Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F02376g1.82ON1976194691060.0
Kwal_33.133921.82ON1968122538390.0
SAKL0C02618g1.82ON1988116327370.0
KLLA0C02321g1.82ON1842115619760.0
Ecym_10861.82ON2091100418870.0
AFR669W1.82ON191859218270.0
YNL271C (BNI1)1.82ON195362618280.0
NCAS0A005901.82ON194663118210.0
KAFR0D039501.82ON195763818210.0
Suva_14.711.82ON194862518060.0
ZYRO0F16676g1.82ON1994109218010.0
Smik_14.661.82ON195262617980.0
KNAG0F004701.82ON202867217960.0
Skud_14.691.82ON194662817790.0
TDEL0C061901.82ON187961817700.0
CAGL0J08206g1.82ON1898112317700.0
TBLA0A054401.82ON217066917580.0
NDAI0F042201.82ON202263617250.0
TPHA0B044901.82ON194065716750.0
Kpol_2000.661.82ON193063315680.0
CAGL0H06765g5.717ON12943967826e-84
Ecym_5679na 1ON13063947772e-83
NCAS0G001205.717ON13144597721e-82
AGL364Cna 1ON12604717655e-82
AFR301C5.717ON16554777701e-81
Ecym_40045.717ON14544827661e-81
SAKL0E15224g5.717ON13354647524e-80
ZYRO0B16654g5.717ON14243977472e-79
KLLA0F10912g5.717ON12834797408e-79
Kwal_55.196205.717ON13894007241e-76
TDEL0F055605.717ON12924627122e-75
KNAG0L022505.717ON13674747089e-75
TPHA0E001205.717ON16424627012e-73
KLTH0E00704g5.717ON13893916883e-72
Smik_9.95.717ON13744846784e-71
Kpol_416.105.717ON14914636795e-71
Skud_9.85.717ON13744846713e-70
YIL159W (BNR1)5.717ON13755106633e-69
NDAI0F001605.717ON13493936624e-69
KAFR0D021205.717ON13243916463e-67
TBLA0E018105.717ON14514606473e-67
Suva_9.265.717ON13754016312e-65
Skud_16.4023.438ON101398880.24
NCAS0F010007.115ON389143830.73
CAGL0K03465g2.441ON67781830.87
ZYRO0D11308g5.477ON868228821.1
Suva_16.4433.438ON115098811.6
Smik_16.3583.438ON1031101802.0
KLLA0D15081g3.438ON1010253765.4
Kpol_1013.467.525ON55956749.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F02376g
         (1976 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...  3512   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...  1483   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...  1058   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   765   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   731   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   708   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...   708   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...   706   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....   706   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...   700   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   698   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...   697   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     696   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...   689   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...   686   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...   686   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   681   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}           669   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   649   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...   608   0.0  
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   305   6e-84
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   303   2e-83
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      301   1e-82
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   299   5e-82
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   301   1e-81
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   299   1e-81
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   294   4e-80
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   292   2e-79
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   289   8e-79
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   283   1e-76
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   278   2e-75
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   277   9e-75
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   274   2e-73
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   269   3e-72
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   265   4e-71
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   266   5e-71
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   263   3e-70
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   259   3e-69
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     259   4e-69
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   253   3e-67
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   253   3e-67
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   247   2e-65
Skud_16.402 Chr16 (719673..722714) [3042 bp, 1013 aa] {ON} YPR11...    39   0.24 
NCAS0F01000 Chr6 complement(199877..201046) [1170 bp, 389 aa] {O...    37   0.73 
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    37   0.87 
ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {...    36   1.1  
Suva_16.443 Chr16 (762629..766081) [3453 bp, 1150 aa] {ON} YPR11...    36   1.6  
Smik_16.358 Chr16 (632912..636007) [3096 bp, 1031 aa] {ON} YPR11...    35   2.0  
KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} som...    34   5.4  
Kpol_1013.46 s1013 complement(104156..105835) [1680 bp, 559 aa] ...    33   9.2  

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score = 3512 bits (9106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1751/1946 (89%), Positives = 1751/1946 (89%)

Query: 31   LKRLTTGSGNSSVSHNTQKLDISDISSPKKINLPDTGEFSHKPLSKQSTLNMASLSAYTD 90
            LKRLTTGSGNSSVSHNTQKLDISDISSPKKINLPDTGEFSHKPLSKQSTLNMASLSAYTD
Sbjct: 31   LKRLTTGSGNSSVSHNTQKLDISDISSPKKINLPDTGEFSHKPLSKQSTLNMASLSAYTD 90

Query: 91   AVGAHNRSASNASVGSPTKYSYSRRASQWSNNNSAVSGSKLSRQQTNXXXXXXXXXXXXX 150
            AVGAHNRSASNASVGSPTKYSYSRRASQWSNNNSAVSGSKLSRQQTN             
Sbjct: 91   AVGAHNRSASNASVGSPTKYSYSRRASQWSNNNSAVSGSKLSRQQTNQSMSSASIFSQGS 150

Query: 151  XXNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKWL 210
              NLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKWL
Sbjct: 151  FSNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKWL 210

Query: 211  MVRQDLQSEVKKFMNSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFTGLSRPKI 270
            MVRQDLQSEVKKFMNSKN                               GSFTGLSRPKI
Sbjct: 211  MVRQDLQSEVKKFMNSKNASKSSTVVGGSSSAVPDSPSASNFTSSTSPNGSFTGLSRPKI 270

Query: 271  STSSVNTSEQFYXXXXXXXXXXXXXQDPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTE 330
            STSSVNTSEQFY             QDPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTE
Sbjct: 271  STSSVNTSEQFYSSNLGTSSTTTLSQDPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTE 330

Query: 331  QLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLREGAD 390
            QLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLREGAD
Sbjct: 331  QLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLREGAD 390

Query: 391  EAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNHVMDALDQESRFC 450
            EAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNHVMDALDQESRFC
Sbjct: 391  EAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNHVMDALDQESRFC 450

Query: 451  DNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLV 510
            DNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLV
Sbjct: 451  DNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLV 510

Query: 511  GASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKL 570
            GASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKL
Sbjct: 511  GASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKL 570

Query: 571  LNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLT 630
            LNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLT
Sbjct: 571  LNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLT 630

Query: 631  SLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSFNSAIQRLYDAM 690
            SLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSFNSAIQRLYDAM
Sbjct: 631  SLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSFNSAIQRLYDAM 690

Query: 691  QTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQ 750
            QTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQ
Sbjct: 691  QTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQ 750

Query: 751  RVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDEKGSENPRPLRPE 810
            RVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDEKGSENPRPLRPE
Sbjct: 751  RVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDEKGSENPRPLRPE 810

Query: 811  RKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFS 870
            RKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFS
Sbjct: 811  RKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFS 870

Query: 871  DYQKDDIKEPEVSNEDDHKAVSESEEKAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEG 930
            DYQKDDIKEPEVSNEDDHKAVSESEEKAQQI               QQESNDISKFNVEG
Sbjct: 871  DYQKDDIKEPEVSNEDDHKAVSESEEKAQQISALKLEELRKKLASLQQESNDISKFNVEG 930

Query: 931  RFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLGQALAGKSVSSDDKARTLDPKEA 990
            RFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLGQALAGKSVSSDDKARTLDPKEA
Sbjct: 931  RFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLGQALAGKSVSSDDKARTLDPKEA 990

Query: 991  LNIVEEVSNILSGLDSSKAAEKSNETPLRTATXXXXXXXXXXXKNGDKIAADSTLPTSSF 1050
            LNIVEEVSNILSGLDSSKAAEKSNETPLRTAT           KNGDKIAADSTLPTSSF
Sbjct: 991  LNIVEEVSNILSGLDSSKAAEKSNETPLRTATSSDSSEDEMDDKNGDKIAADSTLPTSSF 1050

Query: 1051 LESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTGAVPYLGELSGKIGS 1110
            LESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTGAVPYLGELSGKIGS
Sbjct: 1051 LESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTGAVPYLGELSGKIGS 1110

Query: 1111 SSYIKPSEAEENVGIGIMVDEKPLSRRVQEDAAGVSQLESNEEKPALSHDLDKNTTHSKP 1170
            SSYIKPSEAEENVGIGIMVDEKPLSRRVQEDAAGVSQLESNEEKPALSHDLDKNTTHSKP
Sbjct: 1111 SSYIKPSEAEENVGIGIMVDEKPLSRRVQEDAAGVSQLESNEEKPALSHDLDKNTTHSKP 1170

Query: 1171 ITIGENLAAAKTAGKQQAHEDEGTTEGSSTDKDSHEIASATSAXXXXXXXXMDLFAKNGA 1230
            ITIGENLAAAKTAGKQQAHEDEGTTEGSSTDKDSHEIASATSA        MDLFAKNGA
Sbjct: 1171 ITIGENLAAAKTAGKQQAHEDEGTTEGSSTDKDSHEIASATSAPPPPPPPPMDLFAKNGA 1230

Query: 1231 PVKTDNPDPAVSDTKSAAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1290
            PVKTDNPDPAVSDTKSAAA                                         
Sbjct: 1231 PVKTDNPDPAVSDTKSAAAPPPPPPPPPIPPMLASSSSGSTSKAGAPPPPPPPPPPPPAL 1290

Query: 1291 XXXXXNNGXXXXXXXXXXFGASVSRNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKI 1350
                 NNG          FGASVSRNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKI
Sbjct: 1291 LSQSSNNGPPPPPPPPPPFGASVSRNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKI 1350

Query: 1351 DDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVS 1410
            DDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREI                    VS
Sbjct: 1351 DDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIKSLASRKKKDSDKLSFLSRDVS 1410

Query: 1411 QQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTI 1470
            QQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTI
Sbjct: 1411 QQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTI 1470

Query: 1471 DWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLV 1530
            DWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLV
Sbjct: 1471 DWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLV 1530

Query: 1531 HKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNS 1590
            HKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNS
Sbjct: 1531 HKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNS 1590

Query: 1591 MTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIG 1650
            MTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIG
Sbjct: 1591 MTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIG 1650

Query: 1651 NLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFAR 1710
            NLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFAR
Sbjct: 1651 NLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFAR 1710

Query: 1711 NSFFKKFADFLLEYKKAQVYNXXXXXXXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGG 1770
            NSFFKKFADFLLEYKKAQVYN                VEDQLKRTRESESKNKGTTDAGG
Sbjct: 1711 NSFFKKFADFLLEYKKAQVYNLKLEEEERAYERRKKLVEDQLKRTRESESKNKGTTDAGG 1770

Query: 1771 DSVRNEVNEDRDVMDRLLEKLKNAGPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDI 1830
            DSVRNEVNEDRDVMDRLLEKLKNAGPAKSDPSS          LLQGSSSNSTILDNFDI
Sbjct: 1771 DSVRNEVNEDRDVMDRLLEKLKNAGPAKSDPSSARKRAVARKRLLQGSSSNSTILDNFDI 1830

Query: 1831 EDSDGKSLVYSPDNNSSEVQLNEADTSPTPERRVRDSNATSPASHDTGSSDLTDRARNLL 1890
            EDSDGKSLVYSPDNNSSEVQLNEADTSPTPERRVRDSNATSPASHDTGSSDLTDRARNLL
Sbjct: 1831 EDSDGKSLVYSPDNNSSEVQLNEADTSPTPERRVRDSNATSPASHDTGSSDLTDRARNLL 1890

Query: 1891 IELRGPESPGVKMSAQHQRLSKLRARRKNDSSSSGSENRLNFVGAGQAENSDEQNEPEVL 1950
            IELRGPESPGVKMSAQHQRLSKLRARRKNDSSSSGSENRLNFVGAGQAENSDEQNEPEVL
Sbjct: 1891 IELRGPESPGVKMSAQHQRLSKLRARRKNDSSSSGSENRLNFVGAGQAENSDEQNEPEVL 1950

Query: 1951 KSKPESANDDDNGEQSDSSDGEFLDA 1976
            KSKPESANDDDNGEQSDSSDGEFLDA
Sbjct: 1951 KSKPESANDDDNGEQSDSSDGEFLDA 1976

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score = 1483 bits (3839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 795/1225 (64%), Positives = 906/1225 (73%), Gaps = 55/1225 (4%)

Query: 1    MNRSSNSKXXXXXXXXXXXXXXXXXXXXXXLKRLTTGSGNSSVSHNTQKLDISDISSPKK 60
            M+RS++SK                      LKRLT G+ N+S S   QK+DISDISSPKK
Sbjct: 1    MHRSTSSKPAKTPHNRSASNGSGNGGIFSNLKRLT-GNANNSSSQTLQKVDISDISSPKK 59

