gaps = 21/228 (9%)

Query: 564 LLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEML 623
           ++ KL + P V+ L D    +  LY ++E  +      L +  G   + E ++   Q ++
Sbjct: 79  VIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREAMKCFRQ-II 137

Query: 624 KCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 682
             V   H  GIVH DLKP N +      +K+ DFG+A      T     ET  G+P+Y A
Sbjct: 138 IAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAAL---QTDAALLETSCGSPHYAA 194

Query: 683 PEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 742
           PE +       G P E      G  SD+WSCG I++ ++ GR P+    G  R L +   
Sbjct: 195 PEIV------SGLPYE------GFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQ 242

Query: 743 EVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
             +   P+ T     + K A D +   L  +P +R  + ++L+ P +K
Sbjct: 243 RGQFEMPDDTE----ISKDAQDLISKILVVDPAQRIKIRDILSHPLLK 286

>Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 89.7 bits (221), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 111/240 (46%), Gaps = 46/240 (19%)

Query: 560 GEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRF 617
            E  +L ++E  P +VKL     D+  LY +++   G     H   L+    LD   V F
Sbjct: 202 AERSILSEIE-HPNIVKLFYSFHDNSKLYLLLQYIPGGELFYH---LKEHGTLDETTVSF 257

Query: 618 HSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAV----------PEHT 666
           ++ E+   +K +H  G+V+ DLKP N +   +G L + DFG++             PE+ 
Sbjct: 258 YAAEISCALKFLHSKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSAHDSMADEEDPENV 317

Query: 667 VNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPP 726
             +Y  + IGTP Y APE L+   YTQ               D +S GC++Y M+ G+PP
Sbjct: 318 KALY--SIIGTPEYCAPEILLGKAYTQN-------------CDWYSLGCLLYDMLVGKPP 362

Query: 727 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVP----KTAIDTMKACLERNPEKRWSVDE 782
           Y G           N +V I   ++   G  +P    +   D + A L++   KRW+VD+
Sbjct: 363 YTG----------NNHKVIINKIQQNKQGPKIPFYLSEGMKDILNALLKKETSKRWNVDK 412

>TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.229
           YBR028C
          Length = 513

 Score = 89.7 bits (221), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 108/234 (46%), Gaps = 44/234 (18%)

Query: 564 LLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRFHSQE 621
           +L +LE  P +VKL     DH  LY +++   G     H   L+    L+ + V F+  E
Sbjct: 193 ILSELE-HPNIVKLFYAFHDHSKLYLILQYIPGGELFFH---LKEQGTLNEDVVAFYGAE 248

Query: 622 MLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIAN--------AVPEHTVNIYRE 672
           +   +K +H+ GIV+ DLKP N +    G L + DFG++            E    +Y  
Sbjct: 249 ISCALKFLHEKGIVYRDLKPENCLLNYTGHLVLTDFGLSKKGVKKEIPGADEDVAELY-- 306

Query: 673 TQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 732
           + IGTP Y APE L  + YTQ               D +S GC+IY M+ G+PP+ G   
Sbjct: 307 SIIGTPEYCAPEILEGLPYTQN-------------CDWYSLGCLIYDMLVGKPPFVG--- 350

Query: 733 QNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMK--AC--LERNPEKRWSVDE 782
                   N ++ +   +K   G  +P    D MK   C  L+++  KRW VD+
Sbjct: 351 -------ANHKIILNKIKKDKTGAKIPYYLSDGMKDILCWLLKKDCSKRWDVDK 397

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 72/220 (32%), Positives = 107/220 (48%), Gaps = 35/220 (15%)

Query: 574 VVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSG 633
           +V+ +D   D   +Y ++E   +     L  R  M  + E VRF + +++  VK +H   
Sbjct: 138 IVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTTQIVGAVKYMHSRR 196

Query: 634 IVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT 692
           ++H DLK  N  F K   LK+ DFG+A  +       Y  T  GTPNY+APE L   +  
Sbjct: 197 VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLTGKH-- 252

Query: 693 QGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKT 752
            G   E          DIWSCG +IY ++ G+PP   FQ +         EV I+Y E+ 
Sbjct: 253 TGHSYE---------VDIWSCGVMIYALLIGKPP---FQAK---------EVNIIY-ERI 290

Query: 753 SNGD-VVPKT------AIDTMKACLERNPEKRWSVDEVLN 785
             GD V PK       A+  +K  L  +P +R S+DE+++
Sbjct: 291 KCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIID 330

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score = 89.7 bits (221), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 86/329 (26%), Positives = 145/329 (44%), Gaps = 34/329 (10%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEG-FKGEIELLKKLETKP 572
           Y+ ++ LG G                  LK ++      S ++G  + EI  L+ L   P
Sbjct: 30  YQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLSKSDMQGRIEREISYLRLLR-HP 88

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
            ++KL D       +  V+E  DH+L   +  R  M  + E  RF  Q+++  V+  H  
Sbjct: 89  HIIKLYDVIKSKDEIIMVIEYADHELFDYIVQREKMS-ENEGRRFF-QQIISAVEYCHRH 146

Query: 633 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            IVH DLKP N +  +   +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 147 KIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGN---FLKTSCGSPNYAAPEVISGKLY 203

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
                        G   D+WSCG I+Y ++  R P+   +    L   +N  V  + P  
Sbjct: 204 A------------GPEVDVWSCGVILYVLLCRRLPFDD-ESIPTLFKNINNGVYTI-PNF 249

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFI---RDLIK-NSV 807
            S G      A   +K  L  NP  R ++ +++  P+ K + +  + +   +D IK N  
Sbjct: 250 LSEG------AASLIKKMLIVNPMNRITIGDIIQDPWFK-VDLPEYLVPSEKDAIKINGT 302

Query: 808 KYGA-NQREISNEKIEELAEDVWHRLADF 835
              A N + ++   I+E A D+  +  ++
Sbjct: 303 NNNAENLQNLTAADIDEEAIDILTKTMNY 331

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 131/302 (43%), Gaps = 38/302 (12%)

Query: 513 EYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKP 572
           +Y  L  +G+G S                +K++  ++      E    EI ++K+     
Sbjct: 516 QYANLTKIGQGASGGVYTANQVKSNELVAIKQMDLEK--QPKKELILNEIIVMKE-SRHN 572

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHD-----LSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            VV  I+  +  G L+ VME  +       ++H L     +G          +E L+ +K
Sbjct: 573 NVVNFINAHLSKGNLWIVMEYMEGGSLTDVVTHCLLSEGQIGAVC-------RETLEGLK 625

Query: 628 VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 686
            +H  G++H D+K  N +  +KG +K+ DFG    +  + +++ R T +GTP +MAPE +
Sbjct: 626 FLHSKGVIHRDIKSDNVLLSMKGDIKLTDFGFCAQI--NDIDLNRTTMVGTPYWMAPEVV 683

Query: 687 VAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI-MNPEVK 745
                        +R + G   DIWS G +I +MI G PPY        L  I  N   K
Sbjct: 684 -------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNEAPLKALYLIATNGTPK 730

Query: 746 IVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKN 805
           +  PE  S  DV      + +  CL   PE+R S  E+L   FV   A     +  L++ 
Sbjct: 731 LKEPENLS--DVFS----NFLDRCLRVEPEERASAIELLADEFVVACAEPTISLAPLVRL 784

Query: 806 SV 807
           S+
Sbjct: 785 SL 786

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 114/240 (47%), Gaps = 19/240 (7%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVE 613
           ++G   E+E+L++L   PR+V L     D    Y VME     DL   +A    +G D  
Sbjct: 228 MDGVTRELEVLRRL-NHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAG 286

Query: 614 FVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVNIY 670
             R  ++++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      T   +
Sbjct: 287 --REITRQVLEAVKYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGT---F 341

Query: 671 RETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGF 730
            +T  GT  Y+APE +   N    +  E N++      D+WS GC++Y ++ G  P+ G 
Sbjct: 342 MKTFCGTLAYVAPEVISGKN---SEEKEGNKY--SSLVDMWSIGCLVYVILTGHLPFSGS 396

Query: 731 QGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
             Q     I        Y E       +   A D +++ L+ NP  R + ++ L  P+++
Sbjct: 397 TQQELYKQISAGS----YHEGPLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 124/279 (44%), Gaps = 26/279 (9%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           + + E++GRG                  +K ++ D  +D  +E  + E++ L  L+  P 
Sbjct: 23  FRRTEIVGRGKFGVVYKAYHVKTKQVYAIKVLNLDCPEDE-VEDVQKEVQFLSSLKQVPN 81

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           + +     +    L+ +ME C    L  TL LR G  +D +++    + +L  +  +H  
Sbjct: 82  ITQYYGSFLYETKLWVIMEYCAGGSL-RTL-LRPGK-IDEKYLGVIVRNLLVALLYIHKD 138

Query: 633 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            ++H D+K AN +   G  +K+ DFG+A  +   T N  R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNGGHVKLCDFGVAAQL--TTANHKRQTMAGTPYWMAPEVIMEGVY 196

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +            +DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 197 YNTK------------ADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSK-----PPR 239

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
               +  P    + +  CL+ +PE R + +E+L    VK
Sbjct: 240 LEGRNYSPLLK-EFIALCLDEDPEARPTAEELLTTKLVK 277

>YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}
           YPK3An AGC kinase phosphorylated by cAMP-dependent
           protein kinase (PKA) in a TORC1-dependent manner
          Length = 525

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 114/240 (47%), Gaps = 46/240 (19%)

Query: 560 GEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRF 617
            E  +L ++E  P +VKL     D+  LY +++   G     H   L+    LD   V F
Sbjct: 201 AERSILSEIE-HPNIVKLFYSFHDNSKLYLLLQYIPGGELFYH---LKEHGTLDETTVSF 256

Query: 618 HSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIA------NAV----PEHT 666
           ++ E+   ++ +H  G+V+ DLKP N +   +G L + DFG++      +AV    PE+ 
Sbjct: 257 YAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSANDSAVDEEDPENV 316

Query: 667 VNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPP 726
             +Y  + IGTP Y APE L+   Y+Q               D +S GC++Y M+ G+PP
Sbjct: 317 NALY--SIIGTPEYCAPEILLGKAYSQN-------------CDWYSLGCLLYDMLVGKPP 361

Query: 727 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVP----KTAIDTMKACLERNPEKRWSVDE 782
           Y G           N +V I   ++   G  +P    +   D + A L++   KRW+VD+
Sbjct: 362 YTG----------SNHKVIINKIQQNKQGPKIPFYLSEGMKDILNALLKKETAKRWNVDK 411

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 115/243 (47%), Gaps = 17/243 (6%)

Query: 553 SSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLD 611
            +++G   E+E+L++L   PR+V L     D    Y +ME     DL   +A    +G D
Sbjct: 255 GNVDGVTRELEVLRRL-NHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGED 313

Query: 612 VEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 668
               R  ++++L+ V+ +H+ GI H DLKP N +  +    ++KI DFG+A      T  
Sbjct: 314 AG--REITRQILEAVRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTT-- 369

Query: 669 IYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYG 728
            + +T  GT  Y+APE +   N  +G  A  N +      D+WS GC++Y ++ G  P+ 
Sbjct: 370 -FMKTFCGTLAYVAPEVIGGKN-PEGNGANGNLYS--SLVDMWSIGCLVYVILTGHLPFS 425

Query: 729 GFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
           G   +     I N      Y E       +   A D + + L+ NP  R + +  L  P+
Sbjct: 426 GSTQEQLYKQIANGS----YHEGPLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPW 481

Query: 789 VKP 791
           + P
Sbjct: 482 LHP 484

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 110/248 (44%), Gaps = 35/248 (14%)

Query: 564 LLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHD-----LSHTLALRSGMGLDVEFVRFH 618
           L+ K      +V  ID  +  G L+ VME  +       ++H +   + +G         
Sbjct: 670 LVMKGSKHQNIVNFIDSYVLKGDLWVVMEYMEGGSLTDVVTHCILTEAQIGAVC------ 723

Query: 619 SQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGT 677
            +E L+ ++ +H  G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GT
Sbjct: 724 -RETLRGLQFLHSKGVIHRDIKSDNILLSMNGEIKLTDFGFCAQINE--INLKRTTMVGT 780

Query: 678 PNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL- 736
           P +MAPE +             +R + G   DIWS G +I +MI G PPY        L 
Sbjct: 781 PYWMAPEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALY 827

Query: 737 LAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTH 796
           L   N   K+  PE      V+       +  CL  NP+ R S  E+L   F+   A  +
Sbjct: 828 LIATNGTPKLKEPE------VLSPELKSFLAWCLNVNPDTRASATELLRDVFITQCADEN 881

Query: 797 FFIRDLIK 804
             +  L+K
Sbjct: 882 ESLAPLVK 889

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 107/235 (45%), Gaps = 27/235 (11%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++K L +   V+ L +   +   LY V+E  D        +  G   + E V 
Sbjct: 162 GIEREIVIMK-LISHANVLGLYEVWENKSELYLVLEYVDGGELFDYLVSRGRLCEREAVH 220

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVK--GILKIIDFGIANAVPEHTVNIYRETQ 674
           +  Q +++ V   H   I H DLKP N +  K    +KI DFG+A        N   +T 
Sbjct: 221 YFKQ-IIQGVSYCHAFNICHRDLKPENLLLDKKNSTIKIADFGMAAL---EVSNKLLQTS 276

Query: 675 IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 734
            G+P+Y +PE ++   Y             G PSD+WSCG I++ ++ G  P+     + 
Sbjct: 277 CGSPHYASPEIVMGKQYH------------GGPSDVWSCGIILFALLTGHLPFNDDSIKK 324

Query: 735 RLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
            LL + + + ++  P+  S      K A D +   L  NP KR + +E+L  P +
Sbjct: 325 LLLKVQSGKYQM--PQNLS------KEAQDLIAKILTVNPAKRLTTEEILRHPLI 371

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 126/287 (43%), Gaps = 30/287 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSF------DEFDDSSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V        +E     +E  K E+  LK 
Sbjct: 1151 WMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKD 1210

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E+  G +Y +        S    +R     D + +R  + ++L  +K
Sbjct: 1211 LD-HLNIVQYLGSEI-RGNIYSLFLEYVAGGSVGSLIRLYGRFDEKLIRHLNTQVLSGLK 1268

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + GI KI DFGI+    + + NIY  + +   GT  +MAP
Sbjct: 1269 YLHSKGILHRDMKADNLLLDEDGICKISDFGIS----KKSKNIYSNSDMTMRGTVFWMAP 1324

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GC++ +M  G+ P+   +    +  I   +
Sbjct: 1325 EMV---DTKQGYSAK---------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSK 1372

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                 P+ T    ++     D +  C E +PEKR + D++L   F K
Sbjct: 1373 SAPPIPDDTIQ--LISSKGKDFLSKCFEIDPEKRPTADDLLEHSFSK 1417

>SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 368

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 114/270 (42%), Gaps = 54/270 (20%)

Query: 561 EIELLKKLETKPRVVKLID-----HEMDHGVLYEVMECGDHDLSHTLA---LRSGMGLDV 612
           E++LLK       ++ ++D            +Y V E  + DL   +A     SG  L  
Sbjct: 59  ELKLLKFFHDHENIISVLDIVRPTSLAKFDAVYLVQELMETDLHRIIANSNGHSGTPLSD 118

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVP------EH 665
           + +++   +ML+ +K +H + ++H DLKP+N +      LK+ DFG+A  +       E+
Sbjct: 119 DHIQYFVYQMLRALKAMHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSSNSREN 178

Query: 666 TVNIYRETQIGTPNYMAPEALVAMN-YTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGR 724
            V    E  + T  Y APE ++    YT                DIWSCGCI+ +MI G+
Sbjct: 179 LVGFMTE-YVATRWYRAPEIMLTFQEYTTAM-------------DIWSCGCILAEMITGK 224