Query: 61   INLPDTGEFSHKPLSKQSTLNMASLSAYTDAVGAHNRSASNASVGSPTKYSYSRRASQWS 120
            INLPDTGEFSHKPLSKQSTLN+A+LSAYTD    HNRS+S AS  SPTKYSYSRRASQWS
Sbjct: 60   INLPDTGEFSHKPLSKQSTLNIANLSAYTDVASTHNRSSSAASNSSPTKYSYSRRASQWS 119

Query: 121  NNNSAVSGSKLSRQQTNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEELFE 180
            +N      +KLSRQQTN               NLSKFVGPDG++RLE+PRDP+EIEELFE
Sbjct: 120  SNGGTAPSTKLSRQQTNQSISSASIFSQGSFSNLSKFVGPDGSIRLEKPRDPREIEELFE 179

Query: 181  EVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKNXXXXXXXXXXXX 240
            EVLYKRNVYQSLP SAQ+ELNNYDLEKKWLMVRQDLQSEVKKFMN+K+            
Sbjct: 180  EVLYKRNVYQSLPPSAQKELNNYDLEKKWLMVRQDLQSEVKKFMNNKSVSKSPAAASTGI 239

Query: 241  XXXXXXXXXXXXXXXXXXXG-SFTGLSRPKISTSSVNTSEQFYXXXXXXXXXXXXXQDPS 299
                                 S  G SR +    +  TS+QFY             QDPS
Sbjct: 240  SLIAPESPSTGHFASNSSINESLAGSSRSR--AQNPGTSDQFYGSNNGTSSTTTLSQDPS 297

Query: 300  HLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRES 359
            HLSPDYYVRKIICN+ISAKRLNDLWVSLRTEQLDWV GFLEAQGQVAIANVILKTCYRES
Sbjct: 298  HLSPDYYVRKIICNNISAKRLNDLWVSLRTEQLDWVVGFLEAQGQVAIANVILKTCYRES 357

Query: 360  PDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRV 419
            PDNLLGDEVLDKEFAYFKCLKTSLNL+EGADEAV+SNSA+II+SAI+EGLLSLRVATRR+
Sbjct: 358  PDNLLGDEVLDKEFAYFKCLKTSLNLKEGADEAVLSNSAKIIISAIIEGLLSLRVATRRI 417

Query: 420  ASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPD 479
            ASELL+SLSQW+LPHGF HVM+ALDQESRFCDNVHLQARL++Q+++K+ K     +   D
Sbjct: 418  ASELLVSLSQWALPHGFTHVMNALDQESRFCDNVHLQARLLSQTSNKEIKNSLRSSLLAD 477

Query: 480  GDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHL 539
             +GDR+MRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLL+NHL
Sbjct: 478  NNGDRIMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLVNHL 537

Query: 540  CQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQES 599
            CQTPVDVKQRT+LRARLKNAGLPRILNKMK LNYEKVDEQLA F+DSTTDDFD LYSQ  
Sbjct: 538  CQTPVDVKQRTILRARLKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTTDDFDTLYSQGP 597

Query: 600  TGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLK 659
             GE ++M+DPVSMTQNLW+LCKGT+AE+HL SLLQNLLISTGELG  +K+DP QRTKQLK
Sbjct: 598  NGELINMQDPVSMTQNLWDLCKGTEAEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLK 657

Query: 660  LIDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDN 719
            LIDALVSNVSMASVD+QSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKA+R+N
Sbjct: 658  LIDALVSNVSMASVDLQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAERNN 717

Query: 720  LKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELR 779
            LKEKLSNAEGGLVGQLQ+E++QRDHILEKSQRV AQLQHELDESKKKLILAKH+HEVELR
Sbjct: 718  LKEKLSNAEGGLVGQLQEELKQRDHILEKSQRVTAQLQHELDESKKKLILAKHQHEVELR 777

Query: 780  KTLTAMNSNFEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINVESKRLGL 839
            KTLTA+NS  +G      E G + P+PL+PER LAIQ+ALQ KLEKTSKEI VES RLG+
Sbjct: 778  KTLTALNS--KGGDIQLTEDGGQ-PKPLKPERMLAIQRALQIKLEKTSKEITVESSRLGV 834

Query: 840  SLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSESEEKAQ 899
            SLEPNKRL+LLRSRME+IENQARELEMTNFS+Y++D  KE E+++E  H   S+ +    
Sbjct: 835  SLEPNKRLRLLRSRMEEIENQARELEMTNFSEYREDADKEIEMAHEGTHMYPSDVDVGTT 894

Query: 900  QIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKGFGI 959
            Q                Q ESNDISKFNVEGRFHEMFS QK  ALDRLKKLE DY GFGI
Sbjct: 895  QDSNLKLEQLRRKLASLQNESNDISKFNVEGRFHEMFSDQKIQALDRLKKLENDYSGFGI 954

Query: 960  NFDP-DSPLGQALAGKSVSSDDKARTLDPKEALNIVE----EVSNILSGLDSSKAAEKSN 1014
            N+DP +SP  +   G+ V   +K+RTLDPK   N V+    E     + +DSS A+E   
Sbjct: 955  NYDPAESPSLKQEQGQDV---NKSRTLDPKGPNNSVDESQLETDRANASIDSSPASESLE 1011

Query: 1015 ETPLRTATXXXXXXXXXXXKNGDKIAADSTLPTSSFLESLSQKYGGAQNSLSNRHSFAGG 1074
            E  +                  ++I         SFLE LSQKYG  Q +LSNR+S  G 
Sbjct: 1012 EEDVHLTKSTT-----------EEIGG-------SFLERLSQKYGKGQANLSNRNSVVGR 1053

Query: 1075 EINYPGSGYHRKSFMNRVKRTGAVPYLGELSGKIGSSSYIKPSEAEENVGIGIMVDEKPL 1134
            E +YPGSGYHRKSFMNRVK++  VPYL ELSGK G++++   +E+EEN GIGI V+ + L
Sbjct: 1054 ENSYPGSGYHRKSFMNRVKKSDNVPYLEELSGKFGTATH--ENESEENFGIGIRVNNEQL 1111

Query: 1135 SRRVQEDAAGVSQLESNEEKPALSHDLDKNTT------HSKPITIGENLAAAKTAGKQQA 1188
            +    +D           + P   +   K TT      H K   + ++ A+  T      
Sbjct: 1112 TSLPSKDKENHGHTILQSQDPTRQY---KATTEESSHGHPKAKDVQQDSASLLT------ 1162

Query: 1189 HEDEGTTEGSSTDKDSHEIASATSA 1213
                 TTE  S D+D  EI  + SA
Sbjct: 1163 -----TTENISDDEDEGEIIESVSA 1182

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/677 (71%), Positives = 542/677 (80%), Gaps = 21/677 (3%)

Query: 1315 RNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKG 1374
            R+++ TPSPMLPQSPSLF+RYPRP+KKLKQLHWEKIDDAEDSIW++AKAE+FADDLYEKG
Sbjct: 1298 RSRTTTPSPMLPQSPSLFERYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKG 1357

Query: 1375 VLSRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILR 1434
            +LSRLEKAFAAREI                    VSQQFGINLHMYSSLSVEEVV+KIL+
Sbjct: 1358 ILSRLEKAFAAREIKSLTSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILK 1417

Query: 1435 CDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRA 1494
            CD+DFL+TPSVI+FLSKQEIVEVSNNLARNFAPYT DWEG+++V++AKPPEKDP+ELQRA
Sbjct: 1418 CDKDFLTTPSVIEFLSKQEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRA 1477

Query: 1495 DRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLD 1554
            DRLYLELFVNLQ YWSSRMRALKVIT+YEK+YSDL+HKL MIDKATC+IQQSENLRNVLD
Sbjct: 1478 DRLYLELFVNLQGYWSSRMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLD 1537

Query: 1555 VILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKE 1614
            VILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKI+RETYPEFN FLKE
Sbjct: 1538 VILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKE 1597

Query: 1615 LEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPE 1674
            LEPVVAAVKISIEQV+QDC+EFSQSVINVERSVDIGNLSD +KFHP DR LLKVLP LPE
Sbjct: 1598 LEPVVAAVKISIEQVSQDCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPE 1657

Query: 1675 ARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXX 1734
            ARKKGDLLMDEMKLTLLEFDNLM++FGEDAMDKF+RNSFFKKFADFL EYKKAQ YN   
Sbjct: 1658 ARKKGDLLMDEMKLTLLEFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKL 1717

Query: 1735 XXXXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNA 1794
                         VE+Q +R RES ++ + + D   D      + DRDVMDRLLEKLKNA
Sbjct: 1718 EEEEKAYERRKKMVEEQQRRARES-NEQENSVDGNADD-NTAASGDRDVMDRLLEKLKNA 1775

Query: 1795 GPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQL-NE 1853
            GP KSDPSS          LLQGSSSNSTILDNF+IE  +GKSLVYSP+    +V L N 
Sbjct: 1776 GPGKSDPSSARKRAIARRKLLQGSSSNSTILDNFEIEKPEGKSLVYSPE----QVTLSNS 1831

Query: 1854 ADTSPTPERRVRDSNATSPASHDTGSSDLTDRARNLLIELRGPESPGVKMSAQHQRLSKL 1913
             D SPTP+ R R+  +T+     + SSDLTDRARNLLIELRGPESP  + S++ QR+SKL
Sbjct: 1832 VDHSPTPDVRKREGQSTASEVQTSESSDLTDRARNLLIELRGPESPSRRASSKDQRISKL 1891

Query: 1914 RARRKND-SSSSGSENRLNFVGAGQAENSDEQNEPEVLKSK----PESANDDDNG----- 1963
            RARRKND S +SGS+N LNFVG   A   D      V + +     ES+  ++ G     
Sbjct: 1892 RARRKNDGSGNSGSDNHLNFVGQEGAALPDSDQNHRVEEEEESILAESSRAEETGTDKPN 1951

Query: 1964 ----EQSDSSDGEFLDA 1976
                + SDSSD EFLDA
Sbjct: 1952 YNDPDYSDSSDAEFLDA 1968

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score = 1058 bits (2737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/1163 (50%), Positives = 770/1163 (66%), Gaps = 57/1163 (4%)

Query: 1    MNRSSNSKXXXXXXXXXXXXXXXXXXXXXXLKRLTTGSGNSSVSHNTQKLDISDISSPKK 60
            MNRSSNS                       LK+LT GSGN++ + N  K++ SDISSPK 
Sbjct: 1    MNRSSNSGSRRTSHNHSSSNSSGSGGLFSNLKKLT-GSGNNANTSN--KIEPSDISSPKI 57

Query: 61   INLPDTGEFSHKPLSKQSTLNMASLSAYTDA-VGAHNRSASNASVGSPTKYSYSRRASQW 119
            ++ P   EFS KPLSKQ+TLN  +LS+Y D     HNRS S  S GSPTKYSYSRR+SQW
Sbjct: 58   VSTPAVPEFSGKPLSKQTTLNTQNLSSYVDMNTPHHNRSPSGMS-GSPTKYSYSRRSSQW 116

Query: 120  SNNNSAVSGSKLSRQQTNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEELF 179
            SN N+  +G +LSRQQTN               NL+KF+G DG V+L+RP +P+EIE+LF
Sbjct: 117  SNGNNIGNGGRLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLF 176

Query: 180  EEVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKNXXXXXXXXXXX 239
             E+++KRN +QSLPA+ Q+EL NYDL+KKWL+V+QDLQSE+KK  N KN           
Sbjct: 177  AELMHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKLANKKNTHVAPAGAAGL 236

Query: 240  XXXXXXXXXXXXXXXXXXXXGSFTGLSRPKISTSS-VNTSEQFYXXXXXXXXXXXXXQDP 298
                                      S+   STSS +     FY             QDP
Sbjct: 237  AATISAATQGTSGAGGVGGVDGTQAGSKGHNSTSSPILGGGGFYESGNQNSSTATLSQDP 296

Query: 299  SHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRE 358
             HLSPDYYVRKII + IS K+L DLWVSLRTEQLDWV GFL+AQGQVAIANV+L+  ++E
Sbjct: 297  LHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKE 356