Query: 725 PPYGGFQGQNRLLAIM------------------------NPEVKIVYPEKTSNGDVVPK 760
           P + G    ++L  I+                        N  ++   P K   G  V  
Sbjct: 225 PLFPGRDYHHQLWLILEVLGTPSYQDFEQIKSKRAKEYIANLPLRPRVPWKIVLGQHVNP 284

Query: 761 TAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
            AID +   L  NP+KR    E L  P++K
Sbjct: 285 DAIDLLDKMLTFNPDKRIGASEALKHPYLK 314

>SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1071

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 111/234 (47%), Gaps = 28/234 (11%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L++L     V+KL     D   LY ++E   +    ++  + G  L+ E  R++  +ML 
Sbjct: 234 LQRLNNSRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFG-SLNEECCRYYGAQMLD 292

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAV---PEHTVNIYRETQ--IGTP 678
            +  +H +G+VH D+KP N +  + + +K+ DFG A  +    +   N+ ++++  +GT 
Sbjct: 293 AIDFIHKNGVVHRDIKPENILLDEHMKVKLTDFGTAKLLDRDEKSGYNLLKKSRSFVGTA 352

Query: 679 NYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLA 738
            Y++PE L             N   V    DIW+ GCI+YQMI G+PP   F+  N  L 
Sbjct: 353 EYVSPELL-------------NDNCVNYKCDIWAFGCILYQMIAGKPP---FKATNEYLT 396

Query: 739 IMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPI 792
                +K+ Y          P    D +K  L ++PE R +  +V +  F K +
Sbjct: 397 FQK-VMKVQYAFTAG----FPLVIRDLVKQLLVKSPEARLNASQVKSHHFFKSV 445

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 107/235 (45%), Gaps = 27/235 (11%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++K L + P V+ L +   ++  LY V+E  D        +  G   + E V 
Sbjct: 181 GIEREIVIMKLL-SHPNVMALYEVWENNNELYLVLEYVDGGELFDYLVSKGKLTESEAVH 239

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRETQ 674
           +  Q ++  +   H   I H DLKP N +  K   I+KI DFG+A        N   +T 
Sbjct: 240 YFKQ-IINGISYCHSFNICHRDLKPENLLLDKKRRIIKIADFGMAAL---QVSNRLLQTS 295

Query: 675 IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 734
            G+P+Y +PE ++   Y             G PSDIWSCG I++ ++ G  P+     + 
Sbjct: 296 CGSPHYASPEIVMGKCYN------------GAPSDIWSCGIILFALLTGHLPFNDDNIKK 343

Query: 735 RLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
            L+ + N   ++           + + A + +   L  +P KR S +++L+ P +
Sbjct: 344 LLIKVQNGRYQM--------PSYISQEAKNLISRILVVDPSKRISTEQILSHPLL 390

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 142/324 (43%), Gaps = 36/324 (11%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEG-FKGEIELLKKLETKP 572
           Y+ ++ LG G                  LK ++      S ++G  + EI  L+ L   P
Sbjct: 42  YQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAKSDMQGRIEREISYLRLLR-HP 100

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
            ++KL D       +  V+E  DH+L   +  R  M  + E  +F  Q+++  V+  H  
Sbjct: 101 HIIKLYDVIKSKEDIIMVIEYADHELFDYIVQRDKMS-ENEARKFF-QQIISAVEYCHRH 158

Query: 633 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 159 KIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 215

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 216 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DDSIPVLFKNI 251

Query: 752 TSNGDVVPK----TAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSV 807
           ++    +PK     A + +K  L  NP  R S++E++   + +     +   +D+   S 
Sbjct: 252 SNGIYTLPKFLSPGAANLIKRMLIVNPLNRISMNEIMEDEWFRVDFPEYLEPQDMKLKSS 311

Query: 808 KYGANQREISNEKIEELAEDVWHR 831
           K   N  + S+E+I E   D+  R
Sbjct: 312 KDNNNSNDGSSEEINEDLVDILSR 335

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 109/235 (46%), Gaps = 27/235 (11%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL + P V+ L +   +   LY V+E  +        +  G   + E V 
Sbjct: 113 GIEREI-IIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLPEQEAVH 171

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGIL--KIIDFGIANAVPEHTVNIYRETQ 674
           +  Q +++ V   H   I H DLKP N +  K  L  KI DFG+A      T +   ET 
Sbjct: 172 YFKQ-IVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAAL---ETTDKLLETS 227

Query: 675 IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 734
            G+P+Y +PE ++   Y             G PSD+WSCG I++ ++ G  P+     + 
Sbjct: 228 CGSPHYASPEIVMGQKYH------------GSPSDVWSCGIILFALLTGHLPFNDDNVKK 275

Query: 735 RLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
            LL + + + ++  P+  SN       A D +   L  +P  R ++DEVL  P +
Sbjct: 276 LLLKVQSGKYQM--PQNISN------EAKDLIAKILIVDPAMRITIDEVLEHPLL 322

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 90.1 bits (222), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 106/238 (44%), Gaps = 44/238 (18%)

Query: 574 VVKLIDHEMDHGV---------LYEVMECGDH-DLSHTLALRSGMGLDVEFVRFHSQEML 623
           ++KLI H    G+         LY V+E  D  +L   L  R  +G + E V +  Q ++
Sbjct: 195 IMKLISHSNILGLYEVWENKSELYLVLEYVDGGELFDYLVSRGKLG-EREAVHYFKQ-IV 252

Query: 624 KCVKVVHDSGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 681
           + V   H   I H DLKP N +  K    +KI DFG+A        N   +T  G+P+Y 
Sbjct: 253 QGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMAAL---EVSNKLLQTSCGSPHYA 309

Query: 682 APEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 741
           +PE ++   Y             G PSD+WSCG I++ ++ G  P+     +  LL + +
Sbjct: 310 SPEIVMGRPYH------------GGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQS 357

Query: 742 PEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGP-------FVKPI 792
              K   P+  S        A D M   L  NP KR + +E+LN P        VKP+
Sbjct: 358 G--KFHMPQNLS------AEAKDLMSKILVVNPFKRIATEEILNHPLLTKYDKLVKPV 407

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 112/280 (40%), Gaps = 66/280 (23%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGM----- 608
           +E  + EI +LKK+ + P +VKLID E      Y +ME C   DL+  +  R  +     
Sbjct: 97  LENLEIEIAILKKI-SHPHIVKLIDFERTSKDFYLIMEYCSLGDLTFLIKKRQQLIKNHP 155

Query: 609 -----------------GLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANF------- 644
                            GL   F+  + Q++   +K +    +VH D+KP N        
Sbjct: 156 LLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSAPLI 215

Query: 645 ---------------VFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
                          ++   ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 216 NYNDPKSFHDLGFVGIYNLPILKIADFGFARFLPNTSM---AETLCGSPLYMAPEIL--- 269

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
                     N  K    +D+WS G ++Y+M YG PP+           I      I +P
Sbjct: 270 ----------NYQKYNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKANDLIYFP 319

Query: 750 EKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
                 + + K+ I  +   L  +P++R   DE  N   V
Sbjct: 320 TYIEIDNNL-KSLISKL---LTFDPQERIEFDEFFNNELV 355

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 117/240 (48%), Gaps = 14/240 (5%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVE 613
           ++G   E+E+L+KL   PR+V+L     D    Y VME     DL   +A    +G D  
Sbjct: 238 MDGVTRELEVLQKL-NHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAG 296

Query: 614 FVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVNIY 670
             R  S+++L  VK +H  GI H DLKP N +  +    ++KI DFG+A      +   +
Sbjct: 297 --REISRQILTAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS---F 351

Query: 671 RETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGF 730
            +T  GT  Y+APE +   + +      + R +     D+WS GC++Y ++ G  P+ G 
Sbjct: 352 MKTFCGTLAYVAPEVIRGKDSSASPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSG- 410

Query: 731 QGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
             Q++L   +    +  Y E       + + A D + + L+ +P  R +  + L+ P++K
Sbjct: 411 STQDQLYKQIG---RGSYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIK 467

>AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, 303
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPL031C (PHO85); 1-intron
          Length = 303

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/309 (25%), Positives = 133/309 (43%), Gaps = 53/309 (17%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           +++LE LG G  +               LK V  D  + +     + EI L+K+L+ +  
Sbjct: 9   FKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE-N 66

Query: 574 VVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGM----GLDVEFVRFHSQEMLKCVKVV 629
           +V+L D       L  V E  D+DL   +  R       GL++  V++   ++L+ V   
Sbjct: 67  IVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRGLELSLVKYFQWQLLQGVAFC 126

Query: 630 HDSGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPEAL 686
           H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ L
Sbjct: 127 HENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDVL 182

Query: 687 VAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM------ 740
           +                     DIWSCGCI+ +MI G+  + G     +L  I       
Sbjct: 183 MGSR------------TYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFETMGTP 230

Query: 741 --------------NPEVKIVYPEK-------TSNGDVVPKTAIDTMKACLERNPEKRWS 779
                         NP++ + YP K        +  + +    ++ ++  L+ NP  R S
Sbjct: 231 TEQTWVGVSQLPKYNPQIPL-YPNKDIKQLLQATTKEQISDVLVNLIQGLLQLNPSMRLS 289

Query: 780 VDEVLNGPF 788
             + L+ P 
Sbjct: 290 AQQALSHPL 298

>ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 452

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 119/252 (47%), Gaps = 47/252 (18%)

Query: 548 DEFDDSS--IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLA 603
           DE  D S  +E    E  +L +L+  P VVKL     D+  LY +++   G     H   
Sbjct: 120 DESQDVSKRVERIFAERTILSQLD-HPNVVKLFYTFHDNSRLYLLLQYIPGGELFYH--- 175

Query: 604 LRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIAN-- 660
           L+    LD +   F++ E+   +K +H+ GIV+ DLKP N +    G L + DFG++   
Sbjct: 176 LKERGTLDEDTAAFYAAEISCALKFLHEKGIVYRDLKPENCLLDADGHLVLTDFGLSKKS 235

Query: 661 -------AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSC 713
                  + PE    ++  + IGTP Y APE L      +G+P  +N        D +S 
Sbjct: 236 VDDNNSLSAPEDVSVLH--SIIGTPEYCAPEIL------KGEPYTRN-------CDWYSL 280

Query: 714 GCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMK----AC 769
           GC++Y M+ G+PPY G          +N +V +   +K   G  +P    D MK    A 
Sbjct: 281 GCLVYDMLVGKPPYTG----------VNHKVILNKIQKEKQGPRLPYYLSDGMKDWLGAL 330

Query: 770 LERNPEKRWSVD 781
           L+++  KRW VD
Sbjct: 331 LKKDCNKRWDVD 342

>KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.141
           YGL180W
          Length = 790

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 112/281 (39%), Gaps = 63/281 (22%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGM----- 608
           +E  + EI +LKK++    +V LID E +    Y +ME C   DL+  +  R  +     
Sbjct: 76  LENLEIEIAILKKIK-HNHIVSLIDCERNSDYFYLIMEYCSLGDLTFLIKRRKELTNYHP 134

Query: 609 ---------------GLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---- 649
                          GL   F+  + Q++   +K +    ++H D+KP N +        
Sbjct: 135 LLQKIFESYPSPNEYGLHHAFILNYLQQLASALKFLRSKNLIHRDIKPQNLLLCTPLIGY 194

Query: 650 ------------------ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
                             ILKI DFG A  +P  ++    ET  G+P YMAPE L     
Sbjct: 195 TDADTFHKLGYVGIYNLPILKIADFGFARFLPNSSM---AETLCGSPLYMAPEIL----- 246

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
                   N  K    +D+WS G ++++M  GRPP+           I      I +PE 
Sbjct: 247 --------NYQKYNAKADLWSVGTVLFEMYCGRPPFKASNHLELYKKIKRSNDVIQFPEL 298

Query: 752 TSNGDVVPKTAIDT---MKACLERNPEKRWSVDEVLNGPFV 789
            +NGD   +  ++    +   L  +P  R + DE  N   V
Sbjct: 299 IANGDDKDQEDLEIRALISKLLTFDPTNRITFDEFFNHKLV 339

>AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR028C
          Length = 536

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 108/238 (45%), Gaps = 38/238 (15%)

Query: 560 GEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRF 617
            E  +L +LE  P +VKL     DH  LY V++   G     H   L+    LD   V F
Sbjct: 213 AERTILSQLE-HPNIVKLFYSFHDHHKLYLVLQYIPGGELFYH---LKEQGTLDEVTVSF 268

Query: 618 HSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIAN---------AVPEHTV 667
           ++ E+   +K +H  GIV+ DLKP N +   KG L + DFG++             E   
Sbjct: 269 YAAEISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVNQADSPLGGEQVE 328

Query: 668 NIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 727
            +Y  + IGTP Y APE L       GQP  QN        D +S G + Y M+ G+PP+
Sbjct: 329 ELY--SIIGTPEYCAPEILC------GQPYTQN-------CDWYSLGSLTYDMLIGKPPF 373

Query: 728 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLN 785
            G      +L+ +  +  I  P   S+G        D + A L+++  KRW VD   +
Sbjct: 374 TG-ANHKVILSKIKQDKGIKIPHYLSDG------MKDYLNALLKKDIGKRWDVDRFWD 424

>Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON}
            similar to Ashbya gossypii AER264C
          Length = 1541

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 112/245 (45%), Gaps = 28/245 (11%)

Query: 558  FKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVR 616
             K E+ +L+ L   P +V+    E+    +   ME C    L+    L  G   D    +
Sbjct: 1290 IKDEMTVLEML-NHPNIVQYYGVEVHRDRVNIFMEYCEGGSLAS--LLEHGRIEDEMVTQ 1346

Query: 617  FHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRE--- 672
             +S ++L+ +  +H+SG+ H D+KP N +    GI+K +DFG A  +  +   +  E   
Sbjct: 1347 VYSLQLLEGLAYLHESGVHHRDIKPENILLDFNGIIKYVDFGAAKLIATNGSKVLTEDNG 1406

Query: 673  -----TQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 727
                   IGTP YM+PE++ A  Y           K G   DIWS GC++ +M+ GR P+
Sbjct: 1407 RDSTDKMIGTPMYMSPESISASGYG----------KFGS-DDIWSLGCVVLEMVTGRRPW 1455

Query: 728  GGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGP 787
                 Q    AIM        P   +  ++ P T I  +  CL ++P  R S  E+L  P
Sbjct: 1456 ANLDNQ---WAIMYQVAAGQIPSFPTKHEMSP-TGIKFLSRCLIQDPNMRSSAVELLMDP 1511

Query: 788  FVKPI 792
            ++  I
Sbjct: 1512 WIVEI 1516

>Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {ON}
           complement(156530..159514) [2985 nt, 995 aa]
          Length = 994

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 111/280 (39%), Gaps = 66/280 (23%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGM----- 608
           +E  + EI +LKK++  P +V+LI+ E      Y +ME C   DL+  +  R  +     
Sbjct: 73  LENLEVEIAILKKIK-HPHIVRLIECERTSTDFYLIMEYCALGDLTFLIKKRQEIMENHP 131

Query: 609 -----------------GLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFV----FV 647
                            GL   F+  + Q++   +K +    +VH D+KP N +    FV
Sbjct: 132 LLKSVFKRFPPPSKNHNGLHRAFILNYLQQLSSSLKFLRSKNLVHRDIKPQNLLLATPFV 191

Query: 648 KG------------------ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
                               ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 192 DYHDSKSFHDLGYVGISSLPILKIADFGFARFLPNTSM---AETLCGSPLYMAPEIL--- 245

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
                     N  K    +D+WS G ++Y+M YG+PP+           I      I Y 
Sbjct: 246 ----------NYQKYNAKADLWSVGTVLYEMCYGKPPFKASNHLELYKKIKKANNTISY- 294

Query: 750 EKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
              SN   +     D + A L  +P KR    E  +   V
Sbjct: 295 ---SNDCEIEDDLKDLINALLTFDPNKRIGFQEFFDNKLV 331

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 144/324 (44%), Gaps = 40/324 (12%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRV------SFDEFDDSSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V      S DE   S++E  + E+  LK 
Sbjct: 1214 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKD 1273

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E    +    +E        +L +R     D   +R  + ++L+ + 
Sbjct: 1274 LD-HLNIVQYLGFENKDNIYSLFLEYVAGGSVGSL-IRMYGRFDEPLIRHLNTQVLRGLA 1331

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + G+ KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1332 YLHSRGILHRDMKADNLLLDQDGVCKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1387

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GCI+ +M  G+ P+  ++    +  I   +
Sbjct: 1388 EMV---DTKQGYSAKV---------DIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSK 1435

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFF----- 798
                 P  T    ++ +   D + AC E +P+ R + D +L+ PF    AV  +F     
Sbjct: 1436 SAPPIPPDTL--PLISQNGRDFLDACFEIDPDNRPTADNLLSHPFS---AVDPYFDFKTT 1490

Query: 799  -IRDLIKNSVKYGANQ-REISNEK 820
             +   IK++ K  + + R IS EK
Sbjct: 1491 KLASFIKSNDKINSTKLRVISQEK 1514

>KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} similar
           to uniprot|P53104 Saccharomyces cerevisiae YGL180W ATG1
           Protein serine/threonine kinase required for autophagy
           and for the cytoplasm-to-vacuole targeting (Cvt) pathway
          Length = 831

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 110/280 (39%), Gaps = 66/280 (23%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGM----- 608
           +E  + EI +LKK++  P +V LID E      Y +ME C   DL+  +  R  +     
Sbjct: 63  LENLEVEIAILKKIK-HPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHP 121

Query: 609 -----------------GLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG-- 649
                            GL+   V  + Q++   +K +    +VH D+KP N +      
Sbjct: 122 LIKTVFEHYPPPSTEHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLL 181

Query: 650 --------------------ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
                               ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 182 DYNDPKTFHELGFVGIYNLPILKIADFGFARFLPNTSL---AETLCGSPLYMAPEIL--- 235

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
                     N  K    +D+WS G ++Y+M  GRPP+           I     +I  P
Sbjct: 236 ----------NYQKYNAKADLWSVGTVLYEMCCGRPPFKASNHLELFQKIKKANDEITVP 285

Query: 750 EKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
              SN  + PK   + ++  L  +P+ R    +  N   V
Sbjct: 286 ---SNCYIEPKL-FNLIRGLLTFDPDSRMGFTDFFNNEVV 321

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 115/246 (46%), Gaps = 39/246 (15%)

Query: 552  DSSIEGFKGEIELLKKLETKPR--VVKLIDHEMDHGVLYEVM----ECGDHDLSHTLALR 605
            D  +     EI+++  L  KP   ++ L+D   D    Y       E G  DL   +  +
Sbjct: 1166 DRQLGTIPSEIQIMATLNKKPHDNILSLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFK 1225

Query: 606  SGMGLDVEF-VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVP 663
            + M    EF  +   ++++  +K +HD GIVH D+K  N +   KG +KIIDFG A  V 
Sbjct: 1226 TNM---TEFEAKLIFKQIVSGIKHLHDQGIVHRDIKDENVIVDSKGCVKIIDFGSAAYVK 1282

Query: 664  EHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYG 723
                +++    +GT +Y APE L       G+P E      GKP DIW+ G ++Y +++ 
Sbjct: 1283 SGPFDVF----VGTIDYAAPEVL------SGEPYE------GKPQDIWAIGILLYTIVFK 1326

Query: 724  RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
              P+           I+  E+K       +N + + +  I+ +K  L R+  KR  ++E+
Sbjct: 1327 ENPFYNID------EILEGELKF------NNSNDISEDCIELIKKILIRSVPKRPLIEEI 1374

Query: 784  LNGPFV 789
             N  ++
Sbjct: 1375 FNDKWL 1380

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 124/279 (44%), Gaps = 26/279 (9%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
           +++ E++GRG                  +K ++ D  +D  +E  + EI+ L  L+  P 
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDE-VEDIRKEIQFLSSLKQTPN 74

Query: 574 VVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
           +       +    L+ +ME C    L  TL LR G+ ++ +++    +E+L  +  +H  
Sbjct: 75  ITHYYGSYLIDTKLWVIMEYCAGGSL-RTL-LRPGI-IEEKYIGVIMREILVALISIHRD 131

Query: 633 GIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            ++H D+K AN +    G +K+ DFG+A  + +  +   R+T  GTP +MAPE ++   Y
Sbjct: 132 NVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLK--RQTMAGTPYWMAPEVIMEGVY 189

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
              +             DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 190 YDTK------------VDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSK-----PPR 232

Query: 752 TSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
              G    +   + +  CL+ +P++R   +E+     +K
Sbjct: 233 LE-GREYSQPLKEFIALCLDEDPKERPYAEELFKSKLIK 270

>Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C
           (PHO85) - cyclin-dependent protein kinase [contig 27]
           FULL
          Length = 246

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 112/248 (45%), Gaps = 49/248 (19%)

Query: 574 VVKLIDHEMDHGVLYEVMECGDHDLSHTLALR----SGMGLDVEFVRFHSQEMLKCVKVV 629
           +V+L D       L  V E  D+DL   +  R    +  G ++  V++   ++L+ V   
Sbjct: 9   IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQLLQGVAFC 68

Query: 630 HDSGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPEAL 686
           H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ L
Sbjct: 69  HENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDVL 124

Query: 687 VAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM------ 740
           +                     DIWSCGCI+ +MI GRP + G   + +L  I       
Sbjct: 125 MGSR------------TYSTSIDIWSCGCILAEMITGRPLFPGTNDEEQLKLIFETMGTP 172

Query: 741 --------------NPEVKIVYPE------KTSNGDVVPKTAIDTMKACLERNPEKRWSV 780
                         NP++    P+      ++   + +  T ID +   L+ NP++R S 
Sbjct: 173 TERTWPGVSTLPKYNPQLPQHLPKDLGALLQSQTREKMDLTLIDLLYGLLQPNPDRRLSA 232

Query: 781 DEVLNGPF 788
            + LN P+
Sbjct: 233 KQALNHPW 240

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 152/342 (44%), Gaps = 42/342 (12%)

Query: 496 SGDSYNRRKPTIYVNGTE---YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDD 552
           S  SY   K +   +G+    Y+ ++ LG G                  LK ++      
Sbjct: 18  SNGSYVSNKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAK 77

Query: 553 SSIEG-FKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLD 611
           S ++G  + EI  L+ L   P ++KL D       +  V+E   ++L   +  R+ M  +
Sbjct: 78  SDMQGRIEREISYLRLLR-HPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRNKMS-E 135

Query: 612 VEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIY 670
            E  RF  Q+++  V+  H   IVH DLKP N +  + + +KI DFG++N + +     +
Sbjct: 136 QEARRFF-QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---F 191

Query: 671 RETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGF 730
            +T  G+PNY APE +    Y             G   D+WSCG I+Y M+  R P+   
Sbjct: 192 LKTSCGSPNYAAPEVISGKLYA------------GPEVDVWSCGVILYVMLCRRLPFD-- 237

Query: 731 QGQNRLLAIMNPEVKIVYPEKTSNGDVVPK----TAIDTMKACLERNPEKRWSVDEVLNG 786
                     +  + +++   ++    +PK     A D +K  L  NP  R S+ E++  
Sbjct: 238 ----------DESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLIVNPLNRISIHEIMQD 287

Query: 787 PFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDV 828
            + K + +  + +   +K   ++  N++  + E +EE+ +++
Sbjct: 288 EWFK-VDLAEYLVPQDLKQQEQF--NKKSGNEENVEEIDDEM 326

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 117/250 (46%), Gaps = 21/250 (8%)

Query: 553 SSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLD 611
            +++G   E+E+L+KL   P++V+L     D    Y +ME     DL   +A    +G D
Sbjct: 231 GNMDGVTRELEVLRKL-NHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGED 289

Query: 612 VEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 668
               R  ++++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      T  
Sbjct: 290 AG--REITRQVLEGVKYIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT-- 345

Query: 669 IYRETQIGTPNYMAPEALVAMNYTQGQPAEQN--RWKVGKPSDIWSCGCIIYQMIYGRPP 726
            + +T  GT  Y+APE +          AE+N  R +     D+WS GC++Y ++ G  P
Sbjct: 346 -FMKTFCGTLAYVAPEVIAGK-----ANAEENEKRNEYSSLVDMWSMGCLVYVILTGHLP 399

Query: 727 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNG 786
           + G   +     I N      Y E       +   A D + + L+ NP  R +  + L  
Sbjct: 400 FSGSTQEQLYKQIKNGS----YHEGPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEH 455

Query: 787 PFVKPIAVTH 796
           P++K   V H
Sbjct: 456 PWIKMGHVAH 465

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 115/258 (44%), Gaps = 40/258 (15%)

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHD 631
           P ++KL     D   LY ++E   +    ++  + G  L+ E  R++  ++L  +  +H 
Sbjct: 263 PGIIKLFFTFQDEANLYFLLEYAPNGDFLSIMKKYG-SLNEECARYYGAQILNGIYFLHR 321

Query: 632 SGIVHSDLKPANFVFVKGI-LKIIDFGIA------NAVPEHTVNIYRETQIGTPNYMAPE 684
            GI+H D+KP N +  K + +K+ DFG A      +   E+ +    ++ +GT  Y++PE
Sbjct: 322 HGIIHRDIKPENILLDKSMKVKLTDFGTAKLLNRKDGTEEYDLTTRSKSFVGTAEYVSPE 381

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 744
            L             + W V    DIW+ GCI++QMI G+PP   F+  N  L      +
Sbjct: 382 LL------------NDSW-VDHKCDIWAFGCILFQMIAGKPP---FKATNEYLTFQK-VM 424

Query: 745 KIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDL-I 803
           K+ Y          P    D +K  L + PE R ++ ++            H F  D+  
Sbjct: 425 KVQYAFTAG----FPMVVRDLVKQILVKKPEHRLTIPQIEK----------HLFFSDINF 470

Query: 804 KNSVKYGANQREISNEKI 821
           ++   + A   EI+  K+
Sbjct: 471 RDGSLWSAAAPEIAPYKV 488

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 118/241 (48%), Gaps = 14/241 (5%)

Query: 554 SIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDV 612
           +++G   E+E+L+KL   PR+V+L     D    Y VME     DL   +A    +G D 
Sbjct: 237 NMDGVTRELEVLQKL-NHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDA 295

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVNI 669
              R  S+++L  +K +H  GI H DLKP N +  +    ++KI DFG+A      +   
Sbjct: 296 G--REISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS--- 350

Query: 670 YRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 729
           + +T  GT  Y+APE +   + +      + R +     D+WS GC++Y ++ G  P+ G
Sbjct: 351 FMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSG 410

Query: 730 FQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
              Q++L   +    +  Y E       + + A D + + L+ +P  R +  + LN P++
Sbjct: 411 -STQDQLYKQIG---RGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWI 466

Query: 790 K 790
           K
Sbjct: 467 K 467

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 105/235 (44%), Gaps = 22/235 (9%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL   P V++L D    +  LY V+E  +      L +  G   + E VR
Sbjct: 83  GIEREI-IIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRGPLPENEAVR 141

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQI 675
           F  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A      + +   ET  
Sbjct: 142 FFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ESKDKLLETSC 197

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  R
Sbjct: 198 GSPHYAAPEIVSGLPYH------------GFESDVWSCGIILFALLTGRLPFDEEDGNIR 245

Query: 736 LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
            L +     K   P+       +   A D +   L  +P  R     +L  P ++
Sbjct: 246 NLLLKVQSGKFEMPDTNE----ISGEAQDLIAKILTVDPAARIKSRGILKHPLLQ 296

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1111

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 113/246 (45%), Gaps = 41/246 (16%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L++L     +++L     D   LY ++E   +    ++  + G  L+ E   ++S +++ 
Sbjct: 222 LQRLNNSRGIIRLYFTFQDEASLYFLLEYAPNGDFLSIMKKYG-SLNEECTCYYSAQIID 280

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAV------PEHTVNIYRETQ--I 675
            +K +H  GI+H D+KP N +  K + +K+ DFG A  +         T +++  ++  +
Sbjct: 281 AIKFLHQRGIIHRDIKPENILLDKEMKVKLTDFGTAKLLDGKSQASGETYDLHTRSKSFV 340

Query: 676 GTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 735
           GT  Y++PE L             + W V    DIW+ GCI++QMI G+PP   F+  N 
Sbjct: 341 GTAEYVSPELL------------NDNW-VDYRCDIWAFGCIVFQMIAGKPP---FKATNE 384

Query: 736 LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVT 795
            L      +K+ Y          P    D +K  L R P++R S+ ++            
Sbjct: 385 YLTFQK-VMKVQYAFTAG----FPVVVRDLVKRILLRQPDQRLSIPQIER---------- 429

Query: 796 HFFIRD 801
           H+F RD
Sbjct: 430 HYFYRD 435

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 116/240 (48%), Gaps = 19/240 (7%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVE 613
           ++G   E+E+L++L+  PR+V L     D    Y VME     DL   +A    +G D  
Sbjct: 228 MDGVARELEVLQRLD-HPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAG 286

Query: 614 FVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVNIY 670
             R  ++++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      T   +
Sbjct: 287 --REITRQILEAVKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGT---F 341

Query: 671 RETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGF 730
            +T  GT  Y+APE +   N  +    E N +      D+WS GC++Y ++ G  P+ G 
Sbjct: 342 MKTFCGTLAYVAPEVISGKNSGE---KEGNTY--SSLVDMWSIGCLVYVILTGHLPFSG- 395

Query: 731 QGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
             QN L   +       Y E       +   A D +++ L+ +P  R + ++ L  P++K
Sbjct: 396 STQNDLYKQITAG---SYHEGPLKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 117/241 (48%), Gaps = 14/241 (5%)

Query: 554 SIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDV 612
           +++G   E+E+L+KL   PR+V+L     D    Y VME     DL   +A    +G D 
Sbjct: 237 NMDGVTRELEVLQKL-NHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDFVAAHGAVGEDA 295

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVNI 669
              R  S+++L  VK +H  GI H DLKP N +  +    ++KI DFG+A      +   
Sbjct: 296 G--REISRQILAAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS--- 350

Query: 670 YRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 729
           + +T  GT  Y+APE +   + +      + R +     D+WS GC++Y ++ G  P+ G
Sbjct: 351 FMKTFCGTLAYVAPEVIRGKDSSVSPDECEERNEYSSLVDMWSMGCLVYVILTGHLPFSG 410

Query: 730 FQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
              Q++L   +    +  Y E       + + A D +   L+ +P  R +  + L+ P++
Sbjct: 411 -STQDQLYKQIG---RGSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKALDHPWI 466

Query: 790 K 790
           K
Sbjct: 467 K 467

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 125/295 (42%), Gaps = 36/295 (12%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEG-FKGEIELLKKLETKP 572
           Y+ ++ LG G                  LK ++      S ++G  + EI  L+ L   P
Sbjct: 46  YQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-HP 104

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
            ++KL D       +  VME   ++L   +  R  M  D E  RF  Q+++  V+  H  
Sbjct: 105 HIIKLYDVIKSKDEIIMVMEYAGNELFDYIVQRDKMSED-EARRFF-QQIISAVEYCHRH 162

Query: 633 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 163 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 219

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 220 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 255

Query: 752 TSNGDVVPK----TAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDL 802
            +    +PK     A   +K  L  NP  R S+ E++   + K     +   +DL
Sbjct: 256 NNGVYTIPKFLSQGASTLIKKMLIVNPLNRISIQEIMQDEWFKAGLPEYLIPQDL 310

>TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON}
           Anc_1.225 YJL128C
          Length = 816

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 128/290 (44%), Gaps = 38/290 (13%)

Query: 513 EYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKP 572
           E E L  LG G                  +K V   E D++       E+E+L K ++ P
Sbjct: 506 ELEFLSDLGHGNYGNVSKVLHKPTQVIMAMKEVRL-ELDEAKFRQILMELEVLHKCQS-P 563