Query: 359  SPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRR 418
            SPD LL DE LDKEFA+FKCLKT LNL+EGA+EAV +   +++VSAI +GLLSLR++TRR
Sbjct: 357  SPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRT---KLVVSAITDGLLSLRISTRR 413

Query: 419  VASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTP 478
            +ASE+L+ ++QW +P+G N V+  LDQES    NVHLQARL++ +     K+ S +A   
Sbjct: 414  IASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSAN-----KRDSLLAQDH 468

Query: 479  DGD--GDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLI 536
            + D   D   +KFEQW+ VVEYTLDGRGKMGSLVGASEDF+++GGENAI+EY YLTLLL+
Sbjct: 469  ELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLV 528

Query: 537  NHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYS 596
            N LC TP DV QRT+LR+R K+ GL RI+ K++LLNY+K+DEQL  F+D T DD++ + +
Sbjct: 529  NQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMA 588

Query: 597  QESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTK 656
             +S    VDM++P+S+ QNLW   KGT AE++L SL+Q+L I++ ++  +  DDPT+ +K
Sbjct: 589  SKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEG-DDPTEASK 647

Query: 657  QLKLIDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAD 716
            QLKLID+LVSNV+M+S+D +SSFN AIQRLYD+MQTDE+ARRAI+E R+  +++EE+KA+
Sbjct: 648  QLKLIDSLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAE 707

Query: 717  RDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEV 776
            RD L EKLS AEGGLVGQLQ+E+ QRD ILEK+QRV  QLQ +L+E KKK +L KHEHEV
Sbjct: 708  RDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADLEELKKKHLLEKHEHEV 767

Query: 777  ELRKTLTAMNSNFEGSHNMRDEKG----SENPRPLRPERKLAIQKALQAKLEKTSKEINV 832
            ELRK LT +NS  +GS  +++E+     S  P  L  +RKLAIQKALQ +L++T K++  
Sbjct: 768  ELRKLLTILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTK 827

Query: 833  ESKR----LGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKE--------P 880
            ESKR    LG +LEPN+RLKLLRSRMEDIEN+ARELEMTNF+D Q+  ++E        P
Sbjct: 828  ESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTVVPALPP 887

Query: 881  EVSNEDDHKAVSESEEKAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQK 940
                  D    ++ + K  Q+               Q+ESND+SKFNVE R +E+F+ +K
Sbjct: 888  PAVPVLDRAPKAKKQVKEDQV--RKLRELRQRLASVQKESNDVSKFNVEERINELFNDKK 945

Query: 941  SLALDRLKKLETDYKGFGINFDPDSPLGQALAGKSV----SSDDKAR-TLDPKEALNIVE 995
              ALDRLK+LET YKGFGI+F  D  L   L+        + D +A  +LDPK     +E
Sbjct: 946  LSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHAKDGQAHPSLDPKHLSRKIE 1005

Query: 996  EVSNILSGLDSSKAAEKSNETPLRTATXXXXXXXXXXXKNGDKIAADS-TLPTSSFLESL 1054
            E+S I+  L + K  E  N  P  +++           +  D+ +  S    T SFLE+L
Sbjct: 1006 EMSKIVDELTAFK-KEIENGPPSSSSS-----SSDEELEQDDRASIHSGNASTGSFLETL 1059

Query: 1055 SQKYGGAQNS--LSNRHSFAGGEINYPGSGYHRKSFMNRVKRTGAVPYLGELSGKIGSSS 1112
            SQKYG  QN+   ++  +  G E NYPG GYHR+SFM RVK++ A P+L EL+ K+   +
Sbjct: 1060 SQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSDAAPFLSELTQKVAPKT 1119

Query: 1113 YIKPS--------EAEENVGIGI 1127
             I  +          EE++GIGI
Sbjct: 1120 PIDGAYEIEVGARSEEEHIGIGI 1142

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/642 (61%), Positives = 474/642 (73%), Gaps = 21/642 (3%)

Query: 1317 KSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVL 1376
            ++ATPSP+LPQSPSLF+RYPRP KKLKQLHWEKI+D  +SIW+DAKAEK+ADDLYE+GVL
Sbjct: 1292 RAATPSPLLPQSPSLFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVL 1351

Query: 1377 SRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCD 1436
            ++LEKAFAAREI                    VSQQFGINLHMY++LSV+EVV KILRCD
Sbjct: 1352 AQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCD 1411

Query: 1437 RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADR 1496
            +DFL + SVIDFL K EIVEVSNNLARNFAPY+ +WEGVSSV+ AK PEKDP ELQRAD+
Sbjct: 1412 KDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQ 1471

Query: 1497 LYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556
            LYLE+ VNLQ YW+SRMRALKVITTYEK+YSDL+ KL  IDKA  SIQ S+NLR+V +VI
Sbjct: 1472 LYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVI 1531

Query: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616
            LAVGN+MNDSSKQA GF+LATLQRLTFIKD+KNSMTFLNYVEKIIRE Y EFN FL+ELE
Sbjct: 1532 LAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELE 1591

Query: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676
            PV+  VKIS+EQ+A DCREFSQ+++NVERS+++GNLSD +KFHP DRVL+KVLP LPEAR
Sbjct: 1592 PVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEAR 1651

Query: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXX 1736
            K+ DLL DE+KLTL+EFD LM++FGEDA DKFA+NSFFKKFADF+ EYKKAQ +N     
Sbjct: 1652 KRSDLLSDEVKLTLMEFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKMEE 1711

Query: 1737 XXXXXXXXXXXVEDQLKRTR-ESESKNKGTTDAGGDS--VRNEVNEDRDVMDRLLEKLKN 1793
                       VE+Q KR R E+E   KG  D G ++  V      +RDVMD+LLEKLKN
Sbjct: 1712 EERAYERRKKMVEEQHKRARLEAE---KGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKN 1768

Query: 1794 AGPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSD--GKSLVYSPDNNSSEVQL 1851
            AGP KSDPSS          LL G  S++ ILDNF+++++    +SLVYSP+        
Sbjct: 1769 AGPGKSDPSSARKRALARKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANA 1828

Query: 1852 NEADTSPTPERRVRDSNATSPAS-----------HDTGSSDLTDRARNLLIELRGPESPG 1900
              A+ SPTP+   + S A S A+              G  D+ DRARNLL ELRGPES  
Sbjct: 1829 AHAE-SPTPKASRQGSVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPESEK 1887

Query: 1901 VKMSAQHQRLSKLRARRKNDSSSSGSENRLNFVGAGQAENSD 1942
             K   +  R  K+RARR+  +  + SEN+L FVG      +D
Sbjct: 1888 RKPLLEDHR-EKMRARRRRVNEGASSENKLVFVGGASEAPTD 1928

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/1156 (41%), Positives = 674/1156 (58%), Gaps = 138/1156 (11%)

Query: 31   LKRLTTGS--GNSSVSHNTQKLDISDISSPKKINLPDTGEFS-----HKPLSKQSTLNMA 83
            LK+L TG   G+S  S   ++L    ISSPK++    + E +      KPL+K S+LN  
Sbjct: 33   LKKLATGGNHGSSQPSQTRKEL----ISSPKRVFTTASLESATPIGGSKPLNKISSLNTH 88

Query: 84   SLSAYTDAVGAHNRSASNASVGSPTKYSYSRRASQWSNNNSAVSGSKLSRQQTNXXXXXX 143
            +LS YT    A++RS S + + SPTKYSYSRR+SQ            L+R  TN      
Sbjct: 89   NLSHYTMDPEANSRSQSASLLTSPTKYSYSRRSSQ------------LTRSSTNKSIISS 136

Query: 144  XXXXXXXXXN--LSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELN 201
                        L++F+  DG ++L+RP +P+EI  LF ++L KRNV+ S+ +  Q+++ 
Sbjct: 137  SAVSVSSNSTSILNRFLTNDGTLKLDRPENPEEINGLFMDLLIKRNVFDSVSSQDQKDML 196

Query: 202  NYDLEKKWLMVRQDLQSEVKKFMNSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGS 261
            NY +EKKWLMV+QDLQSE K+  ++K                                  
Sbjct: 197  NYPIEKKWLMVKQDLQSEFKRLKSTKPRFSANDTQ------------------------- 231

Query: 262  FTGLSRPKISTSSVNTSEQFYXXXXXXXXXXXXXQDPSHLSPDYYVRKIICNDISAKRLN 321
               + + K STS +NT    Y               PSH  P+YYVR+II   I  K LN
Sbjct: 232  --NMLKRKTSTSKLNTQ---YEGMLHTNESQGSLLSPSHFPPEYYVRQIISKKIKNKELN 286

Query: 322  DLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDN---LLGDEVLDKEFAYFKC 378
            DLWVSLRTE LDWV  FLEAQGQVAIAN+I+ + ++++ DN   +   + L++E A FKC
Sbjct: 287  DLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTDNQNAVTDPQFLERETALFKC 346

Query: 379  LKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISL--------SQW 430
            L+  LN+RE  +EAV S    ++ +A+VEGLLS ++ TRR+A+E LI L        S+ 
Sbjct: 347  LRVLLNIRECLEEAVNST---LVTNALVEGLLSTKIPTRRLATETLIYLVTKDEDFKSRT 403

Query: 431  SLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFE 490
            +    F+ VM++L+ E+    N+H++A+  T   S DP+    +         +V +  +
Sbjct: 404  AGLDCFSLVMESLNHETSLVQNIHMKAKFSTND-STDPESNPQLY--------QVCKILQ 454

Query: 491  QWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRT 550
            QW+ VVE TLDGRGKMGSLVGAS+++R + GEN+I EY   +++LI+ LC    DVK+R 
Sbjct: 455  QWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQLCLNNEDVKKRH 514

Query: 551  VLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPV 610
            ++R +LK+ GL RIL KM+LL+Y  +   L +F+D+  DD+++L   +   E VDM DPV
Sbjct: 515  MMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQKFTENVDMDDPV 574

Query: 611  SMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSM 670
            S+ Q L +  KGT+AE +L S+LQNL +S+ +  ++  DDP +  +QLKLID+L+SNV++
Sbjct: 575  SILQKLTSSFKGTEAESYLLSMLQNLFLSSNK-NAQESDDPGKNVQQLKLIDSLISNVAI 633

Query: 671  ASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGG 730
             ++D +S+FN AIQRLYD+MQTDEIARRAILE+R+  K+ EE+KA+RD L +K+S AE G
Sbjct: 634  TTLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDYLNDKISKAENG 693

Query: 731  LVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFE 790
            LVGQLQ E+ +RD IL+K+QRV  QLQ EL+E KK+ +L KHEHE+ELRK LT +NS  +
Sbjct: 694  LVGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIELRKMLTIVNS--K 751

Query: 791  GSHNMRDEKGSEN-PRPLRPERKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKL 849
             S ++      +N P+PL PERK AIQ  LQ  L+KT +++  ES+RLG ++    RLKL
Sbjct: 752  TSDDLESGSTVQNDPKPLNPERKTAIQNVLQRSLQKTEQDLLNESRRLGTAVGSKSRLKL 811

Query: 850  LRSRMEDIENQARELEMTNFSDYQ-KDDIKEPEVSNEDDHKAVSESEEKAQQIXXXXXXX 908
            LRS+MEDIENQARELEMTNF+D + K + K  E         ++E  +K   I       
Sbjct: 812  LRSKMEDIENQARELEMTNFADVKPKQNQKFKEQVKGQQATKLAELRKKLAII------- 864

Query: 909  XXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLG 968
                    Q ESNDI+KFN+E R +E+F  +K  ALDRLK LE  Y GF I+F  D  L 
Sbjct: 865  --------QNESNDITKFNIEARVNELFQDKKLAALDRLKDLENKYNGFHIDFADDPELK 916

Query: 969  QALAGKSVSSDDKARTLDPKEALNIVEEVSNILSGLDSSKAAEKSN----------ETPL 1018
            + L      S +   +LDP      VEE+++I+  L++ K   K+            +  
Sbjct: 917  ELLT----QSSNGGPSLDPTIVQRKVEEMNSIIDELNALKEEMKNRPKTGSSSSSSSSLS 972

Query: 1019 RTATXXXXXXXXXXXKNGDKIAADSTLPTSSFLESLSQKYG-GAQNSLSNRHSFAGGEIN 1077
              ++            +G  I ++     SSFLESLSQKY  G Q + S      G E  
Sbjct: 973  SASSSSEDGSSQSQASHGSDIVSNG----SSFLESLSQKYSTGQQTATSTNGGRVGRETR 1028

Query: 1078 YPGSGYHRKSFMNRVKRTGA---------VPYLGELSGKIGSSSYIKPSEAEENVGIGIM 1128
            YPGSGYHRKSF+NR+K T            P+L EL  K+  +  I     +  VGIGI 
Sbjct: 1029 YPGSGYHRKSFLNRLKNTTVNPTATSEHLPPFLTELKSKVKMTDDID----DVPVGIGIS 1084

Query: 1129 VD--------EKPLSR 1136
            V         EKP+S+
Sbjct: 1085 VSPGASLKSTEKPVSQ 1100

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/668 (55%), Positives = 470/668 (70%), Gaps = 44/668 (6%)

Query: 1317 KSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVL 1376
            K+   SP+LPQSPSLF+RYPRP KKLKQLHWEKID+A DSIW++A+AEK ADDL+E+GVL
Sbjct: 1211 KATVTSPLLPQSPSLFERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVL 1270

Query: 1377 SRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCD 1436
            S+LEKAFAARE                     VSQQFGINLHM+S+L V++VV K+++CD
Sbjct: 1271 SQLEKAFAARETKSLKGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCD 1330

Query: 1437 RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADR 1496
            R+FLSTPSVI+FLSK  I+EV+NNLAR F PY+ DWEGV+SV++AKPPEKDP ELQRAD+
Sbjct: 1331 REFLSTPSVIEFLSKPTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQ 1390

Query: 1497 LYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556
            LY+E  +NLQ YW SRMRA+ +ITTYEKDYSDLV KL  ID+A   I+QSE+LR+V DVI
Sbjct: 1391 LYVEFMINLQPYWGSRMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVI 1450

Query: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616
            LAVGN+MNDSSKQAQGF+L+TLQRLTFIKD+KNSMTFLNYVEKIIRE YPE++ F++ELE
Sbjct: 1451 LAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELE 1510

Query: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676
            P+ +  KISIEQ+  DC+EFSQSVINVERS++IGNLSDP+KFHP DRVL KV+P LPEAR
Sbjct: 1511 PIFSVTKISIEQLVTDCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEAR 1570

Query: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXX 1736
            KK DLL DE+KL+LLEF+NLM+ FGEDA DKF++NSFF+KFADF+ E+KKA+ +N     
Sbjct: 1571 KKADLLSDEIKLSLLEFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEE 1630

Query: 1737 XXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGP 1796
                       +EDQ ++ +E++SK      A   S   E ++DRD +++LL+KLKNA P
Sbjct: 1631 EERAYERRKKMIEDQQRKQQEADSK----ATAKNLSTSQEPSDDRDDIEKLLDKLKNAAP 1686

Query: 1797 AKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNEADT 1856
            +K DPSS          LL G S  ++I DN    DS  ++ V   + N +  +      
Sbjct: 1687 SKGDPSSTRKRALARKKLLDGKSG-ASIFDNI-TADSTIEAFV---EQNRTLTE------ 1735

Query: 1857 SPTPERRVRDSNATSPASHDTGSS--DLTDRARNLLIELRGPE-----SPG-VKMSAQHQ 1908
            SPT ++     +A+ P +    SS  D  DRARNLL+ELRGP+     SP  +K   + +
Sbjct: 1736 SPTAKK-----SASLPETESLSSSKQDPADRARNLLLELRGPDERKDASPSPIKAKDKLR 1790

Query: 1909 RLSKLRARRKNDSSSSGSENRLNFVGAGQAENSDEQNEPEVLKSKPESANDDDNGEQSDS 1968
             L K  +  K D       N+L FVG+ +         P     KP S    D  + S+S
Sbjct: 1791 DLKKKDSSVKVDQP-----NKLQFVGSLEV-------GPH---PKPLSPT-QDLMDTSNS 1834

Query: 1969 SDGEFLDA 1976
            S+ EF+DA
Sbjct: 1835 SEDEFIDA 1842

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1004 (44%), Positives = 623/1004 (62%), Gaps = 80/1004 (7%)

Query: 41   SSVSHNTQKLDISDISSPKKINLPDTGEFS-HKPLSKQSTLNMASLSAYTDAVGAHNRSA 99
            SS + + Q++  SDISSPKK+++P + + S  KPLSK STLN +SLS Y D +      +
Sbjct: 46   SSSALSQQRIATSDISSPKKVSIPSSLDLSTAKPLSKHSTLNTSSLSQYADEIAQSRTPS 105

Query: 100  SNASVGSPTKYSYSRRASQWSNNNS----------AVSGSKLSRQQTNXXXXXXXXXXXX 149
               S+GSP+KYSYS+R+SQWS  NS            S   LSRQ TN            
Sbjct: 106  GPVSLGSPSKYSYSKRSSQWSGGNSNKQLLLLPQPQHSQHTLSRQPTNQSNNSDNSFSSV 165

Query: 150  XXXNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKW 209
                L K    DG + LE+P+ P+EIEEL++E+L KRN+  S+   + REL  YDL+KKW
Sbjct: 166  TL--LQKITDSDGNLSLEKPKYPQEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKW 223

Query: 210  LMVRQDLQSEVKKFMNSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFTGLSRPK 269
            LMV+QDLQ+E+K+  N+                                  +   L  P+
Sbjct: 224  LMVKQDLQAELKRMKNN-----------------------VPQSTVADPLSNSVHLKSPR 260

Query: 270  ISTSSVNTSEQFYXXXXXXXXXXXXXQDPSHLSPDYYVRKIICNDISAKRLNDLWVSLRT 329
             S SS N S +                DPSHLSPD+YVRKII + I+A  LNDLWVSLRT
Sbjct: 261  GSFSSSNMSAR--SISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRT 318

Query: 330  EQLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLREGA 389
            E +DWV GF++AQGQVAIAN ++K   RES ++LL  ++L+KE AY+KCL+   NLREG 
Sbjct: 319  ESIDWVIGFIDAQGQVAIANRLIKFAQRESLESLLDSDLLEKETAYYKCLRVLTNLREGM 378

Query: 390  DEAVMSNSARIIVSAIVEGLLSLRVATRRVASE-LLISLSQWSLPHG---FNH---VMDA 442
              A+   S+++++SA+VEGLLS+R+ TRR+A+E LL  L+   L      F+    V+ A
Sbjct: 379  QAAL---SSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHA 435

Query: 443  LDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEYTLDG 502
            LDQES++  ++HL+ RL       +  K  S+ PT   D   + +K EQW+ V+EYTLDG
Sbjct: 436  LDQESKYSSSIHLRGRL------HETNKRRSL-PTGRADLHVIAKKIEQWLYVLEYTLDG 488

Query: 503  RGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLP 562
            RG+MGSLVGASED++   GEN ++EY   +++LIN LC +  D+ QR +LR+RLK+ GL 
Sbjct: 489  RGRMGSLVGASEDYK--NGENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLS 546

Query: 563  RILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKG 622
            R++ KM+LL Y  ++ ++++F+D T DD+++L +  +    VDMKDP S+  N W   KG
Sbjct: 547  RVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKG 606

Query: 623  TDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSFNSA 682
            T++E HL SL+Q+L + + +  S++ D P + +KQLKL+DALVSNV+ +S+D +S FN A
Sbjct: 607  TESEAHLLSLMQHLFLWSSKAFSESTD-PAEGSKQLKLLDALVSNVTFSSIDTESGFNGA 665

Query: 683  IQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQR 742
            IQRLYDAMQTDE+ARRAILE+R+  K+ EE+KA+RD+L+ KL+ A+ GLVGQLQ EV+Q 
Sbjct: 666  IQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAQDGLVGQLQGEVQQL 725

Query: 743  DHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHN---MRDEK 799
              ILEKS RV  QL+ +L + KKK +L KHEHEVELRK LT +NS    + N     D  
Sbjct: 726  QRILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELRKMLTILNSKPNDASNDAVSPDGI 785

Query: 800  GSENPRPLRPERKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSRMEDIEN 859
             ++ P PL+PE+K+AIQKALQ +L +T K++  +S+R G    PN+RLK+LRS+M+DIE 
Sbjct: 786  NNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEK 845

Query: 860  QARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSESEEKAQQIXXXXXXXXXXXXXXXQQE 919
            +A  LEMTNF++++    KE +V +    ++  + E   +                 QQE
Sbjct: 846  EALMLEMTNFAEFK----KETKVEDLPRLQSPPKIERNVRSEKVKELAALRQRLAVIQQE 901

Query: 920  SNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKGFGINF--------------DPDS 965
            SN+ISKFNVE R +E+F  +K+ ALDRL+ LE  Y+ FGI+F              D D+
Sbjct: 902  SNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDA 961

Query: 966  PLGQALAGKSVSSDDKARTLDPKEALNIVEEVSNILSGLDSSKA 1009
             +G+A    + +S D    LDP      +EE++ IL  L+  K 
Sbjct: 962  SVGEASNSTAPNSLDSC-VLDPARLDAKIEEMTKILEELNRLKC 1004

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/527 (63%), Positives = 410/527 (77%), Gaps = 9/527 (1%)

Query: 1317 KSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVL 1376
            K ++PSP+LPQSPSLF++YPRP K+LKQLHWEKIDD ++SIW +A+AEKFADDLYE+GVL
Sbjct: 1385 KGSSPSPLLPQSPSLFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVL 1444

Query: 1377 SRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCD 1436
            + LEKAFAAREI                    +SQQFGINLHMYSSL+V+++V+KIL+CD
Sbjct: 1445 TELEKAFAAREIKSLISRKKDENKVTFLSRD-ISQQFGINLHMYSSLTVDQIVTKILKCD 1503

Query: 1437 RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADR 1496
            +DFL+T S I+FLSK EIVEVS N+AR FAPYT DWEGVSSVE AK PEKDP ELQRAD+
Sbjct: 1504 KDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQ 1563

Query: 1497 LYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556
            LYL+L VNLQ+YW+SRMRALK+ITTYEKDY+DL+ KL  +DKA  +IQ+SENLRNV DVI
Sbjct: 1564 LYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVI 1623

Query: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616
            LAVGN+MNDSSKQAQGF+L+TLQRLTFIKD+KNSMTFLNYVEKI+R  YP F+ FL+ELE
Sbjct: 1624 LAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELE 1683

Query: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676
            PV+  VKISIEQ+A DC EF  +V NVERS++IGNLSD +KFHP+DRVL KVLP LPEAR
Sbjct: 1684 PVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEAR 1743

Query: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXX 1736
            K+ +LL DE++L+L+EF++LMRLFGED+ DKFA+NSFF+KFADF+LEYK+AQ +N     
Sbjct: 1744 KRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEE 1803

Query: 1737 XXXXXXXXXXXVEDQLKRTRESESKNKGTTDAG---GDSVRNEVNEDRDVMDRLLEKLKN 1793
                       +E+Q KR R++   +   +  G     S  +   +DRDVMDRLLEKLKN
Sbjct: 1804 EERAYERRKIMIEEQQKRARKNIQIDTSFSRRGSSLSTSSISASGDDRDVMDRLLEKLKN 1863

Query: 1794 AGPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIED-----SDG 1835
            AGP+K+DPSS          L+ G  S S ILD  D+E+     SDG
Sbjct: 1864 AGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDG 1910

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 62/118 (52%), Gaps = 30/118 (25%)

Query: 1041 ADSTLPTS--SFLESLSQKYGGAQN---------SLSNRHSFAGGEINYPGSGYHRKSFM 1089
            +DS L TS  SFLESLSQKYG   N          LS+  +F  G+ +   SGYHRKSF+
Sbjct: 1100 SDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAGDSSQRNSGYHRKSFV 1159

Query: 1090 NRVKRTG---AVPYLGELSGKI----------------GSSSYIKPSEAEENVGIGIM 1128
            NR+K+     +  ++ E+S K+                 SSS  + +++E+ VGIGI 
Sbjct: 1160 NRMKKNSTPKSSSFVDEVSQKMTPVHVAQSPDSLQNTATSSSTPQSAKSEDAVGIGIF 1217

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/592 (59%), Positives = 424/592 (71%), Gaps = 39/592 (6%)

Query: 1314 SRNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEK 1373
            S+    +PSP+LPQSPSLF+RYPRP KKLKQLHWEKIDD ++SIW +A+AEKFADDLYEK
Sbjct: 1349 SKTYGGSPSPLLPQSPSLFERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEK 1408