Query: 573 RVVKLIDHEMDHGVLYEVMECGD-------HDLSHTLALRSGMGLDVEFVRFHSQEMLKC 625
            +V         G +Y  ME  D       +D++  +      G+D   + F S  +++ 
Sbjct: 564 YIVDFYGAFFIEGAVYMCMEYMDGSSLDKIYDITPEIG-----GIDEPQLAFISNAVIRG 618

Query: 626 VKVVHDS-GIVHSDLKPANFVF--VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 682
           ++ + D   I+H D+KP N +    +G +K+ DFG++  +    V    +T IG  +YMA
Sbjct: 619 LRELKDVHNIIHRDVKPTNILCSATQGTVKLCDFGVSGNL----VASMAKTNIGCQSYMA 674

Query: 683 PEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN---RLLAI 739
           PE + ++N       +   + V   SD+WS G  I +M  GR PY      N   +L AI
Sbjct: 675 PERIKSLN------PDMTTYSV--QSDVWSLGLSILEMALGRYPYPPETFDNIFSQLSAI 726

Query: 740 MNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
           ++       P  T   D   K A D +  CL +NPE+R +  ++L  P++
Sbjct: 727 VDG------PPPTLPLDRFSKDAYDFVAVCLRKNPERRPTYSQLLEHPWL 770

>CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028c
          Length = 542

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 118/250 (47%), Gaps = 42/250 (16%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDV 612
           IE    E  +L +LE  P +VKL     D   LY +++   G     H   L+    L+ 
Sbjct: 214 IERTFAERTILSQLE-HPNIVKLFYSFHDTSKLYLLLQYIPGGELFFH---LKEHGTLEE 269

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVK-GILKIIDFGI----ANAVPEHTV 667
           + V F++ E+   +K +H  G+V+ DLKP N +  + G L + DFG+    A+   +  +
Sbjct: 270 DTVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSASNASQEDL 329

Query: 668 NIYRETQ--------IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQ 719
               E +        IGTP Y APE L+      GQP   N        D +S GC++Y 
Sbjct: 330 GAGNEGEDVNELHSIIGTPEYCAPEILL------GQPYTAN-------CDWYSLGCLLYD 376

Query: 720 MIYGRPPYGGFQGQNRLLA--IMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKR 777
           M+ G+PPY G    ++++A  I N +     P   S+G        D + A L+ +P+KR
Sbjct: 377 MLTGKPPYTG--ANHKVIANKIKNDKQGPKIPYYLSDG------MKDVLGALLKSDPKKR 428

Query: 778 WSVDEVLNGP 787
           W VD+  + P
Sbjct: 429 WDVDKYWSEP 438

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 109/235 (46%), Gaps = 29/235 (12%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L++L     V+KL     D   LY ++E   +    ++  + G  L  E   ++S ++L 
Sbjct: 210 LQRLNDGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFG-SLSQECAVYYSAQILD 268

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPE----HTVNIYRETQ--IGT 677
            +  +H  GIVH D+KP N +  K + +K+ DFG A  + +     T N+   ++  +GT
Sbjct: 269 AIDYLHHKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGT 328

Query: 678 PNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 737
             Y++PE L+  NY            V    DIW+ GCI++QMI G+PP   F+  N  L
Sbjct: 329 AEYVSPE-LLNDNY------------VDYKCDIWAFGCILFQMIAGKPP---FKATNEYL 372

Query: 738 AIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPI 792
                 +K+ Y          P    D +K  L ++PE+R    ++    F K +
Sbjct: 373 TFQK-VMKVQYAFTAG----FPLVIRDLIKKILVKSPEQRLDASQIKKHHFFKDV 422

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 88.2 bits (217), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 109/239 (45%), Gaps = 35/239 (14%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++K L + P V+ L +   +   LY V+E  D        +  G   + E V 
Sbjct: 182 GIEREIVIMK-LISHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVH 240

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG--ILKIIDFGIANA-VPEHTVNIYRET 673
           +  Q +++ V   H   I H DLKP N +  K    +KI DFG+A   +P    N   +T
Sbjct: 241 YFKQ-IIQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMAALELP----NKLLQT 295

Query: 674 QIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 733
             G+P+Y +PE ++  +Y             G PSD+WSCG I++ ++ G  P+     +
Sbjct: 296 SCGSPHYASPEIVMGKSYH------------GGPSDVWSCGIILFALLTGHLPFNDDNIK 343

Query: 734 NRLLAIMNPEVKI---VYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
             LL +   + ++   + PE           A D +   L  +P KR + D +LN P +
Sbjct: 344 KLLLKVQAGKFRMPSTLSPE-----------AQDLISRILVIDPSKRITTDRILNHPLI 391

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 118/241 (48%), Gaps = 14/241 (5%)

Query: 554 SIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDV 612
           +++G   E+E+L+KL   PR+V+L     D    Y VME     DL   +A    +G D 
Sbjct: 237 NMDGVTRELEVLQKLH-HPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDA 295

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVNI 669
              R  S+++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      +   
Sbjct: 296 G--REISRQILEAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS--- 350

Query: 670 YRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 729
           + +T  GT  Y+APE +   + +      + R +     D+WS GC++Y ++ G  P+ G
Sbjct: 351 FMKTFCGTLAYVAPEVIRGKDSSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSG 410

Query: 730 FQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
              Q++L   +    +  Y E       + + A D + + L+ +P  R +  + L  P++
Sbjct: 411 -STQDQLYKQIG---RGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPWI 466

Query: 790 K 790
           K
Sbjct: 467 K 467

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 110/235 (46%), Gaps = 27/235 (11%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++ KL + P ++ L +   +   L+ V+E  +        +  G   + E V 
Sbjct: 116 GIEREI-IIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEAVH 174

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRETQ 674
           +  Q +++ V   H+  I H DLKP N +  K    +KI DFG+A      T N   ET 
Sbjct: 175 YFRQ-IIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAAL---ETTNKLLETS 230

Query: 675 IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 734
            G+P+Y +PE ++  NY             G PSD+WSCG I++ ++ G  P+     + 
Sbjct: 231 CGSPHYASPEIVMGKNYH------------GSPSDVWSCGIILFALLTGHLPFNDDNIKK 278

Query: 735 RLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
            LL + + +  +  P+  S+       A D +   L  +P  R +++EVL  P +
Sbjct: 279 LLLKVQSGKYHM--PQNISS------EAQDLISKILIVDPRGRITINEVLQHPLI 325

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/265 (27%), Positives = 115/265 (43%), Gaps = 41/265 (15%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMG-LDVEFVRFHSQEM 622
           L+++     +VKL     D   LY ++E C + D    L+L    G L+     ++S ++
Sbjct: 231 LQRINNSKMIVKLFFTFQDESSLYFLLEYCPNGDF---LSLMKKYGSLNETVACYYSAQV 287

Query: 623 LKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIY-----RETQIG 676
           +  +  +H +GI+H D+KP N +  K   +K+ DFG A  +   T N +      ++ +G
Sbjct: 288 IDAIDYLHTNGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKSFVG 347

Query: 677 TPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL 736
           T  Y+APE L             N   V    D+W+ GCI+YQMI G+PP   F+  N  
Sbjct: 348 TAEYVAPELL-------------NDSFVDYRCDVWAFGCILYQMIAGKPP---FKATNEY 391

Query: 737 LAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTH 796
           L      +K+ Y          P    D +K  L ++  +R         P +  I   H
Sbjct: 392 LTFQKV-MKVQYAFTAG----FPLIIRDLVKKILVKDLNQR---------PSISQIEKHH 437

Query: 797 FFIRDLIKNSVKYGANQREISNEKI 821
           FF     +N   +     EIS  KI
Sbjct: 438 FFREKNFQNGSVWSDPVPEISGFKI 462

>Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 107/239 (44%), Gaps = 44/239 (18%)

Query: 560 GEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRF 617
            E  +L ++E  P +VKL     D+  LY +++   G     H   L+    LD   V F
Sbjct: 202 AERSILSEIE-HPNIVKLFYSFHDNSKLYLLLQYIPGGELFYH---LKEHGTLDETTVSF 257

Query: 618 HSQEMLKCVKVVHDSGIVHSDLKPANFVFVK-GILKIIDFGI---------ANAVPEHTV 667
           ++ E+   ++ +H  G+V+ DLKP N +  + G L + DFG+         AN      V
Sbjct: 258 YAAEISCALRFLHTKGVVYRDLKPENCLLNQNGHLVLTDFGLSKKSADDSMANEEDPENV 317

Query: 668 NIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 727
           N      IGTP Y APE L    YTQ               D +S GC++Y M+ G+PPY
Sbjct: 318 NTLHSI-IGTPEYCAPEILSGQAYTQN-------------CDWYSLGCLLYDMLVGKPPY 363

Query: 728 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVP----KTAIDTMKACLERNPEKRWSVDE 782
            G           N +V I   ++   G  +P    +   D + A L++   KRW+VD+
Sbjct: 364 TG----------NNHKVIINKIQQNKQGPKIPFYLSEGMKDMLNALLKKETSKRWNVDK 412

>Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa] {ON}
            YNR031C (SSK2) - A MAP kinase kinase kinase; activator of
            Pbs2p [contig 17] FULL
          Length = 1542

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 120/248 (48%), Gaps = 30/248 (12%)

Query: 557  GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFV 615
              K E+ +L+ L   P VV+    E+    +   ME C    L+  L    G   D    
Sbjct: 1294 AIKEEMSVLEML-NHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLL--EHGRIEDEMVT 1350

Query: 616  RFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTV---NIYR 671
            + ++ +ML+ +  +H S +VH D+KP N +    G++K +DFG A ++  +     N+  
Sbjct: 1351 QIYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGA 1410

Query: 672  E-------TQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGR 724
            E       + +GTP YM+PE++          A++ ++  G   DIWS GC+I +M+ GR
Sbjct: 1411 EGKADGVNSMMGTPMYMSPESITG--------AKKGKFGSG---DIWSLGCVILEMVTGR 1459

Query: 725  PPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVL 784
             P+     +    AIM        P+  +  ++ P+  ID +  CL+++P KR +  E+L
Sbjct: 1460 RPWFNLDNE---WAIMYHVAAGHVPQLPTKEELSPQ-GIDFLLRCLKQDPNKRSTAMELL 1515

Query: 785  NGPFVKPI 792
              P++  I
Sbjct: 1516 LHPWMIEI 1523

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 116/245 (47%), Gaps = 37/245 (15%)

Query: 552  DSSIEGFKGEIELLKKLETKPR--VVKLIDHEMDHGVLYEVM----ECGDHDLSHTLALR 605
            D  +     EI+++  L   P   +++L+D   D    Y       E G  DL   +  +
Sbjct: 1144 DRKLGTIPSEIQIMATLNKTPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFK 1203

Query: 606  SGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPE 664
            + M  + E  +   ++++  +K +HD GIVH D+K  N +   KG +KIIDFG A  V  
Sbjct: 1204 TNMT-ECE-AKLIVKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKS 1261

Query: 665  HTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGR 724
               +++    +GT +Y APE L       G P E      GKP DIW+ G ++Y +++  
Sbjct: 1262 GPFDVF----VGTIDYAAPEVL------GGNPYE------GKPQDIWAIGILLYTVVFKE 1305

Query: 725  PPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVL 784
             P+           I+  ++K       +N + V +  I+ +K+ L R   KR ++D++ 
Sbjct: 1306 NPFYNID------EILEGDLKF------NNAEEVSEDCIELIKSILNRCVPKRPTIDDIN 1353

Query: 785  NGPFV 789
            NG ++
Sbjct: 1354 NGKWL 1358

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 87.8 bits (216), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 142/320 (44%), Gaps = 35/320 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDD------SSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V   ++        S++E  + E+  LK 
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1234

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E    +    +E        +L +R     D   ++  + ++LK + 
Sbjct: 1235 LD-HLNIVQYLGFENKDNIYSLFLEYVAGGSVGSL-IRMYGRFDEPLIKHLTTQVLKGLA 1292

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + GI KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1293 YLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1348

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GCI+ +M  G+ P+   +    +  I   +
Sbjct: 1349 EMV---DTKQGYSAK---------VDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1396

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFF----I 799
                 PE T    ++ +     + AC E NPEKR +  E+L+  F   + VT  F    +
Sbjct: 1397 SAPPIPEDTL--PLISQVGRGFLDACFEINPEKRPTATELLSHRF-SVVNVTFDFKSTEL 1453

Query: 800  RDLIKNSVKYGANQREISNE 819
               IK++ K  +++  I+++
Sbjct: 1454 AKFIKSNDKLNSSKLRITSQ 1473

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score = 85.9 bits (211), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 86/328 (26%), Positives = 142/328 (43%), Gaps = 35/328 (10%)

Query: 504 KPTIYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEF--DDSSIEGFKGE 561
           +P+ Y+N ++Y   + LG G                  +K +       +D  ++    E
Sbjct: 37  QPSSYINKSDYVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKALKGNDVQLQMLYDE 96

Query: 562 IELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQE 621
           + +L++L   P +V+  D        Y V +           L+ G   +V+ V+   Q 
Sbjct: 97  LSILQRLH-HPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVDAVKIIIQ- 154

Query: 622 MLKCVKVVHDSGIVHSDLKPANFVFV----KGILKIIDFGIANAVPEHTVNIYRETQIGT 677
           MLK ++ +H   IVH DLKP N +++       L I DFGIA  + +    I++    G+
Sbjct: 155 MLKAIEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAKELKDGDDLIFKAA--GS 212

Query: 678 PNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 737
             Y+APE L     T G          GKP DIWS G I Y ++ G   Y  F  +  + 
Sbjct: 213 LGYVAPEVLT----TNGH---------GKPCDIWSLGVITYTLLCG---YSAFIAET-VE 255

Query: 738 AIMNPEVKIVYPEKTSN--GDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAV- 794
             +      +YP K      + V + A + +   L  NP++R +  E+LN P++K  ++ 
Sbjct: 256 GFLEECTSNIYPVKFHEPYWNNVSREAKEFILKALTLNPDERPTATELLNDPWIKSKSLQ 315

Query: 795 THFFIRDLIKNSVKYGANQREISNEKIE 822
           TH  + D     VK G + R+   E +E
Sbjct: 316 THDLLPD-----VKKGFDARKKFREAVE 338

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 111/237 (46%), Gaps = 29/237 (12%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++K L +   V+ L +   +   LY V+E  D        +  G   + E + 
Sbjct: 160 GIEREIVIMK-LISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIH 218

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG--ILKIIDFGIANA-VPEHTVNIYRET 673
           +  Q +++ V   H   I H DLKP N +  K    +KI DFG+A   +P    N   +T
Sbjct: 219 YFKQ-IVEGVSFCHSFNICHRDLKPENLLLDKKNRKIKIADFGMAALELP----NKLLKT 273

Query: 674 QIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 733
             G+P+Y +PE ++      G+P        G PSD+WSCG +++ ++ G  P+     +
Sbjct: 274 SCGSPHYASPEIVM------GRPYH------GGPSDVWSCGIVLFALLTGHLPFNDDNIK 321

Query: 734 NRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
             LL + + + ++  P   S        A D +   L  NPEKR +  E+LN P +K
Sbjct: 322 KLLLKVQSGKYQM--PMNLS------AEARDLISKILVINPEKRITTQEILNHPLIK 370

>CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa]
           {ON} similar to uniprot|P53104 Saccharomyces cerevisiae
           YGL180w APG1 essential for autophagocytosis
          Length = 942

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 110/280 (39%), Gaps = 66/280 (23%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGM----- 608
           +E  + EI +LKK++  P +V LID E      Y VM+ C   DL+  +  R  +     
Sbjct: 54  LENLEIEIAILKKIK-HPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHP 112

Query: 609 -----------------GLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG-- 649
                            GL+  FV  + Q++   +K +    +VH D+KP N +      
Sbjct: 113 LLQTVFNKYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLT 172

Query: 650 --------------------ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
                               ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 173 NYRDSKTFHELGYVGIYNLPILKIADFGFARFLPSTSL---AETLCGSPLYMAPEIL--- 226

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
                     N  K    +D+WS G ++++M  G PP+           I     +I +P
Sbjct: 227 ----------NYQKYNAKADLWSVGTVLFEMCCGVPPFTASNHLELFKKIKRAHDEINFP 276

Query: 750 EKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
           E     D +     + + + L  +P KR   +E  N   V
Sbjct: 277 EVCEVEDGLK----ELICSLLTFDPAKRIGFEEFFNNKIV 312

>Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}
           similar to Ashbya gossypii ACL191C
          Length = 365

 Score = 84.7 bits (208), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 124/271 (45%), Gaps = 59/271 (21%)

Query: 561 EIELLKKLETKPRVVKLID-------HEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVE 613
           E++LLK   +   ++ ++D        E D   +Y V E  + DL   ++ ++   L  +
Sbjct: 59  ELKLLKFFHSHENIISVLDIVRPTSYQEFD--AVYLVQELMETDLQRIIS-QTNNFLSDD 115

Query: 614 FVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVP------EHT 666
            +++ + ++L+ +K +H + ++H DLKP+N +      LK+ DFG++  +       E+ 
Sbjct: 116 HIQYFTYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENM 175

Query: 667 VNIYRETQIGTPNYMAPEALVAMN-YTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRP 725
           V    E  + T  Y APE +++   YT                DIWSCGCI+ +MI G+P
Sbjct: 176 VGFMTE-YVATRWYRAPEIMLSFQEYTTAM-------------DIWSCGCILAEMISGKP 221

Query: 726 PYGGFQGQNRLLA------------------------IMNPEVKIVYPEKTSNG--DVVP 759
            + G    ++L                          I+N  +++  P   + G  D+ P
Sbjct: 222 LFPGRDYHHQLWVILEILGTPSYEDFAQIKSKRAKAYILNLPMRLKIPWNVALGTNDINP 281

Query: 760 KTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
             A+D +   L  NP+KR S +E L  P+++
Sbjct: 282 -LAMDLLDKMLTFNPDKRISAEEALKHPYLE 311

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 125/285 (43%), Gaps = 30/285 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDD------SSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V   ++         ++E  + E+  LK 
Sbjct: 1178 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKD 1237

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E  + +    +E        +L +R     D   +R  + ++LK + 
Sbjct: 1238 LD-HLNIVQYLGFENKNNIYSLFLEYVAGGSVGSL-IRMYGRFDESLIRHLTTQVLKGLA 1295

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + GI KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1296 YLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1351

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GCI+ +M  G+ P+   +    +  I   +
Sbjct: 1352 EMV---DTKQGYSAK---------VDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1399

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
                 PE T    ++ +     + AC E NPE+R +  E+L+  F
Sbjct: 1400 SAPPIPEDTL--PLISQVGRSFLDACFEINPEERPTATELLSHQF 1442

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 144/326 (44%), Gaps = 37/326 (11%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDS------SIEGFKGEIELLKK 567
            + K E++G+G                  +K+V   ++         ++E  + E+  LK 
Sbjct: 1124 WIKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYGSQNEQIIHTVEALRAEMSTLKN 1183

Query: 568  LETKPRVVKLIDHEMDH--GVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKC 625
            L+    V  L     DH   +  E +  G    S    +R     D   ++  + ++L+ 
Sbjct: 1184 LDHLNIVQYLGFEAKDHMNSLFLEYVAGG----SVGSLIRMYGRFDEVMIKHLTTQVLRG 1239

Query: 626  VKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTPNYM 681
            +  +H  GI+H D+K  N +   +G+ KI DFGI+      + +IY  +++   GT  +M
Sbjct: 1240 LSYLHSRGILHRDMKADNLLLDQEGVCKISDFGIS----RKSKDIYSNSEMTMRGTVFWM 1295

Query: 682  APEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 741
            APE +   +  QG  A+          DIWS GC++ +M  G+ P+   +    +  I  
Sbjct: 1296 APEMV---DTAQGYSAK---------VDIWSMGCVVLEMFAGKRPWSNLEVVAAMFKIGK 1343

Query: 742  PEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHF---F 798
             +     PE T    ++ ++  D + AC + +PE R + D+ L+ PF+       F    
Sbjct: 1344 SKSAPPIPEDTL--PLISQSGRDFIDACFQIDPEARPTADKQLSHPFILEKENFDFKSTK 1401

Query: 799  IRDLIKNSVKYGANQREISNEKIEEL 824
            + +LIK++ K  + +  +S+ +  +L
Sbjct: 1402 LAELIKSNDKVNSTKLRVSSHEKSQL 1427

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 87.4 bits (215), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 116/246 (47%), Gaps = 39/246 (15%)

Query: 552  DSSIEGFKGEIELLKKLETKPR--VVKLIDHEMDHGVLYEVM----ECGDHDLSHTLALR 605
            D  +     EI+++  L  KP   +++L+D   D    Y       E G  DL   +  +
Sbjct: 1141 DRKLGTIPSEIQIMATLNKKPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFK 1200

Query: 606  SGMGLDVEF-VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVP 663
            + M    EF  +   ++++  +K +HD GIVH D+K  N +   KG +KIIDFG A  V 
Sbjct: 1201 TNM---TEFEAKLIFKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVK 1257

Query: 664  EHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYG 723
                +++    +GT +Y APE L       G P E      G+P DIW+ G ++Y +++ 
Sbjct: 1258 SGPFDVF----VGTIDYAAPEVL------GGNPYE------GQPQDIWAIGILLYTVVFK 1301

Query: 724  RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
              P+           I+  ++K       +N + V +  I+ +K+ L R   KR ++D++
Sbjct: 1302 ENPFYNID------EILEGDLKF------NNAEGVSEDCIELIKSILNRCVPKRPTIDDI 1349

Query: 784  LNGPFV 789
             N  ++
Sbjct: 1350 NNDKWL 1355

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 116/246 (47%), Gaps = 39/246 (15%)

Query: 552  DSSIEGFKGEIELLKKLETKPR--VVKLIDHEMDHGVLYEVM----ECGDHDLSHTLALR 605
            D  +     EI+++  L  KP   +++L+D   D    Y       E G  DL   +  +
Sbjct: 1140 DRKLGTIPSEIQIMATLNKKPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFK 1199

Query: 606  SGMGLDVEF-VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVP 663
            + M    EF  +   ++++  +K +HD GIVH D+K  N +   KG +KIIDFG A  V 
Sbjct: 1200 TNM---TEFEAKLIFKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVK 1256

Query: 664  EHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYG 723
                +++    +GT +Y APE L       G P E      G+P DIW+ G ++Y +++ 
Sbjct: 1257 SGPFDVF----VGTIDYAAPEVL------GGNPYE------GQPQDIWAIGILLYTVVFK 1300

Query: 724  RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
              P+           I+  ++K       +N + V +  I+ +K+ L R   KR ++D++
Sbjct: 1301 ENPFYNID------EILEGDLKF------NNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1348

Query: 784  LNGPFV 789
             N  ++
Sbjct: 1349 NNDKWL 1354

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 115/242 (47%), Gaps = 15/242 (6%)

Query: 554 SIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDV 612
           +++G   E+E+L+KL   PR+V L     D    Y VME     DL   +A    +G   
Sbjct: 227 NMDGVSRELEVLQKL-NHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVG--E 283

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVNI 669
           E  R  S+++L+ ++ +H  GI H DLKP N +  +    ++KI DFG+A      ++  
Sbjct: 284 EAGREISRQILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSI-- 341

Query: 670 YRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKV-GKPSDIWSCGCIIYQMIYGRPPYG 728
             +T  GT  Y+APE +       G+   +          D+WS GC+++ ++ G  P+ 
Sbjct: 342 -MKTFCGTLAYVAPEVIGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPFS 400

Query: 729 GFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
           G   Q +L   +    K  Y E       +   A D +   L+ +  KR +VD+ LN P+
Sbjct: 401 G-STQEQLYEQIR---KGSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPW 456

Query: 789 VK 790
           +K
Sbjct: 457 IK 458

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 127/285 (44%), Gaps = 30/285 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRV------SFDEFDDSSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V      S DE   S+++  K E+  LK 
Sbjct: 1254 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIMSTVDAIKSEVSTLKD 1313

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E    +    +E        +L +R     D   +R  + ++L+ + 
Sbjct: 1314 LD-HLNIVQYLGFENKDNIYSLFLEYVAGGSVGSL-IRIYGRFDEPLIRHLNIQVLRGLA 1371

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + G+ KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1372 YLHARGILHRDMKADNLLLDQDGVCKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1427

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GCI+ +M  G+ P+  F+    +  I   +
Sbjct: 1428 EMV---DTKQGYSAKV---------DIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGKSK 1475

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
                 PE T    ++     + + AC E +P+KR + DE+L   F
Sbjct: 1476 SAPPIPEDTL--PLISAEGREFLDACFEIDPDKRPTADELLYHTF 1518

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 109/233 (46%), Gaps = 29/233 (12%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L++L     ++KL     D   LY ++E   +    ++  + G  L+ +   ++S ++L 
Sbjct: 215 LQRLNDGRGIIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKYG-SLNQDCSVYYSAQILD 273

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPE----HTVNIYRETQ--IGT 677
            +  +H  G++H D+KP N +  K + +K+ DFG A  V +     T N+   ++  +GT
Sbjct: 274 AIDYLHQKGVIHRDIKPENILLDKDMKVKLTDFGTAKLVEKDETTQTYNLLERSKSFVGT 333

Query: 678 PNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 737
             Y++PE L+  NY            V    DIW+ GCI++QMI G+PP   F+  N  L
Sbjct: 334 AEYVSPE-LLNDNY------------VDYKCDIWAFGCILFQMIAGKPP---FKATNEYL 377

Query: 738 AIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                 +K+ Y          P    D +K  L +NPE+R    +V    F K
Sbjct: 378 TFQK-VMKVQYAFTAG----FPLIIRDLIKQILVKNPEQRLDTLQVKKHHFFK 425

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/320 (23%), Positives = 144/320 (45%), Gaps = 35/320 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDD------SSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V   ++        S++E  + E+  LK 
Sbjct: 1181 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1240

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E  + +    +E        +L +R     D   ++  + ++L+ + 
Sbjct: 1241 LD-HLNIVQYLGFENKNSIYSLFLEYVAGGSVGSL-IRMYGRFDESLIKHLTTQVLRGLA 1298

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + GI KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1299 YLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1354

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GCI+ +M  G+ P+   +    +  I   +
Sbjct: 1355 EMV---DTKQGYSAKV---------DIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1402

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFF----I 799
                 PE T    ++ +     + AC E +PEKR +  ++L+  F + + VT  F    +
Sbjct: 1403 SAPPIPEDTL--PLITRVGRSFLDACFEIDPEKRPTATKLLSHQFSE-VDVTFDFKSTTL 1459

Query: 800  RDLIKNSVKYGANQREISNE 819
               IK++ K  +++  I+++
Sbjct: 1460 AKFIKSNDKLNSSKLRITSQ 1479

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 111/242 (45%), Gaps = 22/242 (9%)

Query: 551 DDSSIEGFKGEIEL-LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMG 609
           +D S+  +  E E+ + KL + P V+ L D    +  LY ++E  +      L +  G  
Sbjct: 65  NDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPL 124

Query: 610 LDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVN 668
            + E +    Q ++  +   H  GIVH DLKP N +      +KI DFG+A    +  + 
Sbjct: 125 PEREAINCFRQ-IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADL- 182

Query: 669 IYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYG 728
              ET  G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+ 
Sbjct: 183 --LETSCGSPHYAAPEIVSGLPYE------------GFASDVWSCGVILFALLTGRLPFD 228

Query: 729 GFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
              G  R L +   + +   P  T     + + A D +   L  +P +R  + ++L+ P 
Sbjct: 229 EENGNVRDLLLKVQKGQFEMPNDTE----ISRDAQDLIGKILVVDPRQRIKIRDILSHPL 284

Query: 789 VK 790
           +K
Sbjct: 285 LK 286

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 112/237 (47%), Gaps = 29/237 (12%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++K L + P V+ L +   +   L+ V+E  D        +  G   + E V 
Sbjct: 165 GIEREIVIMK-LISHPNVMGLYEVWENKSELFLVLEYVDGGELFDYLVSRGKLSEREAVH 223

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI--LKIIDFGIANA-VPEHTVNIYRET 673
           +  Q +++ V   H   I H DLKP N +  K I  +KI DFG+A   +P    N    T
Sbjct: 224 YFKQ-IIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGMAALELP----NKLLVT 278

Query: 674 QIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 733
             G+P+Y +PE ++  +Y             G PSD+WSCG I++ ++ G  P+     +
Sbjct: 279 SCGSPHYASPEIVMGKSYH------------GSPSDVWSCGIILFALLTGHLPFNDDSIK 326

Query: 734 NRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
             LL + + + ++  P+  S        A D +   L  +PEKR  ++++L  P ++
Sbjct: 327 KLLLKVQSGKFQM--PQNIS------LEAEDLISRILVVDPEKRIQINDILIHPLIR 375

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 107/229 (46%), Gaps = 32/229 (13%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L++L     +++L     D   LY ++E   +    ++  + G  L+ E   ++  ++L 
Sbjct: 222 LQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDFLSVMKKYG-SLNEECACYYGAQILD 280

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHT---------VNIYRETQ 674
            +  +H  GI+H D+KP N +  K + +KI DFG A  + E T         +    ++ 
Sbjct: 281 AIGFMHTRGIIHRDIKPENILMDKDMKVKITDFGTAKILDEKTNGNNKTSYELLTRSKSF 340

Query: 675 IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 734
           +GT  Y++PE L+  NY+  +             DIW+ GCI+YQMI G+PP   F+  N
Sbjct: 341 VGTAEYVSPE-LLNDNYSDSR------------CDIWAFGCILYQMIAGKPP---FKATN 384

Query: 735 RLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
             L      +K+ Y          P    D +K  L + PE+R ++ ++
Sbjct: 385 EYLTFQK-VMKVQYAFTAG----FPTIIRDLIKRILLKVPEQRLTIGQI 428

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 112/235 (47%), Gaps = 47/235 (20%)

Query: 561  EIELLKKLETKPR--VVKLIDHEMDHGVLYEVM----ECGDHDLSHTLALRSGMGLDVEF 614
            EI+++  L+ KP   ++KL+D   D    Y       E G  DL   + L++ M    E+
Sbjct: 1118 EIQIMATLQKKPHENIMKLLDFFEDDQYYYIESPMHGETGSIDLFDLIELKTNM---TEY 1174

Query: 615  -VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRE 672
              +   +++   VK +HD+GIVH D+K  N +   KG +K+IDFG A  V     +++  
Sbjct: 1175 EAKLLFKQITSGVKHLHDNGIVHRDIKDENVIVDNKGCVKLIDFGSAAYVKRGPFDVF-- 1232

Query: 673  TQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG--- 729
              +GT +Y APE L      +G P E      GKP DIW+ G ++Y +IY   P+     
Sbjct: 1233 --VGTIDYAAPEVL------EGDPYE------GKPQDIWAIGVLLYTIIYKENPFYNVDE 1278

Query: 730  -FQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
               G  R+    NP V            +V +  +  +   L+R+  KR +VD++
Sbjct: 1279 ILDGDLRI----NPSV------------IVSEECVALITMVLDRSLSKRPTVDDI 1317

>Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} similar to
            Ashbya gossypii ACR191C
          Length = 1143

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 87/332 (26%), Positives = 138/332 (41%), Gaps = 39/332 (11%)