Query: 1374 GVLSRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKIL 1433
            GVLS LEKAFAAREI                    +SQQFGINLHMYSSL V  VVSKIL
Sbjct: 1409 GVLSELEKAFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKIL 1468

Query: 1434 RCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQR 1493
            +CD+DFLST S I+FLSK EIVEVS N+AR+FAPYT DWEGVSSVE+AK PEKDP+ELQR
Sbjct: 1469 KCDKDFLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQR 1528

Query: 1494 ADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVL 1553
            +D+L+L L VNLQ+YWSSRMR LK+ITTYEKDY+DL+ KL  +DKA  +IQ+SENLRNV 
Sbjct: 1529 SDQLFLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVF 1588

Query: 1554 DVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLK 1613
            DVILAVGN+MND+SKQAQGF+L+TLQRLTFIKD+KNSMTFLNYVE+I+ + YP FN FL+
Sbjct: 1589 DVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQ 1648

Query: 1614 ELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLP 1673
            ELEPV+  VKISIEQ+A DC EF  +V NVERS++IGNLSD +KFHP DRVL KVLP LP
Sbjct: 1649 ELEPVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILP 1708

Query: 1674 EARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXX 1733
            EARKK +LL DE++L+L+EF+NLMR+FGEDA DKFA+NSFFKKFADF+LEYK+AQ +N  
Sbjct: 1709 EARKKANLLADEVQLSLMEFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRK 1768

Query: 1734 XXXXXXXXXXXXXXVEDQLKRTR------ESESKNKGTTDAGGDSVRNEVNEDRDVMDRL 1787
                          +++Q +R +      E+         A GD        DRDVMD+L
Sbjct: 1769 IDEEERAYERRKLMIQEQQRRAKLVQEGDETTCARLSAISASGD--------DRDVMDKL 1820

Query: 1788 LEKLKNAGPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSS 1847
            LEKLKNAGP+K DPSS          L+ G    S IL+  D++D    +    PD    
Sbjct: 1821 LEKLKNAGPSKGDPSSARKRALARKKLM-GGREGSIILEGLDVDDLQSAAPDVQPD---- 1875

Query: 1848 EVQLNEADTSPTPERRVRDSNATSPASHDTGSSDLTDRARNLLIELRGPESP 1899
               L  A  SP P+          PA+         DRAR+LL+ELR  E P
Sbjct: 1876 -TPLRAASASPPPD----------PAA---------DRARHLLLELRNGEHP 1907

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/734 (48%), Positives = 485/734 (66%), Gaps = 48/734 (6%)

Query: 297  DPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCY 356
            +P+HLSPD+YVRKII + ++A+ LNDLW+SLRTE +DWV GF++AQGQVAIAN +LK   
Sbjct: 290  EPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQ 349

Query: 357  RESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVAT 416
            RES D L   + L+KE AY+KCL+   NLREG  EA+ S   ++++S++VEGLLS R++T
Sbjct: 350  RESLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKS---KLVISSVVEGLLSSRLST 406

Query: 417  RRVASE-LLISLSQWSLPHG------FNHVMDALDQESRFCDNVHLQARLITQSASKDPK 469
            RRVA+E LL  LS   L            ++ ALDQES+F  N+HL+ RL       +  
Sbjct: 407  RRVATETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRL------HETN 460

Query: 470  KGSSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYA 529
            K  S+ PT   D   V ++ EQW+ V+EYTLDGRG+MGSLVGAS+D++  GGEN ++EY 
Sbjct: 461  KRKSL-PTGRADFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVLEYL 517

Query: 530  YLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTD 589
              +++L+N LC    DV+QR +LR+RLK+ GL RI+ KM+LL Y  ++ ++ +F+D+T D
Sbjct: 518  LYSMILLNLLCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLD 577

Query: 590  DFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKD 649
            D++ L +  +    VDMKDP ++ Q+ W   +GT+AE HL SLLQ+L + +         
Sbjct: 578  DYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHLLSLLQHLFLWSRAFAEYR-- 635

Query: 650  DPTQRTKQLKLIDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKR 709
            DP +  KQLKL+DALV+NV+ +S+D +S FN AIQRLYDAMQTDE+ARRAILE+R+  K+
Sbjct: 636  DPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKK 695

Query: 710  YEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLIL 769
            YEEIKA+RDNL  KLS A+ GLVGQLQ EV Q + ILEKS RV  QL+ EL   KKK +L
Sbjct: 696  YEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQLKGELHALKKKHLL 755

Query: 770  AKHEHEVELRKTLTAMNSNFEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKE 829
             KHEHEVELRK LT +NS   G +    E  +  P PL+PE+K+AIQKALQ +L +T K+
Sbjct: 756  EKHEHEVELRKMLTILNSKPHGENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKD 815

Query: 830  INVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDD--------IKEPE 881
            +  +SKRL     PN+RLK+LRS+M+ IE +AR LEMTNF+D++K+         +  P+
Sbjct: 816  LTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFKKEPEEENEPKLLSPPK 875

Query: 882  VSNEDDHKAVSESEEKAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKS 941
            +      + V E     +++               QQESN++SKFNVE R +E+F  +K+
Sbjct: 876  IQRSLRGEQVKELAALRKRL------------AIIQQESNEVSKFNVEERVNELFYEKKN 923

Query: 942  LALDRLKKLETDYKGFGINFDPDSPLGQA-LAGKSVSSD------DKARTLDPKEALNIV 994
             ALDRL+ LE  YKGFGI+F+ D  L    LA  SV  D      + +  LDP      +
Sbjct: 924  KALDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKI 983

Query: 995  EEVSNILSGLDSSK 1008
            EE++ IL  L+  K
Sbjct: 984  EEMTKILDRLNKLK 997

 Score =  116 bits (290), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 122/218 (55%), Gaps = 32/218 (14%)

Query: 31  LKRLTTGSGNSSVSHNTQKLDISDISSPKKINLPDTGEFS-HKPLSKQSTLNMASLSAYT 89
           L +LT  SG       +Q++  SDISSPKK+ LP   + S  KPL+K +T+N ++L   +
Sbjct: 38  LMKLTGSSG-------SQRIATSDISSPKKVTLPSNLDLSGAKPLNKLNTINASNLPQVS 90

Query: 90  DAVGAHNRSASNASVGSPTKYSYSRRASQWSNNNSA---------------------VSG 128
             V    RSAS A++ SP+KYSYS+R+SQW+++  A                        
Sbjct: 91  GEV-TQARSASGAALSSPSKYSYSKRSSQWASSKQANHPEHDQQYPQHLNHLFVQPHPHH 149

Query: 129 SKLSRQQTNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNV 188
           S L+RQ TN                L K    DG + LE+P DP+EIEEL++E+L KRN+
Sbjct: 150 SALTRQMTNQSNYSASSYTSLSL--LHKATDIDGTLTLEKPEDPQEIEELYQELLQKRNI 207

Query: 189 YQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMNS 226
            QS+     REL +Y ++KKWLMV+QDLQ+E KK  NS
Sbjct: 208 PQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKNS 245

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 46/83 (55%), Gaps = 14/83 (16%)

Query: 1040 AADSTLPTSSFLESLSQKYG-----GAQNSLSNRHSFAGGEI------NYPGSGYHRKSF 1088
             A++ +  +SFLE+LSQKYG     GA +  S+ H      +      N   SG HRKSF
Sbjct: 1078 GAEAIISNASFLETLSQKYGTGSQSGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSF 1137

Query: 1089 MNRVKRT---GAVPYLGELSGKI 1108
            +NR+KRT    +  +L EL+ K+
Sbjct: 1138 VNRMKRTITPTSSNFLEELTQKV 1160

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/626 (55%), Positives = 453/626 (72%), Gaps = 10/626 (1%)

Query: 1314 SRNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEK 1373
            S+ KSA  SP+LPQSPSLF++YPRP KKLKQLHWEK+D  ++SIW   KAEKFADDLYEK
Sbjct: 1330 SQIKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEK 1389

Query: 1374 GVLSRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKIL 1433
            GVL+ LEKAFAAREI                    +SQQFGINLHMYSSLSV ++V KIL
Sbjct: 1390 GVLADLEKAFAAREIKSLASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKIL 1449

Query: 1434 RCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQR 1493
             CDRDFL TPSV++FLSK EI+EVS NLARN+APY+ DWEGV ++E+AKPPEKDP +LQR
Sbjct: 1450 NCDRDFLQTPSVVEFLSKSEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQR 1509

Query: 1494 ADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVL 1553
            AD++YL+L VNL++YW SRMRAL V+T+YE++Y++L+ KL  +DKA  ++Q+S+NLRNV 
Sbjct: 1510 ADQIYLQLMVNLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVF 1569

Query: 1554 DVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLK 1613
            +VILAVGNFMND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKI+R  YP FNDFL 
Sbjct: 1570 NVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLS 1629

Query: 1614 ELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLP 1673
            ELEPV+  VK+SIEQ+  DC++FSQS++NVERSV+IGNLSD +KFHP D+VL+K LP LP
Sbjct: 1630 ELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLP 1689

Query: 1674 EARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXX 1733
            EARKKGDLL DE+KLT++EF++LM  +GED+ DKFA+ SFFKKFADF+ EYKKAQ  N  
Sbjct: 1690 EARKKGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLA 1749

Query: 1734 XXXXXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNED-RDVMDRLLEKLK 1792
                          VE+Q KR +E E + + +     +    +  ED R VMD+LLE+LK
Sbjct: 1750 AEEEERLYIKHKKIVEEQQKRAQEKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLK 1809

Query: 1793 NAGPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPD--NNSSEVQ 1850
            NAGPAKSDPSS           L    +   +L++ D E+    S++YSP+  + +++  
Sbjct: 1810 NAGPAKSDPSSARKRALVRKKYLSEKDNAPQLLNDLDTEEG---SILYSPEAMDPTADTV 1866

Query: 1851 LNEADTSPTPERRVRDSNATSPASHDTGS----SDLTDRARNLLIELRGPESPGVKMSAQ 1906
            ++    +P   R V +++   P+   T +     +++DRAR LL ELRG ++P  + S  
Sbjct: 1867 IHAESPTPLATRGVMNTSEDLPSPSKTSALEDQEEISDRARMLLKELRGSDTPVKQNSIL 1926

Query: 1907 HQRLSKLRARRKNDSSSSGSENRLNF 1932
             + L KLRAR++     + + NRL+F
Sbjct: 1927 DEHLEKLRARKERSIGEASTGNRLSF 1952

 Score =  588 bits (1517), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 347/865 (40%), Positives = 522/865 (60%), Gaps = 66/865 (7%)

Query: 297  DPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCY 356
            D ++  P +YV++I+ + +++  + DLWV+LRTEQLDWV  F++ QG +A+ANV++ + Y
Sbjct: 332  DRTNRPPIHYVQRILADKLTSDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIY 391

Query: 357  RESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVAT 416
            + +P   L  E+L+KE ++FKC +    L +G  E    ++ R++   + EGL S ++AT
Sbjct: 392  KTAPRENLTKELLEKENSFFKCFRVLSMLSQGLYEF---STHRLMTDTVAEGLFSTKLAT 448

Query: 417  RRVASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAP 476
            R++A+E+ + + +      F  V+ +LD++ R   N+H+      Q+  K P+  S +  
Sbjct: 449  RKMATEIFVCMLEKKNKSRFEAVLTSLDKKFRIGQNLHM-----IQNFKKMPQYFSHLTL 503

Query: 477  TPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLI 536
                  +  ++  + W+  VE TLDGRGKMGSLVGAS++F+  GGENAI+EY   T++ I
Sbjct: 504  ------ESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFI 557

Query: 537  NHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYS 596
            NHLC    ++ QR +LR +L+N G+ RI+NK+KLL+Y+KV +Q+  +D++  DDF+    
Sbjct: 558  NHLCSCSDNINQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLE 617

Query: 597  QESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTK 656
              +    VD+ DP+S+ +NLW++CKGT+ E+ L SL+Q+L +S+ +L  +N++  ++ TK
Sbjct: 618  ANNKAFNVDLHDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNS-SKLTK 676

Query: 657  QLKLIDALVSNVSMASV-DMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKA 715
            QLKL+D+LV+NVS+AS  D +++ N AIQRLYDAMQTDE+ARRAILE+R   K+ EEI+A
Sbjct: 677  QLKLMDSLVTNVSVASTSDEETNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQA 736