Query: 478  IVEPLKTTESIPLKPPATSGDSYNRRKPTIY-VNGTEYEKLELLGRGGSSXXXXXXXXXX 536
            +V P++   + P+KP   S   + R+ P    V+  ++  L++LG+G             
Sbjct: 781  VVTPIQPLSTSPIKP--HSAGRHKRKSPKRRKVSLDDFILLKVLGKGNFGKVLLAKSKNT 838

Query: 537  XXXXXLKRVSFDEF-DDSSIEGFKGE--IELLKKLETKPRVVKLIDHEMDHGVLYEVME- 592
                 +K +  D    +  IE  + E  + LL      P +  L         +Y  ME 
Sbjct: 839  DRLCAIKVLKKDHIIQNHDIESARAEKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEF 898

Query: 593  CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGIL 651
             G  DL   +       L V   +F++ E+L  +K  HD+GI++ DLK  N +  ++G +
Sbjct: 899  IGGGDLMWHV---QNQRLSVRRAKFYAAEVLLALKYFHDNGIIYRDLKLENILLTLEGHI 955

Query: 652  KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIW 711
            KI D+G+      H       T  GTP +MAPE L    YT             K  D W
Sbjct: 956  KIADYGLCKDNMWHGNKT--STFCGTPEFMAPEILKEQAYT-------------KAVDWW 1000

Query: 712  SCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLE 771
            + G ++YQM+  + P+ G        AI+  E   +YP   + GD+V        +  L 
Sbjct: 1001 AFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEP--LYPIDMA-GDIV-----QIFQGLLT 1052

Query: 772  RNPEKRWSVD-----EVLNGPFVKPIAVTHFF 798
            ++PEKR         EV+  PF + I     F
Sbjct: 1053 KDPEKRLGAGTRDALEVMEEPFFRNINFDDIF 1084

>Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W
           (KSS1) - MAP protein kinase homolog involved in
           pheromone signal transduction [contig 242] FULL
          Length = 365

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 133/317 (41%), Gaps = 60/317 (18%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRV---SFDEFDDSSIEGFKGEIELLKKLET 570
           Y+ +EL+G G                  +K++   S + F   ++     E++LLK   +
Sbjct: 13  YQLVELVGEGAYGTVCSAVHKPSGTKVAIKKIQPFSKEMFVTRTLR----ELKLLKLFHS 68

Query: 571 KPRVVKLID----HEMD-HGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKC 625
              ++ ++D      MD    +Y V E  + DL H +    G  L  + +++ + ++L+ 
Sbjct: 69  HENIISVLDVVRPTSMDKFQAVYLVQELMETDL-HKVISSGGASLSDDHIQYFTYQILRA 127

Query: 626 VKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHT-----VNIYRETQIGTPN 679
           +K +H + ++H D+KP+N +      LK+ DFG+A  +   T     +  +    + T  
Sbjct: 128 LKAIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLISSTHSRQNLVGFMTEYVATRW 187

Query: 680 YMAPEALVAMN-YTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLA 738
           Y APE ++    YT                DIWSCGCI+ +MI G+P + G    ++L  
Sbjct: 188 YRAPEIMLTFQQYTVAM-------------DIWSCGCILAEMITGKPLFPGRDYHHQLWL 234

Query: 739 IMNP--------------------------EVKIVYPEKTSNGDVVPKTAIDTMKACLER 772
           I+                              K+ +       D+ P+ A+D +   L  
Sbjct: 235 ILEALGTPSYEDFENINSKRAKEYIANLPLRQKLPWQVVLQKQDINPQ-AVDLLDKMLTF 293

Query: 773 NPEKRWSVDEVLNGPFV 789
           NP+KR S  E L  P++
Sbjct: 294 NPDKRISAAEALAHPYL 310

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 103/228 (45%), Gaps = 21/228 (9%)

Query: 564 LLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEML 623
           ++ KL + P V+ L D    +  LY ++E  +      L +  G   + E V+   Q ++
Sbjct: 71  VVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEAVKCFRQ-II 129

Query: 624 KCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 682
             +   H  GIVH DLKP N +      +KI DFG+A    +  +    ET  G+P+Y A
Sbjct: 130 IAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARL---LETSCGSPHYAA 186

Query: 683 PEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 742
           PE +  + Y             G  SD+WSCG I++ ++ GR P+    G  R L +   
Sbjct: 187 PEIVSGLPYR------------GFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQ 234

Query: 743 EVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
             +   P+ T     + K A + +   L  +P +R    ++L  P +K
Sbjct: 235 RGQFEMPDATE----ISKDAQNLISRILVVDPTQRMKTRDILTHPLLK 278

>Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 110/280 (39%), Gaps = 66/280 (23%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGM----- 608
           +E  + EI +LKK++  P +V LID E      Y +ME C   DL+  L  R  +     
Sbjct: 67  LENLEIEIAILKKIK-HPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHP 125

Query: 609 -----------------GLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANF------- 644
                            GL   FV  + Q++   +K +    +VH D+KP N        
Sbjct: 126 LLRTVFEKYPPPSESHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLI 185

Query: 645 ---------------VFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
                          ++   ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 186 GYHDSKTFHELGFVGIYNLPILKIADFGFARFLPNTSL---AETLCGSPLYMAPEIL--- 239

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
                     N  K    +D+WS G ++++M  G PP+           I      I +P
Sbjct: 240 ----------NYQKYNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDAITFP 289

Query: 750 EKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
              S  ++ P+     + + L  +P KR   +E  N   V
Sbjct: 290 ---SYCNIEPELK-KLICSLLTFDPAKRIGFEEFFNNKVV 325

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 118/247 (47%), Gaps = 39/247 (15%)

Query: 552  DSSIEGFKGEIELLKKLETKPR--VVKLIDHEMDHGVLYEVME----CGDHDLSHTLALR 605
            D ++     EI+++  L  KP   +++++D   D    Y   E     G  DL   + L+
Sbjct: 1013 DRTLGTIPSEIQIMVTLNRKPHENILRILDFFEDDDYYYLETEMHGETGSIDLFDLIELK 1072

Query: 606  SGMGLDVEF-VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFV-KGILKIIDFGIANAVP 663
            + M    EF  +   +++   +K +HD+GIVH D+K  N +   KG +K+IDFG A  V 
Sbjct: 1073 TNM---TEFEAKLLFKQVASGIKHLHDNGIVHRDIKDENVIVDNKGFVKLIDFGSAAYVK 1129

Query: 664  EHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYG 723
                +++    +GT +Y APE L       G+P E      GKP DIW+ G ++Y +IY 
Sbjct: 1130 SGPFDVF----VGTIDYAAPEVL------GGEPYE------GKPQDIWAIGVLLYTIIYK 1173

Query: 724  RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
              P+           I++ +++I    + S         +  ++  L R+  KR ++D++
Sbjct: 1174 ENPFYNID------EILDGDLRIQSTHEVS------AECVALIRKILNRSVSKRPTIDDI 1221

Query: 784  LNGPFVK 790
            +   +++
Sbjct: 1222 MEDSWLQ 1228

>Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {ON}
           YKL168C (KKQ8) - probable serine/threonine-specific
           protein kinase (EC 2.7.1.-) [contig 108] FULL
          Length = 700

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 109/239 (45%), Gaps = 41/239 (17%)

Query: 572 PRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVH 630
           P ++K++D    H    EV+E C   DL   L+  S  GL         +++L  VK +H
Sbjct: 468 PNILKMLDLMQTHDGFIEVLEFCPSGDLYSLLSRTSKNGLHPLEADCFMKQLLHGVKYMH 527

Query: 631 DSGIVHSDLKPANFVFV-KGILKIIDFG---IANAVPEHTVNIYRETQIGTPNYMAPEAL 686
           D GI H DLKP N +F  +G+LKI DFG   +     E  V+ ++   +G+  Y+APE  
Sbjct: 528 DHGIAHCDLKPENILFGPQGVLKICDFGTSCVFQTAWEKQVH-FQTGAVGSEPYVAPEEF 586

Query: 687 VAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGR-----------PPYGGFQGQNR 735
           +A            R    +  D WSCG I   M+ G            P Y  F  + R
Sbjct: 587 IA-----------EREYDPRLVDSWSCGVIYCTMVLGHYLWKIPLVDKDPVYKSFVEEMR 635

Query: 736 ----LLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                +AI   ++K V PE       V +     + A  + NPEKR S++++L+  ++K
Sbjct: 636 SKREFVAI--EDLKHVTPE-------VNRCRKLCLYAIFQWNPEKRTSIEKLLHSNWMK 685

>NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON}
           Anc_3.229
          Length = 535

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 128/299 (42%), Gaps = 76/299 (25%)

Query: 560 GEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDVEFVRF 617
            E  +L +LE  P +VKL     D+  LY +++   G     H   L+    LD   V +
Sbjct: 207 AERSILSELE-HPNIVKLFYSFHDNSKLYLLLQYIPGGELFFH---LKEYGTLDETTVAY 262

Query: 618 HSQEMLKCVKVVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQ-- 674
           ++ E+   +K +HD GIV+ DLKP N +  + G L + DFG++       VN    ++  
Sbjct: 263 YAAEISCALKFLHDKGIVYRDLKPENCLLNETGHLVLTDFGLSKKSVSQEVNSELNSEDT 322

Query: 675 -----------------IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCII 717
                            IGTP Y APE L      +G P ++N        D +S GC++
Sbjct: 323 DTPTEQIGENVDTLHSIIGTPEYCAPEIL------KGLPYDRN-------CDWYSLGCLL 369

Query: 718 YQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMK----ACLERN 773
           Y M+ G+PPY G   +     I+N   KI   +K   G  +P    D MK      L+++
Sbjct: 370 YDMLSGKPPYTGVDHK----VILN---KI---QKDKTGPKIPFYLSDGMKDMLTWLLKKD 419

Query: 774 PEKRWSVDEVLNGPFVKPIAV------------------THFFIRDLIKNSVKYGANQR 814
             KRW VD+     +  PIA                   +HF  R +  N ++ G  Q+
Sbjct: 420 RSKRWDVDK-----YWAPIANNNKKLKKKNGKERTSDFQSHFIFRKIDWNLLESGELQK 473

>KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] {ON}
            similar to uniprot|P53599 Saccharomyces cerevisiae
            YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
            kinase kinase kinase activator of Pbs2p
          Length = 1523

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 115/248 (46%), Gaps = 30/248 (12%)

Query: 557  GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFV 615
              K E+ +L+ L   P VV+    E+    +   ME C    L+  L    G   D    
Sbjct: 1278 AIKEEMSVLEML-NHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLL--EHGRIEDEMVT 1334

Query: 616  RFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRE-- 672
            + ++ +ML+ +  +H S +VH D+KP N +    G++K +DFG A ++  +   +     
Sbjct: 1335 QVYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKVANNGS 1394

Query: 673  --------TQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGR 724
                    + +GTP YM+PE++              + K G  SDIWS GC+I +M  GR
Sbjct: 1395 EGKTDGVNSMMGTPMYMSPESVTG----------AKKGKFGS-SDIWSLGCVILEMATGR 1443

Query: 725  PPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVL 784
             P+     +    AIM        P+  S  ++ P+   D +  CL+++P+KR +  E+L
Sbjct: 1444 RPWFNLDNE---WAIMYHVAAGHVPQLPSRDEISPQ-GTDFLLKCLKQDPDKRATAMELL 1499

Query: 785  NGPFVKPI 792
              P++  I
Sbjct: 1500 VHPWMIEI 1507

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 104/228 (45%), Gaps = 21/228 (9%)

Query: 564 LLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEML 623
           ++ KL + P V+ L D       LY ++E  +      L +  G   + E ++   Q ++
Sbjct: 79  VIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQ-II 137

Query: 624 KCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 682
             +   H  GIVH DLKP N +      +KI DFG+A    +  +    ET  G+P+Y A
Sbjct: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGM---LETSCGSPHYAA 194

Query: 683 PEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 742
           PE +  + Y             G  SD+WSCG I++ ++ GR P+    G  R L +   
Sbjct: 195 PEIVSGLPYE------------GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQ 242

Query: 743 EVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
           + +   P    N   +   A D ++  L  +P +R  + ++L+ P +K
Sbjct: 243 KGQFEMP----NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 98/226 (43%), Gaps = 26/226 (11%)

Query: 572 PRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVH 630
           P + KL +  +    ++ V+E C  H+L   L     + L+ E  +  SQ +   V   H
Sbjct: 88  PYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLE-ESKKLFSQ-IASAVYYAH 145

Query: 631 DSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
           +   VH DLK  N +    G  K+ DFG      E       ET  GT  YMAPE +   
Sbjct: 146 ELKCVHRDLKLENVLLDGNGHAKLTDFGFTR---EMATRSQLETICGTTVYMAPELIERK 202

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
            Y             G   DIWS G I+Y MI G  P+         L I+N E+     
Sbjct: 203 CYD------------GFKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF--- 247

Query: 750 EKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVT 795
               N + +   AID ++  L +NP +R S+ +VL+ PF++P  V 
Sbjct: 248 ----NQEWISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVV 289

>KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON}
           Anc_2.496 YHL007C
          Length = 791

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 100/222 (45%), Gaps = 33/222 (14%)

Query: 574 VVKLIDHEM---DHGVLYEVMECGD-HDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVV 629
           +V  ID  +   D  ++ E M+ G   D+     L  G       +    +E LK ++ +
Sbjct: 569 IVNFIDAYLLNDDLWIVMEYMQGGSLTDVVTYCLLSEGQ------IGTVCRETLKGLRFL 622

Query: 630 HDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 688
           H  G++H D+K  N +  + G +K+ DFG    + +   N  R T +GTP +MAPE +  
Sbjct: 623 HSKGVLHRDIKSDNILLSLTGNIKVTDFGFCAQINDD--NAKRVTMVGTPYWMAPEII-- 678

Query: 689 MNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI-MNPEVKIV 747
                      +R + G   DIWS G ++ +MI G PPY        L  I  N +  + 
Sbjct: 679 -----------SRKEYGPKVDIWSLGIMVIEMIEGEPPYLNETPLKALYLIATNGKPSLK 727

Query: 748 YPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
            PEK S      KT    +  CL  +P+KR    ++L  PF+
Sbjct: 728 EPEKLS------KTFFLFLDKCLAVDPDKRAEATDLLRDPFI 763

>KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {ON}
           Anc_8.141 YGL180W
          Length = 857

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 110/281 (39%), Gaps = 63/281 (22%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGM----- 608
           +E  + EI +LKK++  P +V L+D E      Y +ME C   DL+  +  R  +     
Sbjct: 60  LENLEVEIAILKKIK-HPHIVGLVDCERTGTDFYLIMEYCALGDLTFLIKKRKELVKNHP 118

Query: 609 -----------------GLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANF------- 644
                            GL   F+  + Q++   +K +    +VH D+KP N        
Sbjct: 119 LLRKVFEKYPPPNENRNGLHSAFILNYLQQLACSLKFLRSKNLVHRDIKPQNLLLSTPLL 178

Query: 645 ---------------VFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 689
                          ++   ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 179 DYTDPASFHKLGYIGIYNLPILKIADFGFARFLPSSSL---AETLCGSPLYMAPEIL--- 232

Query: 690 NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 749
                     N  K    +D+WS G ++Y+M  G PP+           I      I +P
Sbjct: 233 ----------NYQKYNAKADLWSVGTVLYEMCCGHPPFKASNHLELFKKIKRANNVINFP 282

Query: 750 EKTSNGDVVPKTAIDTMKA-CLERNPEKRWSVDEVLNGPFV 789
           E  + GD      + ++    L  +P+ R S D   +   V
Sbjct: 283 EYFTTGDTQLDEDLKSLICQLLTFDPQDRTSFDTFFDNKLV 323

>TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.229
           YBR028C
          Length = 493

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 114/252 (45%), Gaps = 53/252 (21%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC--GDHDLSHTLALRSGMGLDV 612
           IE    E  +L +LE  P +VKL     D+  LY +++   G     H   L+    LD 
Sbjct: 163 IERTFAERTILSELE-HPNIVKLFYSFHDNSKLYLILQYIPGGELFFH---LKEQGTLDE 218