Query: 716  DRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHE 775
            +RD+L EKLS AE GLVGQL+DE+ +RD IL K+QRV  QL+ EL+E KKK +L KH+ E
Sbjct: 737  ERDSLSEKLSKAEHGLVGQLEDELHERDRILAKNQRVMQQLEAELEELKKKHLLEKHQQE 796

Query: 776  VELRKTLTAMNSNFEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINVESK 835
            VELRK LT +NS  E S N ++E        L    K  IQK LQ  L +  K+   +SK
Sbjct: 797  VELRKMLTILNSRPEESFN-KNEGTRGMNSSLNSSEKANIQKVLQDGLSRAKKDYKDDSK 855

Query: 836  RLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEP--------EVSNEDD 887
            + G++L+PNKRLK+LR +ME+IEN+AR+LEMTNF++++KD ++ P        +     D
Sbjct: 856  KFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKKMKNKD 915

Query: 888  HKAVSESEEKAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRL 947
             K +     K Q+                Q ESNDISKFNVE R +E+F+ +KSLAL RL
Sbjct: 916  RKPLV----KPQEADVNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRL 971

Query: 948  KKLETDYKGFGINFDPDSPL---GQALAGKSVSSDDKARTLDPKEALNIVEEVSNILSGL 1004
            K+LET YKGFGI+F+ D  +    +         D    +LDPK     ++E++ I    
Sbjct: 972  KELETKYKGFGIDFNVDEIMDSPKKNTGDVETEEDANYASLDPKTYQKKLDEINRI---T 1028

Query: 1005 DSSKAAEKSNETPLRTATXXXXXXXXXXXKNGDKIAADSTLPT----------------S 1048
            D     +   E  ++               +  +       PT                 
Sbjct: 1029 DQLLDIQTQTEHEIQVEEDGESDLSSSSSDDESEEIYQDASPTQELRSEHSELSSGSGPG 1088

Query: 1049 SFLESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYH------RKSFMNRVKRT--GAVPY 1100
            SFL++LSQKYG  QN  +   S A GE N  GSG         K+FMNR++++   + PY
Sbjct: 1089 SFLDALSQKYGTGQNVTA---SAAFGE-NNNGSGIGPLHSKVEKTFMNRLRKSTVSSAPY 1144

Query: 1101 LGELSGKIGSSSYIKPSEAEENVGI 1125
            L EL+ K+     ++P E  E+ G+
Sbjct: 1145 LEELTQKVNK---VEPYEQNEDEGL 1166

 Score =  124 bits (310), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 100/171 (58%), Gaps = 15/171 (8%)

Query: 59  KKINLPDTGEFSH-KPLSKQSTLNMASLSAYTDA-----VGAHNRSASNASVGSPTKYSY 112
           +K+N P     +  +PL+K+STLN  +LS Y +      V   ++ A + S+ S  KYSY
Sbjct: 69  RKLNAPSRSTSTEARPLNKKSTLNTQNLSQYMNGKLSGDVPVSSQHARSHSMQS--KYSY 126

Query: 113 SRRASQWSNNNSAVSGSKLSRQQTNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDP 172
           S+R       NS+ + +KL+RQ T                NLSKF  PDG + LE P DP
Sbjct: 127 SKR-------NSSQASNKLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIYLEMPSDP 179

Query: 173 KEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKF 223
            E+E LFE+++YKRN++QSL    Q  L  Y +EKKWL+V+QDLQ+E+KK 
Sbjct: 180 YEVEVLFEDIMYKRNIFQSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKM 230

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/631 (57%), Positives = 455/631 (72%), Gaps = 25/631 (3%)

Query: 1317 KSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVL 1376
            K    SP+LPQS SLF+ YPRP KKLKQLHWEK+D  ++SIW+  KAEKFADDLYEKGVL
Sbjct: 1273 KKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVL 1332

Query: 1377 SRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCD 1436
            + LEKAFAAREI                    +SQQFGINLHMY++L V++VV KIL+CD
Sbjct: 1333 TDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCD 1392

Query: 1437 RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADR 1496
            RDFL TPSVI+FLSK EIVEVS NLARN+APY+ DWEGV SVE+AK PEKDP ELQRAD+
Sbjct: 1393 RDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQ 1452

Query: 1497 LYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556
            LYL+L +NLQ+YW SRMRAL VITT++K+Y++L+ KL  +DKA  S+Q+SENL+NV +VI
Sbjct: 1453 LYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVI 1512

Query: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616
            LAVGN+MND+SKQAQGF+LATLQRLTFIKD  NSMTFLNYVEKI+R  YP FNDFL ELE
Sbjct: 1513 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELE 1572

Query: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676
            PV+  VKISIEQ+  DC+EFSQS++NVERSV+ GNLSD +KFHP DRVL KVLP LP+AR
Sbjct: 1573 PVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDAR 1632

Query: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXX 1736
            KKG+LL DE+KLT++EF  LM+++GED+ DKFA+NSFFKKFADF+ EYKKAQ  N     
Sbjct: 1633 KKGELLGDEVKLTIMEFLRLMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQNIKAEE 1692

Query: 1737 XXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGP 1796
                       VEDQ K+ +E E+ + G+ + G +   ++  + R +MD+LL++LKNAGP
Sbjct: 1693 EEQVYERHKKMVEDQQKKLQEQENGSNGSEN-GEEGSGDDSGDRRAMMDKLLDQLKNAGP 1751

Query: 1797 AKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNS---SEVQLN- 1852
            +K+DPSS          L+  S++   +L + + ED    S++YSP+  +   + V L+ 
Sbjct: 1752 SKTDPSSARKRALVRKKLMTESTA---LLKDIETEDD---SIIYSPEGKNPFVNPVDLDT 1805

Query: 1853 -----EADTSPTPERRVRDSNATSPASHDTGSSD----LTDRARNLLIELRGPESPGVKM 1903
                 E D S +P +R     + SP+ + T  SD    +TDRA+ LL+ELRG  +P  + 
Sbjct: 1806 PHDESEMDVSSSPIQR-----SLSPSRNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRN 1860

Query: 1904 SAQHQRLSKLRARRKNDSSSSGSENRLNFVG 1934
            S   +   KLRARR+  +S   S  RL FVG
Sbjct: 1861 SLLDEHKEKLRARRRKTNSDLHSGTRLQFVG 1891

 Score =  599 bits (1545), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 340/851 (39%), Positives = 515/851 (60%), Gaps = 63/851 (7%)

Query: 297  DPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCY 356
            D ++  P +YV++II + I+++ + DLWV+LRTEQ+DWV  F+E QG +A+AN+++K+ Y
Sbjct: 309  DKTNRPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLY 368

Query: 357  RESPDNLLGDEVLDKEFAYFKCLKT----SLNLREGADEAVMSNSARIIVSAIVEGLLSL 412
            + S D     ++L+KE A+FKC +     S  LRE     +MS +       +  GL S+
Sbjct: 369  KTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQT-------VARGLFSI 421

Query: 413  RVATRRVASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGS 472
             ++TRR+A+E+ + + +   P  F  +++ALDQ+ +   N H+     TQ+    P   +
Sbjct: 422  TLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHM-----TQNIKMFPDYFT 476

Query: 473  SIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLT 532
             +        D  ++  + W+  VE+TLDGRGKMGSLVGAS+DF+ SGGENAI+EY   +
Sbjct: 477  HLT------LDSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWS 530

Query: 533  LLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFD 592
            ++ INHLC    ++ QR +LR +L+N G+ RI+NK+K L+Y+KV EQ+  ++++  DD +
Sbjct: 531  MIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLN 590

Query: 593  ALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPT 652
             L    +    ++++DP SM +NLW+ CKGT+ E+ L SL+Q+L +S+ +   + KD P 
Sbjct: 591  TLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKD-PV 649

Query: 653  QRTKQLKLIDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEE 712
            + ++QLKL+D+LV+NVS++S D ++S N AIQRLYDAMQTDE+ARR+ILE+R   K+ EE
Sbjct: 650  KLSRQLKLLDSLVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEE 709

Query: 713  IKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKH 772
            ++A+RD L +KL NAE GLVGQLQDE+ QRD IL K+QRV  QLQ EL+E KKK +L KH
Sbjct: 710  VQAERDLLSQKLKNAEHGLVGQLQDELAQRDRILSKNQRVMEQLQGELEELKKKHLLEKH 769

Query: 773  EHEVELRKTLTAMNSN---FEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKE 829
            E EVELRK LT +N+     EG+   +  K  +NP  L P +K +IQ+ALQ  L +T K+
Sbjct: 770  EQEVELRKMLTILNARPEIVEGNGTSKKTKA-KNPSALDPSKKQSIQQALQDGLSRTKKD 828

Query: 830  INVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEP-EVSNEDDH 888
             +V+++  G++++PNKRLKLLR +MEDIEN+ARELEMTNF++Y+K  ++ P ++      
Sbjct: 829  YSVDARNFGMTIQPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRKLEAPSKIKKPKKV 888

Query: 889  KAVSESEEKAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRLK 948
                E +    ++               Q ESNDISKFNV+ R +E+F+ ++  AL RL+
Sbjct: 889  ATKKEIDPSINKL-----NDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQ 943

Query: 949  KLETDYKGFGINFDPDSPLGQALA---GKSVSSDDKARTLDPKEALNIVEEVSNILSGLD 1005
             LET YK FGI+F+ D  +  A     G +  S D + +LDPK     ++E++ +   L 
Sbjct: 944  DLETKYKDFGIDFNIDELVDSASKDENGNNQQSGDYS-SLDPKAYQRKLDELNRLTDELL 1002

Query: 1006 SSKAAEKSNETPLRTATXXXXXXXXXXXK---------------NGDKIAADSTLPTSSF 1050
              K    +++  L +                                  +  S  P  SF
Sbjct: 1003 RVKNKVNASDNNLSSRRPSASSSSESASSSSDSDDGESLIERQDTQSNFSGTSAGP-GSF 1061

Query: 1051 LESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTG-AVPYLGELSGKIG 1109
            LE+L+QKY   Q S S R      + N          F+NR+K+T  A P+L EL+ K+ 
Sbjct: 1062 LEALTQKYATGQKSASPRDQSTRMKDNI---------FINRIKQTNVAPPFLDELTDKVA 1112

Query: 1110 SSSYIKPSEAE 1120
             +  ++ S AE
Sbjct: 1113 EAPPVEASLAE 1123

 Score =  114 bits (286), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 92/156 (58%), Gaps = 10/156 (6%)

Query: 70  SHKPLSKQSTLNMASLSAYTDAVGA--HNRSASNASVGSPTKYSYSRRASQWSNNNSAVS 127
           S KPL+K+++LN  +LS Y +   +  H RSAS  S    +    S   +  S  N    
Sbjct: 69  SLKPLNKKTSLNTQNLSQYINDKHSPQHTRSASVQSSSKYSYSRRSSSQTLGSTLN---- 124

Query: 128 GSKLSRQQTNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRN 187
             +++RQ TN               NLSKF+ PDG + LE PRDP E+E LFE+++ KRN
Sbjct: 125 --QIARQHTNQSSASILSQGSFT--NLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRN 180

Query: 188 VYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKF 223
           + QSLP   Q EL +YDLEKKWL+V+QDLQ+E+KK 
Sbjct: 181 ILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKM 216

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/638 (56%), Positives = 450/638 (70%), Gaps = 19/638 (2%)

Query: 1317 KSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVL 1376
            KS + SP+LPQSPSLF+RYPR  KK+KQLHWEKI+  ++SIW   KAE+FADDL+EKGV 
Sbjct: 1285 KSVSSSPLLPQSPSLFERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVF 1344

Query: 1377 SRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCD 1436
            S LEKAFAARE+                    +SQQFGINLHMYSSLSVE++V+KIL+CD
Sbjct: 1345 SNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCD 1404

Query: 1437 RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADR 1496
            RDFL TPSVI+FLSK EI EVS NLARN++PYT DWEG+ S+E+AKPPEKDP +LQRAD+
Sbjct: 1405 RDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQ 1464

Query: 1497 LYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556
            +YL+L VNLQ YW+SRMRALK+ITTYEK+Y++L+ KL  +DKA  S+Q+SENLRNV +VI
Sbjct: 1465 IYLQLMVNLQPYWASRMRALKIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVI 1524

Query: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616
            LAVGN+MND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKIIR  YP FN FL+ELE
Sbjct: 1525 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELE 1584

Query: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676
            PV+  VKISIEQ+A DC+EF QSV NVERS++IGNLSD +KFHP DRVL KVLPTLP+ R
Sbjct: 1585 PVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVR 1644