Query: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVK-GILKIIDFGIA------------ 659
           + V F++ E+   +K +H  GIV+ DLKP N +  + G L + DFG++            
Sbjct: 219 DTVAFYAAEISCALKFLHSKGIVYRDLKPENCLLDQHGHLVLTDFGLSKKSVVQRDNPLS 278

Query: 660 -----NAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCG 714
                + + E   +++  + IGTP Y APE L  + YT             K  D +S G
Sbjct: 279 SSTEGDLLGEEVTSLH--SIIGTPEYCAPEILQGIPYT-------------KNCDWYSLG 323

Query: 715 CIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMK----ACL 770
           C++Y M+ G+PP+ G           N +V +   +K   G  +P    D MK    A L
Sbjct: 324 CLMYDMMTGKPPHTG----------ANHKVILNKIQKDKQGPKIPYYLSDGMKDMLSALL 373

Query: 771 ERNPEKRWSVDE 782
           ++   KRW VD+
Sbjct: 374 KKEHTKRWDVDQ 385

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 121/277 (43%), Gaps = 36/277 (12%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEG-FKGEIELLKKLETKP 572
           Y+ ++ LG G                  LK ++      S ++G  + EI  L+ L   P
Sbjct: 45  YQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-HP 103

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
            ++KL D       +  V+E   ++L   +  R  M  + E  RF  Q+++  V+  H  
Sbjct: 104 HIIKLYDVIKSKDEIIIVIEFASNELFDYIIQRDKMS-EQEARRFF-QQIISAVEYCHRH 161

Query: 633 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 162 KIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 218

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 219 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 254

Query: 752 TSNGDVVPK----TAIDTMKACLERNPEKRWSVDEVL 784
           ++   ++PK     A + +K  L  NP  R S+ E+ 
Sbjct: 255 SNGVYILPKFLSLGAANLIKKMLIVNPLNRISISEIF 291

>AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YJL095W (BCK1)
          Length = 1423

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 131/290 (45%), Gaps = 36/290 (12%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEF---DDSSI---EGFKGEIELLKK 567
            + K E++G+G                  +K+V   +F   D++++   E    E+  LK 
Sbjct: 1124 WIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKD 1183

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E  + +    +E        +L +R     D + +RF + ++L+ + 
Sbjct: 1184 LD-HLNIVQYLGFENKNCIYSLFLEYVAGGSVGSL-IRLYGHFDEQLIRFLTTQVLEGLA 1241

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +    G+ KI DFGI+      + NIY  +++   GT  +MAP
Sbjct: 1242 YLHLRGILHRDMKADNLLLDNDGVCKISDFGIS----RKSNNIYSNSEMTMRGTVFWMAP 1297

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   + TQG  A+          DIWS GC++ +M  G+ P+   +    +  I   +
Sbjct: 1298 EMV---DTTQGYSAK---------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSK 1345

Query: 744  VKIVYPEKTSNGDVVPKTAIDT---MKACLERNPEKRWSVDEVLNGPFVK 790
                 PE     D +P  + D    +  C   +PE+R + D +L+ PF +
Sbjct: 1346 SAPPIPE-----DTLPHISQDGRAFLDDCFMIDPEERPTADTLLSHPFCQ 1390

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 145/328 (44%), Gaps = 40/328 (12%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRV------SFDEFDDSSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V      S DE   S++E  + E+  LK 
Sbjct: 1096 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDENIISTVEALRSEVSTLKD 1155

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E    +    +E        +L +R     D   +R  + ++L+ + 
Sbjct: 1156 LD-HLNIVQYLGFENKDNIYSLFLEYVAGGSVGSL-IRMYGRFDEAMIRHLTIQVLRGLS 1213

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + G+ KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1214 YLHSRGILHRDMKADNLLLDQDGVCKISDFGIS----RKSNDIYSNSDMTMRGTVFWMAP 1269

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GC++ +M  G+ P+   +    +  I   +
Sbjct: 1270 EMV---DTKQGYSAK---------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSK 1317

Query: 744  VKIVYPEKTSNGDVVPKTAIDT---MKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIR 800
                 PE     D +P  + D    + +C E +PE R + D++L+  F K     +F   
Sbjct: 1318 SAPPIPE-----DTLPLISQDGRQFLDSCFEIDPESRPTADKLLSHAFSKVYPSFNFKST 1372

Query: 801  DLIKNSVKYGANQREISNEKIEELAEDV 828
            +L     K+  +  +I++ K+   ++DV
Sbjct: 1373 EL----CKFIKSNDKINSSKLRVASKDV 1396

>Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON}
            similar to Ashbya gossypii ABR014W
          Length = 1122

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 129/299 (43%), Gaps = 40/299 (13%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETKPR 573
            Y  L  +G+G S                +K+++ ++      E    EI ++K  + K  
Sbjct: 836  YRNLIKIGQGASGGVYTAYEIGTNASVAIKQMNLEK--QPKKELIINEILVMKGSKHK-N 892

Query: 574  VVKLIDHEMDHGVLYEVMECGDH----DLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVV 629
            +V  ID  +  G L+ VME  +     D+     L  G    V      S+E L+ +  +
Sbjct: 893  IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTHCILTEGQIAAV------SRETLRGLHFL 946

Query: 630  HDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 688
            H  G++H D+K  N +  + G +K+ DFG    + E   N+ R T +GTP +MAPE +  
Sbjct: 947  HSKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQINES--NLKRTTMVGTPYWMAPEVV-- 1002

Query: 689  MNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPEVK 745
                       +R + G   DIWS G +I +MI G PPY        L  I     P++K
Sbjct: 1003 -----------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLK 1051

Query: 746  IVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIK 804
                +  S   V+ +     +  CL  NPE R +  E+L+   +  +A  +  +  L+K
Sbjct: 1052 ----DAGSLSSVLKR----FLNWCLHVNPENRATAVELLSDKLITEVADDNKSLAPLVK 1102

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 133/287 (46%), Gaps = 30/287 (10%)

Query: 514  YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRV------SFDEFDDSSIEGFKGEIELLKK 567
            + K E++G+G                  +K+V      S +E   S++E  + E+  LK 
Sbjct: 1182 WIKGEMIGKGSFGAVFLCLNVTTGEMMAVKQVEVPRYGSQNEAIISTVEALRAEVSTLKD 1241

Query: 568  LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627
            L+    +V+ +  E+   +    +E        +L +R     D + ++  + ++L+ + 
Sbjct: 1242 LD-HLNIVQYLGFEVKDSIYSLFLEYVAGGSVGSL-IRMYGKFDEKLIKHLTIQVLRGLS 1299

Query: 628  VVHDSGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 683
             +H  GI+H D+K  N +  + G+ KI DFGI+      + +IY  +++   GT  +MAP
Sbjct: 1300 YLHSRGILHRDMKADNLLLDQDGVCKISDFGIS----RKSKDIYSNSEMTMRGTVFWMAP 1355

Query: 684  EALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 743
            E +   +  QG  A+          DIWS GC++ +M  G+ P+   +    +  I   +
Sbjct: 1356 EMV---DTKQGYSAKV---------DIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSK 1403

Query: 744  VKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
                 P+ T    ++ ++  D +  C + +PE+R + D++L+  F+K
Sbjct: 1404 SAPPIPDDTL--PLISQSGRDFLDQCFKIDPEERPTADKLLSHQFLK 1448

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 129/295 (43%), Gaps = 38/295 (12%)

Query: 507 IYVNGTEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLK 566
           I   G +Y +   LG GG +                         + + +    EI++ K
Sbjct: 70  IKTRGRDYHRGHFLGEGGFARCFQMKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHK 129

Query: 567 KLETKPRVVKLIDHEMDHGVLYEVME-CGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKC 625
            ++  P +V+ ID   D   +Y ++E C +  L   L  R    L    VR+ + +++  
Sbjct: 130 SMK-HPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKV--LTEPEVRYFTTQIVGA 186

Query: 626 VKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPE 684
           +K +H+  ++H DLK  N  F     LKI DFG+A  +       Y  T  GTPNY+APE
Sbjct: 187 IKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAPE 244

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 744
            L   +   G   E          DIWS G +IY ++ G+PP   FQ +         EV
Sbjct: 245 VLAGKH--SGHSYE---------VDIWSIGVMIYALLIGKPP---FQAK---------EV 281

Query: 745 KIVYPEKTSNGDVV-------PKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPI 792
            I+Y E+  +GD +        K  +  ++  L  +P +R S+DE+++  + + I
Sbjct: 282 NIIY-ERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGI 335

>NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 bp,
           323 aa] {ON} Anc_8.482
          Length = 323

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 113/237 (47%), Gaps = 27/237 (11%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 6   SQFKQLEKLGNGTYATVYKGLNKSTGAFVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 64

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSG----MGLDVEFVRFHSQEMLKCVK 627
             +V+L D       L  V E  D+DL   +  +S      GL++  V++   ++ + + 
Sbjct: 65  -NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSQSTGNTPRGLELNLVKYFQWQLFEGLA 123

Query: 628 VVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 684
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 124 FCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 179

Query: 685 ALV-AMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM 740
            L+ +  YT                DIWSCGCI+ +MI G+  + G     +L  I 
Sbjct: 180 VLMGSRTYTTS-------------IDIWSCGCILAEMITGKALFPGTNDDEQLKLIF 223

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 106/241 (43%), Gaps = 27/241 (11%)

Query: 555 IEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEF 614
           +E    E+++L++L   P +V   D    +   Y + +           L+ G   +V+ 
Sbjct: 80  LEALYDELDILQRLH-HPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDA 138

Query: 615 VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFV----KGILKIIDFGIANAVPEHTVNIY 670
           VR    E+L  VK +H   IVH DLKP N +++    +  L I DFGIA  +      IY
Sbjct: 139 VRILV-EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIY 197

Query: 671 RETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGF 730
           +    G+  Y+APE L    +             GKP DIWS G I Y ++ G   Y  F
Sbjct: 198 KAA--GSLGYVAPEVLTQDGH-------------GKPCDIWSIGVITYTLLCG---YSAF 239

Query: 731 QGQNRLLAIMNPEVKIVYPEKTSN--GDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
           + + R+L  ++      YP        D V   A   +   L+ NP KR +  E+L  P+
Sbjct: 240 KAE-RVLDFLDECTTGKYPVTFHRPYWDSVSDKAKRFILKALDLNPAKRPTAAELLEDPW 298

Query: 789 V 789
           +
Sbjct: 299 I 299

>KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]
           {ON} highly similar to uniprot|P14681 Saccharomyces
           cerevisiae YGR040W KSS1 Mitogen-activated protein kinase
           (MAPK) involved in signal transduction pathways that
           control filamentous growth and pheromone response
          Length = 365

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 118/266 (44%), Gaps = 51/266 (19%)

Query: 561 EIELLKKLETKPRVVKLID----HEMD-HGVLYEVMECGDHDLSHTLALRSGMGLDVEFV 615
           E++LLK   +   ++ ++D      MD    +Y V E  + DL H +    G  L  + +
Sbjct: 59  ELKLLKLFHSHENIISVLDVVRPTSMDKFQAVYLVQELMETDL-HKVISGGGSSLSDDHI 117

Query: 616 RFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHT-----VNI 669
           ++ + ++L+ +K +H + ++H D+KP+N +      LK+ DFG+A  +   T     +  
Sbjct: 118 QYFTYQILRALKAIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSTHSRQNLVG 177

Query: 670 YRETQIGTPNYMAPEALVAMN-YTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYG 728
           +    + T  Y APE ++    YT                DIWSCGCI+ +MI G+P + 
Sbjct: 178 FMTEYVATRWYRAPEIMLTFQQYTTAM-------------DIWSCGCILAEMITGKPLFP 224

Query: 729 GFQGQNRLLAIMNPEVKIVY-----------PEKTSN--------GDVVPKT------AI 763
           G    ++L  I+       Y            E  +N          VV +T      AI
Sbjct: 225 GRDYHHQLWLILEAVGTPSYEDFENINSKRAKEYIANLPLRQKLPWQVVLQTQEVNPDAI 284

Query: 764 DTMKACLERNPEKRWSVDEVLNGPFV 789
           D +   L  NP+KR S  E L+ P++
Sbjct: 285 DLLDRMLTFNPDKRISAVEALSHPYL 310

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 96/221 (43%), Gaps = 31/221 (14%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L +L   P VV+L     D   LY V+E   H     L  R G  L       ++ ++L 
Sbjct: 197 LVRLRDCPGVVRLHATFQDRESLYFVLEYAPHGDLLALLRRHG-SLSRAVTCHYAAQLLS 255

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQ------IGT 677
            +  +H  G++H D+KP N +       K+ DFG A  +P+   N+ + ++      +GT
Sbjct: 256 AIGALHSVGVIHRDIKPENVLLDSHYRAKLTDFGTAALLPQTHSNLEQVSRHVTTSFVGT 315

Query: 678 PNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 737
             Y+ PE L+A  +  G              D+W+  C+++Q+I GRPP   FQ +N  L
Sbjct: 316 AEYVPPE-LLAAGHADGT------------CDLWAWACVVFQLIAGRPP---FQARNEFL 359

Query: 738 AIMNP-EVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKR 777
              N   V+  YP         P    D ++  L   P +R
Sbjct: 360 TFQNVMAVRYTYPPG------FPSDLKDLLRRVLRHEPRQR 394

>Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {ON}
           YKL161C (REAL)
          Length = 504

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 124/265 (46%), Gaps = 54/265 (20%)

Query: 561 EIELLKKLETKPRVVKLIDHEM---DHGVL------YEVMECGDHDLSHTLALRSGMGLD 611
           E++LL+     P ++ L D ++    +GVL       E+MEC   DLS    LRSG  L+
Sbjct: 72  ELKLLRHFRGHPNIIWLFDTDIVFYPYGVLNGVYLYEELMEC---DLSQ--VLRSGQRLE 126

Query: 612 VEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTV--N 668
               +    ++L  +K +H +G++H DLKP N +      LKI +FG++    E+    N
Sbjct: 127 NAHYQSFIYQILCALKYIHSAGVLHRDLKPKNLLVNSDCQLKICNFGLSRGYSENYEENN 186

Query: 669 IYRETQIGTPNYMAPEALVA-MNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 727
            +    + T  Y APE +++   YT             K  D+WS GCI+ +++ G+P +
Sbjct: 187 HFLTEFVATRWYRAPEIMLSYQGYT-------------KAIDVWSTGCILAELLGGKPIF 233

Query: 728 GG---FQGQNRLLAIMNP----EVKIVYPEKTSNGDV----VPKT------------AID 764
            G       N +L I+       ++ +  EK  N       +P+T             +D
Sbjct: 234 DGKDYVDQLNHILQILGTPSKETLQEISSEKVQNYIFQFGNIPRTPFESLLPRANSEGLD 293

Query: 765 TMKACLERNPEKRWSVDEVLNGPFV 789
            ++  LE +P++R +V+E L  P++
Sbjct: 294 LLQKMLEFDPKRRVTVNEALEHPYL 318

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 115/246 (46%), Gaps = 39/246 (15%)

Query: 552  DSSIEGFKGEIELLKKLETKPR--VVKLIDHEMDHGVLYEVM----ECGDHDLSHTLALR 605
            D  +     EI+++  L  KP   +++L+D   D    Y       E G  DL   +  +
Sbjct: 1140 DRKLGTIPSEIQIMATLNKKPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFK 1199

Query: 606  SGMGLDVEF-VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVP 663
            + M    EF  +   ++++  +K +HD GIVH D+K  N +   KG +KIIDFG A  V 
Sbjct: 1200 TNM---TEFEAKLIFKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVK 1256

Query: 664  EHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYG 723
                +++    +GT +Y APE L       G P E      G+P DIW+ G ++Y +++ 
Sbjct: 1257 SGPFDVF----VGTIDYAAPEVL------GGNPYE------GQPQDIWAIGILLYTVVFK 1300