Query: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXX 1736
            KKGDLL DE+ LTL+EFD LM+++GED  DKFARNSFFKKFADF+ EY+KAQ  N     
Sbjct: 1645 KKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEE 1704

Query: 1737 XXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGP 1796
                       VE+Q ++    E+KN+   D   D  + E  + R  MD+LLE+LKN GP
Sbjct: 1705 EEEAYERHKRMVEEQQRKAERKEAKNQNNIDENEDDDQ-ERTDRRGTMDKLLEQLKNVGP 1763

Query: 1797 AKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNN---SSEVQLNE 1853
            +++DPSS          +L        ++ + + E     S++YSPDN    S+    N 
Sbjct: 1764 SRADPSSARKRALARKKMLTDKEGTVNMMHDLETE---SDSIIYSPDNKAIGSTPFGANG 1820

Query: 1854 ADTSPTPERRVRDSNATSPAS---HDTGSSDLTDRARNLLIELRGPESPGVKMSAQHQRL 1910
            A +        ++SN  SP+     D    ++++RA+ LL+ LRG  SP  + S   +  
Sbjct: 1821 ASSHK------QNSNELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHK 1874

Query: 1911 SKLRARRK--NDSSSSGSENRLNFVGAGQAENSDEQNE 1946
             KLRARR+  N+   SGS N+L F    + + S+E  E
Sbjct: 1875 EKLRARRRRTNNDLPSGS-NKLKFYDTNEKDISNEPTE 1911

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1128 (37%), Positives = 639/1128 (56%), Gaps = 86/1128 (7%)

Query: 31   LKRLTTG-SGNSSVSHNTQKLDISDISSPKK---INLPDTGEF-----------SHKPLS 75
            LKRLT+  S N+S    +  ++ S ISSP +    NLP +              ++KPL+
Sbjct: 27   LKRLTSNNSNNTSKYTESYSINKSSISSPLQKHDTNLPPSSSSSPSSNASAITTTNKPLN 86

Query: 76   KQSTLNMASLSAYTDAVGAHNRSASNASVGSPTKYSYSRRASQWSNNNSAVSGSKLSRQQ 135
            K+STLN  +LS Y D    H RS+S  S  +    S  R ++Q S + S     +LSRQ 
Sbjct: 87   KKSTLNTQNLSQYMD----HARSSSTNSASASKYSSSRRSSTQVSTSESL---RRLSRQH 139

Query: 136  TNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPAS 195
            T                N SKF+ PDG   LE PRDPKEIE LFEE++YKRN+ Q+L   
Sbjct: 140  TGQSSSASIHSQNSSYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQNLSVE 199

Query: 196  AQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKNXXXXXXXXXXXX-------------XX 242
             QREL NYD+ KKWL+V+QD+Q+E K+   +KN                           
Sbjct: 200  KQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYSPTTTTTNNNNN 259

Query: 243  XXXXXXXXXXXXXXXXXGSFTGLSRPKISTSSVNTSEQFYXXXXXXXXXXXXXQDPSHLS 302
                               +  ++ P+       TS + Y              D ++  
Sbjct: 260  NNNSNYNNTSPMASVASNEYYPMTSPQTKKP---TSHELYQLTESNASTSTLSSDKTNRP 316

Query: 303  PDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDN 362
            P+ YV KII + +S   + DLWV+LRTEQLDWV  FLE QG +A+AN+++K  Y+ +P +
Sbjct: 317  PNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANILMKQIYKTTPKD 376

Query: 363  LLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASE 422
             L  ++L+KE ++FKC K    L +G  E    +  +++   I  GL S R+ TR++A E
Sbjct: 377  HLSSKLLEKENSFFKCFKVLSMLSQGIYEF---SKHKLMTDTIARGLFSTRLGTRKMAIE 433

Query: 423  LLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDG 482
            + + + +      F  ++++LDQ  R   N H+      Q+  K P+    + P      
Sbjct: 434  IFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHM-----FQNLKKLPQYFIHLTP------ 482

Query: 483  DRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQT 542
            D  ++  + W+  +E T+DGRGKMGSLVGAS D + SGGENAI+EY   T++ +N LC  
Sbjct: 483  DSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNA 542

Query: 543  PVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGE 602
               ++QR +LR +L+N+G  RI+NK+KLLNYEKV +++  ++++  DDF+ +   ++   
Sbjct: 543  STIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNS 602

Query: 603  GVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLID 662
             V+++DPVS+  NLW  CKGT+ E+ L SL+Q+L +S+  L  +  DDPT+ +KQLKL+D
Sbjct: 603  NVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEE-VDDPTKLSKQLKLMD 661

Query: 663  ALVSNVSMASV-DMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLK 721
            +LV+NVS +S  D +S+ N AIQRLYD+MQTDE+ARRAILE+R   K+ EE++A++D L 
Sbjct: 662  SLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLH 721

Query: 722  EKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKT 781
            EKLS AE GLVGQL++++ +RD IL K+QRV  QLQ EL+E KKK +L KHEHEVELRK 
Sbjct: 722  EKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHEHEVELRKM 781

Query: 782  LTAMN---SNFEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINVESKRLG 838
            LT +N   S  +G+  +  +K  +N   L  ++   IQK LQ  L +   +  +++K+ G
Sbjct: 782  LTILNTRSSTNDGAKTI--DKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFG 839

Query: 839  LSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEP-EVS------NEDDHKAV 891
            ++++PNKRLK+LR +MEDIEN+AR+LEMTNF+++++  ++ P EV+       +   + +
Sbjct: 840  MTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHKKHKIEKI 899

Query: 892  SESEEKAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLE 951
            ++ E   Q+                Q ESN+ISKFN+E R +E+F+ +K  AL RLK+LE
Sbjct: 900  NQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELE 959

Query: 952  TDYKGFGINFDPDSPLGQAL--AGKSVSSDDKARTLDPK---EALNIVEEVSNILSGLDS 1006
            T YK FGINF+    L        K  S++++  +LDPK   + L+ ++ ++  L  L  
Sbjct: 960  TKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLNLQK 1019

Query: 1007 SKAAEKSNETPLRTATXXXXXXXXXXXKNGDKIAADSTLP----TSSFLESLSQKYGGAQ 1062
            ++   + + +   ++                 +A+ S+ P    T SFLE+LS+KYG  Q
Sbjct: 1020 TQELREESSSSYSSSESDEENDDDEIF-----VASSSSKPAGSGTRSFLETLSEKYGTGQ 1074

Query: 1063 NSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTG-AVPYLGELSGKIG 1109
             +++          N        K F++R++R+  A P+L EL+ K+ 
Sbjct: 1075 KNVA-----MTATPNSRIVTQSEKQFLDRMRRSSTAAPFLQELTEKVA 1117

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/625 (56%), Positives = 451/625 (72%), Gaps = 10/625 (1%)

Query: 1314 SRNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEK 1373
            S+ KSA  SP+LPQSPSLF++YPRP KKLKQLHWEKID  ++SIW   KAEKFADDLYEK
Sbjct: 1327 SQMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEK 1386

Query: 1374 GVLSRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKIL 1433
            GVL+ LEKAFAAREI                    +SQQFGINLHMYSSLSV ++V KIL
Sbjct: 1387 GVLADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKIL 1446

Query: 1434 RCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQR 1493
            +CDRDFL TPSV++FLSK EI EVS NLARN+APY+ DWEG+  +E+AKPPEKDP +LQR
Sbjct: 1447 KCDRDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQR 1506

Query: 1494 ADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVL 1553
            AD++YL+L VNL+ YW SRMRAL V+T+YEK+Y++L+ KL  +D+A  ++Q+S+NLRNV 
Sbjct: 1507 ADQIYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVF 1566

Query: 1554 DVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLK 1613
            +VILAVGNFMND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKIIR  YP FNDFLK
Sbjct: 1567 NVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLK 1626

Query: 1614 ELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLP 1673
            ELEPV+  VK+SIEQ+  DC++FSQS++NVERSV+IGNLSD +KFHP D+VL+K LP LP
Sbjct: 1627 ELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLP 1686

Query: 1674 EARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXX 1733
            EAR+KGDLL DE+KLT++EF++LM+ +GED+ DKFA+ SFFKKFADF+ EYK+AQ  N  
Sbjct: 1687 EARRKGDLLEDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLA 1746

Query: 1734 XXXXXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKN 1793
                          VE+Q KR ++ E K++  +     +   E  + R VMD+LLE+LKN
Sbjct: 1747 AEEEERLYEKHKKMVEEQQKRAQDKE-KHREHSALPEGNEEEETEDRRAVMDKLLEQLKN 1805

Query: 1794 AGPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNE 1853
            AGPAKSDPSS           +    +++ +L+  D+ D +G S++YSP+  + +     
Sbjct: 1806 AGPAKSDPSSARKRALVRKKYISDKDNSAQVLN--DLNDEEG-SILYSPEATTPDTDTVI 1862

Query: 1854 ADTSPTP------ERRVRDSNATSPASHDTGSSDLTDRARNLLIELRGPESPGVKMSAQH 1907
               SPTP           D  + S AS      ++TDRAR LL ELRG ++P  + S   
Sbjct: 1863 HAESPTPLATRGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILD 1922

Query: 1908 QRLSKLRARRKNDSSSSGSENRLNF 1932
            + L KLRAR++  +  + + N+L+F
Sbjct: 1923 EHLEKLRARKERANGETNTGNKLSF 1947

 Score =  583 bits (1502), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 342/853 (40%), Positives = 520/853 (60%), Gaps = 48/853 (5%)

Query: 297  DPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCY 356
            D ++  P +YV++I+ + ++   + DLWV+LRTEQLDWV  F++ QG +A+ANV++ + Y
Sbjct: 335  DRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIY 394

Query: 357  RESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVAT 416
            + +P   L  E+L+KE ++FKC +    L +G  E    ++ R++   + EGL S ++ T
Sbjct: 395  KTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEF---STHRLMTDTVAEGLFSTKLVT 451

Query: 417  RRVASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAP 476
            R++A+E+ + + +    + F  V+ ALD++ R   N+H+      Q+  K P+  S +  
Sbjct: 452  RKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHM-----IQNFKKMPQYFSHLTL 506

Query: 477  TPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLI 536
                  +  ++  + W+  VE TLDGRGKMGSLVGAS++F+  GGENAI+EY   T++ I
Sbjct: 507  ------ESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFI 560

Query: 537  NHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYS 596
            NHLC    +V QR +LR +L+N G+ RI+NK+KLL+Y+KV +Q+  +D++  DDF+    
Sbjct: 561  NHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLE 620

Query: 597  QESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTK 656
              +    VD+KDP+S+ +NLW +CKGTD E+ L SL+Q+L +S+ +L  +N+ +P++ +K
Sbjct: 621  ASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQ-NPSKLSK 679

Query: 657  QLKLIDALVSNVSMASV-DMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKA 715
            QLKL+D+LV+NVS+AS  D +S+ N AIQRLYDAMQTDE+ARRAILE+R   K+ EEI+A
Sbjct: 680  QLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQA 739

Query: 716  DRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHE 775
            +RD+L EKL  AE GLVGQL++E+  RD IL K+QRV  QL+ EL+E KKK +L KH+ E
Sbjct: 740  ERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMQQLESELEELKKKHLLEKHQQE 799

Query: 776  VELRKTLTAMNSNFEGSHNMRDEKGSENPRP-LRPERKLAIQKALQAKLEKTSKEINVES 834
            VELRK LT +NS  E S ++   KG+++  P L    K  IQK LQ  L +  K+   +S
Sbjct: 800  VELRKMLTILNSRPEESSDL--SKGTKDINPSLNSSEKANIQKVLQDGLSRAKKDYKDDS 857

Query: 835  KRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDI----KEPEVSNEDDHKA 890
            K+ G++L+PNKRLK+LR +ME+IEN+AR+LEMTNF++++K+ +    +  +   +     
Sbjct: 858  KKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIEIKKPKIKHKKHK 917

Query: 891  VSESEEKAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKL 950
            + +S  K Q                 Q ESNDISKFNVE R +E+F+ +KSLAL RLK+L
Sbjct: 918  IKKSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKEL 977

Query: 951  ETDYKGFGINFDPDSPLGQALAGKSVSSDDKAR-TLDPKEALNIVEEVSNILSGLDSSKA 1009
            ET YKGFGI+F+ +  +           +D A  +LDPK   + ++E++ I   L   + 
Sbjct: 978  ETKYKGFGIDFNVEEFIETPKKFSVDEENDAAYPSLDPKAYQSKLDEINRITDELLDLQT 1037