Query: 724  RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
              P+           I+  ++K       +N + V +  I+ +K+ L R    R ++D++
Sbjct: 1301 ENPFYNID------EILEGDLKF------NNAEEVSEDCIELIKSILNRRVPNRPTIDDI 1348

Query: 784  LNGPFV 789
             N  ++
Sbjct: 1349 NNDKWL 1354

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 103/219 (47%), Gaps = 29/219 (13%)

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHD 631
           P V+KL     D   LY ++E   +    ++  R G  L  E  +++  ++L  +  +H 
Sbjct: 261 PGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGT-LSEECTKYYGAQILDAIHHLHK 319

Query: 632 SGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPE------HTVNIYRETQIGTPNYMAPE 684
            GI+H D+KP N +  K + +K+ DFG A  +        + +N   ++ +GT  Y++PE
Sbjct: 320 QGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYVSPE 379

Query: 685 ALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 744
            L+  NY            V    DIW+ GCI++QM+ G+PP   F+  N  L      +
Sbjct: 380 -LLNDNY------------VDSRCDIWAFGCILFQMVAGKPP---FKATNEYLTFQK-VM 422

Query: 745 KIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEV 783
           ++ Y          P    D +K  L + PE+R ++ ++
Sbjct: 423 RVQYAFTAG----FPMILRDLIKQLLVKKPEQRLTILQI 457

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 121/283 (42%), Gaps = 36/283 (12%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEG-FKGEIELLKKLETKP 572
           Y+ ++ LG G                  LK ++      S ++G  + EI  L+ L   P
Sbjct: 44  YQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVLAKSDMQGRIEREISYLRLLR-HP 102

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
            ++KL D       +  V+E  D++L   +  R  M  + E  RF  Q+++  V   H  
Sbjct: 103 HIIKLYDVIKSKDEIIMVIEYADNELFDYIVQRDKMS-EQEARRFF-QQIISAVDYCHRH 160

Query: 633 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 161 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 217

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 218 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 253

Query: 752 TSNGDVVPK----TAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
            +    +P+     A   +K  L  NP  R S+ E++   + K
Sbjct: 254 NNGIYTLPRFLSEGASSLIKKMLIVNPLNRISIHEIMQDEWFK 296

>Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W
           (REAL)
          Length = 1081

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 115/248 (46%), Gaps = 42/248 (16%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L+KL     VV+L     D   LY ++E   +    +L  + G  +D     +++ +++ 
Sbjct: 232 LQKLNNSLSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYG-SIDENCACYYAAQIID 290

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIA-------NAV--PEHTVNIYRETQ 674
            +  +H +GI+H D+KP N +  + + +K+ DFG A       N+V  P++ ++   ++ 
Sbjct: 291 AIDYLHSNGIIHRDIKPENILLDEEMRIKLTDFGTAKLLSPTSNSVSKPKYDLSTRSKSF 350

Query: 675 IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 734
           +GT  Y++PE L             N        DIW+ GCI++QMI G+PP   F+  N
Sbjct: 351 VGTAEYVSPELL-------------NDSFTDYRCDIWAFGCILFQMIAGKPP---FKATN 394

Query: 735 RLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAV 794
             L      +K+ Y          P    D +K  L +N ++R +++++           
Sbjct: 395 EYLTFQK-VMKVQYAFTPG----FPLVIRDLVKRILVKNLDQRLTINQIKE--------- 440

Query: 795 THFFIRDL 802
            H+F +D+
Sbjct: 441 -HYFFKDM 447

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 133/310 (42%), Gaps = 41/310 (13%)

Query: 491 KPPATSGDSYNRRKPTIYVNGT---EYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSF 547
           +P   SG  +++R+ T +  G    +Y+ ++ LG G                  LK ++ 
Sbjct: 9   QPHGGSGQGHHQRQLTNHAQGQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINK 68

Query: 548 DEFDDSSIEG-FKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRS 606
                S ++G  + EI  L+ L   P ++KL D       +  V+E   ++L   +  R 
Sbjct: 69  KVLAKSDMQGRIEREISYLRLLR-HPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRD 127

Query: 607 GMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEH 665
            M  + E  RF  Q+++  V   H   IVH DLKP N +  + + +KI DFG++N + + 
Sbjct: 128 KMP-EQEARRFF-QQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG 185

Query: 666 TVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRP 725
               + +T  G+PNY APE +    Y             G   D+WS G I+Y M+  R 
Sbjct: 186 N---FLKTSCGSPNYAAPEVISGKLYA------------GPEVDVWSSGVILYVMLCRRL 230

Query: 726 PYGGFQGQNRLLAIMNPEVKIVYPEKTSNG-----DVVPKTAIDTMKACLERNPEKRWSV 780
           P+             + E   V  +  SNG     + + + A   +K  L  NP  R +V
Sbjct: 231 PF-------------DDESIPVLFKNISNGVYTIPNFLSQGAASLIKKMLIVNPVNRITV 277

Query: 781 DEVLNGPFVK 790
            E++   + K
Sbjct: 278 HEIMQDEWFK 287

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 108/238 (45%), Gaps = 32/238 (13%)

Query: 565 LKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK 624
           L+KL     VV+L     D   LY ++E   +    +L  + G  LD     ++  +++ 
Sbjct: 235 LQKLNNSHSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYG-SLDENCACYYGSQIID 293

Query: 625 CVKVVHDSGIVHSDLKPANFVFVKGI-LKIIDFGIANAV---------PEHTVNIYRETQ 674
            +  +H SGI+H D+KP N +    + +K+ DFG A  +          ++ ++   ++ 
Sbjct: 294 AIDHLHVSGIIHRDIKPENILLDGEMRIKLTDFGTAKLLEPTNNSSSKSKYDLSTRSKSF 353

Query: 675 IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 734
           +GT  Y++PE L             N        DIW+ GCI++QMI G+PP   F+  N
Sbjct: 354 VGTAEYVSPELL-------------NDSFTDYRCDIWAFGCILFQMIAGKPP---FKATN 397

Query: 735 RLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPI 792
             L      +K+ Y          P    D +K  L +N ++R +++++   PF K I
Sbjct: 398 EYLTFQKV-MKVQYAFTPG----FPLIIRDLVKKILIKNLDQRLTINQIKEHPFFKEI 450

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 122/283 (43%), Gaps = 36/283 (12%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEG-FKGEIELLKKLETKP 572
           Y+ ++ LG G                  LK ++      S ++G  + EI  L+ L   P
Sbjct: 54  YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-HP 112

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
            ++KL D       +  V+E   ++L   +  R  M  D E  RF  Q+++  V+  H  
Sbjct: 113 HIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSED-EARRFF-QQIISAVEYCHRH 170

Query: 633 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 171 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 227

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 228 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 263

Query: 752 TSNGDVVPK----TAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
           ++    +PK     A   +K  L  NP  R S+ E++   + K
Sbjct: 264 SNGVYSLPKFLSPGAASLIKRMLIVNPLNRISIHEIMQDDWFK 306

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 122/283 (43%), Gaps = 36/283 (12%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEG-FKGEIELLKKLETKP 572
           Y+ ++ LG G                  LK ++      S ++G  + EI  L+ L   P
Sbjct: 55  YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-HP 113

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
            ++KL D       +  V+E   ++L   +  R  M  + E  RF  Q+++  V+  H  
Sbjct: 114 HIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMS-EQEARRFF-QQIISAVEYCHRH 171

Query: 633 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 172 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 228

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 229 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 264

Query: 752 TSNGDVVPK----TAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
           ++    +PK     A   +K  L  NP  R S+ E++   + K
Sbjct: 265 SNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 307

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 113/236 (47%), Gaps = 37/236 (15%)

Query: 561  EIELLKKLETKPR--VVKLIDHEMDHGVLYEVM----ECGDHDLSHTLALRSGMGLDVEF 614
            EI+++  +  +P   ++ L+D   D    Y       E G  DL   +  ++ M  ++E 
Sbjct: 1129 EIQIMATISKEPHENILTLLDFFEDDDYYYIETPVHGETGSIDLFDLIEFKTNMT-EIE- 1186

Query: 615  VRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRET 673
             +   ++++  VK +HD GIVH D+K  N +   +G +KIIDFG A  V     +++   
Sbjct: 1187 AKLLFKQVVSGVKHLHDQGIVHRDIKDENIIVDSQGFVKIIDFGSAAYVKSGPFDVF--- 1243

Query: 674  QIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 733
             +GT +Y APE L       G P E      GKP DIW+ G ++Y +++   P+      
Sbjct: 1244 -VGTIDYAAPEVL------GGSPYE------GKPQDIWAIGILLYTIVFKENPFYNID-- 1288

Query: 734  NRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
                 I+  E+K       ++ ++V +     +   L RN +KR ++D++ N  ++
Sbjct: 1289 ----EILEGELKF------NSSELVSEQCTTLIAKILNRNVQKRPTIDDIYNDEWL 1334

>SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly
           similar to uniprot|Q00772 Saccharomyces cerevisiae
           YHR030C SLT2 Suppressor of lyt2 serine/threonine MAP
           kinase
          Length = 521

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 142/324 (43%), Gaps = 84/324 (25%)

Query: 561 EIELLKKLETKPRVVKLIDHEMDHGV--------LYE-VMECGDHDLSHTLALRSGMGL- 610
           E++LL+       +  L D ++  G+        LYE +MEC  H +     ++SG  L 
Sbjct: 72  ELKLLRHFRGHKNITCLYDMDIVFGIDGSFNGLYLYEELMECDMHQI-----IKSGQPLS 126

Query: 611 DVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTV-- 667
           D  +  F  Q +L  +K +H + ++H DLKP N +      LKI DFG+A    E+ V  
Sbjct: 127 DAHYQSFIYQ-ILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVEN 185

Query: 668 NIYRETQIGTPNYMAPEALVAM-NYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPP 726
           N +    + T  Y APE +++   YT             +  D+WSCGCI+ +++   P 
Sbjct: 186 NQFLTEYVATRWYRAPEIMLSYQGYT-------------RAIDVWSCGCILAELLGSAPI 232

Query: 727 YGG---FQGQNRLLAIMN--PEVKIVYPEKTSNGDV---------VPKT----------- 761
           + G       NR+L I+   PE  +   E+  + +V         VPK            
Sbjct: 233 FKGKDYVDQLNRILQILGTPPEETL---ERIGSKNVQDYIHQLGFVPKVPFITMYPNANP 289

Query: 762 -AIDTMKACLERNPEKRWSVDEVLNGPFV--------KPIAVTHFFIRDLIKNSVKYGAN 812
            A+D ++  L  +P++R +V E L  P++        +P+  T F   D    SV     
Sbjct: 290 QALDLLEKMLAFDPQRRITVKEALKHPYLSIWHDPADEPVCSTKF---DFSFESV----- 341

Query: 813 QREISNEKIEELAEDVWHRLADFR 836
                 ++IE+L + V   + DFR
Sbjct: 342 ------DEIEQLKQMVVEEVQDFR 359

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 125/281 (44%), Gaps = 32/281 (11%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEG-FKGEIELLKKLETKP 572
           Y+ ++ LG G                  LK ++      S ++G  + EI  L+ L   P
Sbjct: 68  YQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVLAKSDMQGRVEREISFLRLLR-HP 126

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
            ++KL D       +  V+E  +++L   +  R  M  + E  +F  Q+++  V+  H  
Sbjct: 127 HIIKLYDVIKSKDEIIMVIEYANNELFEYIVQRDKMT-ENEARKFF-QQIISAVEYCHRH 184

Query: 633 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 185 KIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 241

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY--P 749
                        G   D+WSCG I+Y M+  R P+      + + A+       +Y  P
Sbjct: 242 A------------GPEVDVWSCGVILYVMLCRRLPF----DDDSIPALFKNISNGIYTLP 285

Query: 750 EKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
           +  S G      A + +K  L  NP  R S+ E+++  + K
Sbjct: 286 KFLSEG------AANLIKKMLIVNPLNRISMTEIIHDEWFK 320

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 122/283 (43%), Gaps = 36/283 (12%)

Query: 514 YEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEG-FKGEIELLKKLETKP 572
           Y+ ++ LG G                  LK ++      S ++G  + EI  L+ L   P
Sbjct: 55  YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-HP 113

Query: 573 RVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDS 632
            ++KL D       +  V+E   ++L   +  R  M  + E  RF  Q+++  V+  H  
Sbjct: 114 HIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMS-EQEARRFF-QQIISAVEYCHRH 171

Query: 633 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 691
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 172 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 228

Query: 692 TQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 751
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 229 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 264

Query: 752 TSNGDVVPK----TAIDTMKACLERNPEKRWSVDEVLNGPFVK 790
           ++    +PK     A   +K  L  NP  R S+ E++   + K
Sbjct: 265 SNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 307

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 108/235 (45%), Gaps = 27/235 (11%)

Query: 557 GFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVR 616
           G + EI ++K L + P V+ L +   +   LY V+E  D        +  G   + E V 
Sbjct: 145 GIEREIVIMK-LISHPNVMGLYEVWENKSELYLVLEYVDGGELFDYLVSRGKLPEREAVH 203

Query: 617 FHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRETQ 674
           +  Q +++ V   H   I H DLKP N +  K   I+KI DFG+A        +    T 
Sbjct: 204 YFKQ-IIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMAAL---EVSDKLLSTS 259

Query: 675 IGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 734
            G+P+Y +PE ++  +Y             G P+D+WSCG I++ ++ G  P+     + 
Sbjct: 260 CGSPHYASPEIVMGKSYH------------GSPTDVWSCGIILFALLTGHLPFNHDNIKK 307

Query: 735 RLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789
            LL + +     VY   +   D+ P  A D +   L  +P+KR +  E+LN   +
Sbjct: 308 LLLKVQSG----VYHMPS---DLSPD-AKDLISKILVVDPDKRLTTTEILNHSLI 354

>TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056
           bp, 351 aa] {ON} Anc_8.490 YPL042C
          Length = 351

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 82/340 (24%), Positives = 140/340 (41%), Gaps = 82/340 (24%)

Query: 512 TEYEKLELLGRGGSSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIEGFKGEIELLKKLETK 571
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHN 63

Query: 572 PRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSG------------------------ 607
             +V+L D       L  V E  D DL   +  RS                         
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEYMDKDLKKFMDARSLAHANQLNANANQNINSGNPMGNNG 122

Query: 608 --------MGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVF-VKGILKIIDFGI 658
                   +GL++  V++   ++L+ V   H++ I+H DLKP N +   KG LK+ DFG+
Sbjct: 123 NSNSKTQPIGLELNLVKYFQWQLLEGVAYCHENKILHRDLKPQNLLIDNKGQLKLGDFGL 182

Query: 659 ANA--VPEHTVNIYRETQIGTPNYMAPEALV-AMNYTQGQPAEQNRWKVGKPSDIWSCGC 715
           A A  +P +T +    +++ T  Y AP+ L+ + NY+                D+WSCGC
Sbjct: 183 ARAFGIPVNTFS----SEVVTLWYRAPDVLMGSRNYSTS-------------IDMWSCGC 225

Query: 716 IIYQMIYGRPPYGGFQGQNRLLAIMN----------PEV--------KIVYPEKTSN--- 754
           I+ +MI G+P + G   + +L  I            P +         ++ P +  N   
Sbjct: 226 ILAEMIAGKPLFPGTNDEEQLKLIFELIGSPNEQNWPGITSLPKYSQTVIQPSQPKNLKH 285

Query: 755 ------GDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPF 788
                  +++    ID +   L+ NP+ R S  + L  P+
Sbjct: 286 VLQPYTKELLDDNVIDLLNGLLQLNPDMRLSAQQALYHPW 325

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,509,564
Number of extensions: 4148771
Number of successful extensions: 19527
Number of sequences better than 10.0: 2102
Number of HSP's gapped: 16774
Number of HSP's successfully gapped: 2259
Length of query: 837
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 719
Effective length of database: 39,950,811
Effective search space: 28724633109
Effective search space used: 28724633109
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)