Query: 1010 AEKSNETPLRTATXXXXX-------------XXXXXXKNGDKIAADSTLPTSSFLESLSQ 1056
              K                                  + G+     +     SFL++LSQ
Sbjct: 1038 QVKQETEEDEDEETKSSSSSSDADDDEIYQDASPSQERRGEYSELSAGSGPGSFLDALSQ 1097

Query: 1057 KYGGAQNSLSNRHSFAGGEINYPGSGYH----RKSFMNRVKRTGA--VPYLGELSGKIGS 1110
            KYG  QN  +     + G  +  GSG+      KSF+NR++++ A   PYL EL+ K+  
Sbjct: 1098 KYGTGQNVTA-----SAGLRDNRGSGHMPSNVEKSFINRLRKSTASSAPYLEELTQKVNK 1152

Query: 1111 SSYIKPSEAEENV 1123
                K ++ E+ V
Sbjct: 1153 VEPFKQNKDEDLV 1165

 Score =  124 bits (312), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 94/160 (58%), Gaps = 20/160 (12%)

Query: 72  KPLSKQSTLNMASLSAY------TDAVGA--HNRSASNASVGSPTKYSYSRRASQWSNNN 123
           +PL+K++TLN  +LS Y      TDA  +  H RS S  S     KYSYS+R S  ++N 
Sbjct: 83  RPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQS-----KYSYSKRTSSQASN- 136

Query: 124 SAVSGSKLSRQQTNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEELFEEVL 183
                 KL+RQ T                NLSKF  PDG + LE P DP E+E LFE+++
Sbjct: 137 ------KLTRQHTGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIM 190

Query: 184 YKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKF 223
           YKRN++QSL    Q EL +Y  EKKWL+V+QDLQ+E+KK 
Sbjct: 191 YKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKI 230

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1092 (37%), Positives = 628/1092 (57%), Gaps = 77/1092 (7%)

Query: 48   QKLDISDISSPKKINLPD--TGEFSHKPLSKQSTLNMASLSAYTDAVGAHNRSASNASVG 105
            Q+++  DISSPKK+++P   T     +PL+     +     +         R+ S  S G
Sbjct: 54   QRIETGDISSPKKVSVPSRVTNANDLRPLNHHYNHHHNHHHS---------RTPSQQSTG 104

Query: 106  SPTKYSYSRR-ASQWSNNN------------SAVSGSKLSRQQTNXXXXXXXXXXXX--- 149
            S  KY+Y +R +S  +  N            + V+  +LSRQQTN               
Sbjct: 105  S--KYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRQQTNHSHANSQSSAASVLS 162

Query: 150  --XXXNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEK 207
                 NL +F+ PDG VRL+ P+D  E+E LFE+++YKRN+ Q+LP   Q+EL NYD++K
Sbjct: 163  QGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDIDK 222

Query: 208  KWLMVRQDLQSEVKKFMNSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFTGLSR 267
            KWL+VRQDL S++KK M   +                                  T +  
Sbjct: 223  KWLIVRQDLSSDLKKMMAKSSSSATQASANTTDLSLTNTISSHDYSDA-------TSIRH 275

Query: 268  PKISTSSVNTSEQFYXXXXXXXXXXXXXQDPSHLSPDYYVRKIICNDISAKRLNDLWVSL 327
             K + SS + +   Y              +  +  P YYV+KII +D++   LNDLWV+L
Sbjct: 276  MKTNASSKSLNSNLYSNANANSSNTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTL 335

Query: 328  RTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLRE 387
            RTEQLDWV  FLE QG +A+ANV++K+ Y+ + +  L ++ L++E +YFKC +  + L +
Sbjct: 336  RTEQLDWVDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQ 395

Query: 388  GADEAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNHVMDALDQES 447
            G  E        I+   +   L S+R+ TR++A+E+ + + +      F+ ++ ALD++ 
Sbjct: 396  GLYEFT---KHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKKNKSRFDVILTALDKKF 452

Query: 448  RFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMG 507
               +N+H+      Q     P++   +        D   +  + W+  +E  L GRGKMG
Sbjct: 453  MIGENLHMM-----QFVKNSPQQFIHLK------RDSQFKIVQAWLTGLETALQGRGKMG 501

Query: 508  SLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNK 567
            SLVGASE+ R +GGEN+I+EY+  T++ INHLC     V QR +LR RL+NAG  RI+N+
Sbjct: 502  SLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNR 561

Query: 568  MKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQ 627
             KLL+Y+K+  Q+  +++   DD + L   E     V+M+DP+ M Q +W+ CKGT+ E+
Sbjct: 562  FKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEK 621

Query: 628  HLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSFNSAIQRLY 687
               SL+++L +S+ ++   ++ DP++  KQLKL+D+LV+NVS+++VD +SS N AIQRLY
Sbjct: 622  TFISLIKHLFLSSSKVAD-DRGDPSKLAKQLKLMDSLVANVSVSAVDEESSVNVAIQRLY 680

Query: 688  DAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILE 747
            DAMQTDE+ARRAILE+R   K  EEI+A+RD L++KL++   G+VG+L++E++QRD IL 
Sbjct: 681  DAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILA 740

Query: 748  KSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDEKGSENPRPL 807
            K+QRVN  LQ EL+E KKK +L KHEHEVELRK LT +N+  +  +  +  K +++   L
Sbjct: 741  KNQRVNRHLQAELEELKKKHLLEKHEHEVELRKMLTILNARPDDENLAKSTKVTKSVNGL 800

Query: 808  RPERKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMT 867
             P+R+ +IQKALQ  L++T K+++V+SKR G++++PNKRL++LR +ME IE +ARELEMT
Sbjct: 801  DPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMT 860

Query: 868  NFSDYQKDDIKEPEVSNEDDHKAVSESEEKAQQIXXXXXXXXXXXXXXXQQESNDISKFN 927
            NF+++++  ++EP  +       V +  E  +Q+               Q+E+N+++KFN
Sbjct: 861  NFAEHEEKQLEEPVGTGTKKKAGVRKLSELRKQL------------SDIQKETNEVTKFN 908

Query: 928  VEGRFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLGQALAGKSVSSDDKARTLDP 987
            VE R  E+F+ ++  AL RLK+LET YKGFGI+F+ ++ L ++  G    +DD+    D 
Sbjct: 909  VEERVKELFNQKRLKALKRLKELETTYKGFGIDFNANALL-ESKGGDIHWNDDEIDGQDL 967

Query: 988  KEALNIVEEVSNILSGLDSSKA-AEKSNETPLRTATXXXXXXXXXXXKNGDKIAADSTLP 1046
            + A   ++E+  I + L + K   E  N+     ++             G +    S   
Sbjct: 968  QGAQEKMDEMDRIANELTAMKMKVEIQNQQQHTDSSSTESSSEDDDGATGSRTDTASEFS 1027

Query: 1047 -------TSSFLESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTGAVP 1099
                     SFLE+LSQKYG  QN+  +   F G +     S  HR SF NR+K++ A P
Sbjct: 1028 QKSFGSGAGSFLEALSQKYGAGQNTTISNSPFPGVDRK---SSNHRTSFANRMKKSNATP 1084

Query: 1100 YLGELSGKIGSS 1111
            Y  EL+ K+  +
Sbjct: 1085 YFDELTRKVAKA 1096

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/595 (54%), Positives = 409/595 (68%), Gaps = 24/595 (4%)

Query: 1322 SPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEK 1381
            S  L ++P+  D YP+P KKLKQLHWEK+D  EDSIW    AEKFA DLYEKGVL+ LEK
Sbjct: 1246 SNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEK 1305

Query: 1382 AFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLS 1441
            AFAAREI                     SQQFGINLHMYS +SV ++V KIL+CDRDF+ 
Sbjct: 1306 AFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQ 1365

Query: 1442 TPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLEL 1501
            TPSVI+FLSK EI EVS NLARNF+PY+ DW+G+ S+E+AKPPEKDP +LQRAD++YL+L
Sbjct: 1366 TPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQL 1425

Query: 1502 FVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGN 1561
              NLQ YW SRMRA+KVIT+Y+K+Y +LV KL  +DKA  +I +SENL N+ +VILAVGN
Sbjct: 1426 IFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGN 1485

Query: 1562 FMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAA 1621
            FMND++K+AQGF+L+TLQRLTFIKD  NSMTFLNYVEKIIR  YP FNDFLKELEPV+  
Sbjct: 1486 FMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNV 1545

Query: 1622 VKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDL 1681
             KISI+Q+  DC E+ Q+V NVERS++IGNLSD +KFHP DRVL+KVLP LPEARKK DL
Sbjct: 1546 TKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDL 1605

Query: 1682 LMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXXXXXX 1741
            L DE++L+++EF+NLM+ +GED  DKFA+NSFFKKFADF+ EYKKAQ  N          
Sbjct: 1606 LDDEVRLSIMEFENLMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQNLKVEEEERVY 1665

Query: 1742 XXXXXXVEDQLKRTRESESKNKG-TTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPAKSD 1800
                  VE+Q +R  ++ SKN+    +   D   ++  + R +MD+LL++LKNAGP  SD
Sbjct: 1666 ERHKKMVEEQQRR-EQTPSKNRDYVVNEDEDIADDDDQDRRAMMDKLLDQLKNAGPTTSD 1724

Query: 1801 PSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNEADTSPTP 1860
            PSS          L     + + ++ +    DS+  S+VYSP N S +   N  + SPT 
Sbjct: 1725 PSSARKRALMRRKLQADKDAAAHLISDL---DSNEDSIVYSP-NASQDQSANAEEASPTV 1780

Query: 1861 ERRVRDSNATSPASHDTGS----------------SDLTDRARNLLIELRGPESP 1899
             +    +N   P   D  S                 +++D+A+NLL+EL G  +P
Sbjct: 1781 HKGSNKNN--KPVLSDLESPIKASRNADRNNENEEEEISDKAKNLLMELSGNGAP 1833

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/626 (56%), Positives = 447/626 (71%), Gaps = 10/626 (1%)

Query: 1314 SRNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEK 1373
            S+ KSA  SP+LPQSPSLF++YPRP KKLKQLHWEK+D  ++SIW   KAEKFADDLYEK
Sbjct: 1329 SQVKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEK 1388

Query: 1374 GVLSRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKIL 1433
            GVL+ LEKAFAAREI                    +SQQFGINLHMYSSLSV ++V KIL
Sbjct: 1389 GVLADLEKAFAAREIKSLATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKIL 1448

Query: 1434 RCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQR 1493
             CDRDFL TPSV++FLSK EI+EVS NLARN+APY+ DWEGV ++++AKPPEKDP +LQR
Sbjct: 1449 NCDRDFLQTPSVVEFLSKPEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQR 1508

Query: 1494 ADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVL 1553
            AD++YL+L VNL++YW SRMRAL V+T+YEK+Y++L+ KL  +DKA  ++Q+S+NLRNV 
Sbjct: 1509 ADQIYLQLMVNLESYWGSRMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVF 1568

Query: 1554 DVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLK 1613
            +VILAVGNFMND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKIIR  YP FNDFLK
Sbjct: 1569 NVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLK 1628

Query: 1614 ELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLP 1673
            ELEPV+  VK+SIEQ+  DCR+FSQS++NVERSV+IGNLSD +KFHP D++L+K LP LP
Sbjct: 1629 ELEPVLDVVKVSIEQLVNDCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLP 1688

Query: 1674 EARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXX 1733
            EARKKGDLL DE+KLT++EF++LM  +GED+ DKFA+ SFFKKFADF+ EYKKAQ  N  
Sbjct: 1689 EARKKGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLA 1748

Query: 1734 XXXXXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNED-RDVMDRLLEKLK 1792
                          VE+Q KR +E E + + +  +  +    +  ED R VMD+LLE+LK
Sbjct: 1749 AEEEERIYEKHKKIVEEQQKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLK 1808

Query: 1793 NAGPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLN 1852
            NAGP KSDPSS           L    ++  +L++ D E+    S++YSP+    +    
Sbjct: 1809 NAGPGKSDPSSARKRALVRKRYLSDKDNSQQLLNDLDNEEG---SILYSPEALDPDADAV 1865

Query: 1853 EADTSPTPERR------VRDSNATSPASHDTGSSDLTDRARNLLIELRGPESPGVKMSAQ 1906
                SPTP           D  + S AS      +++DRA+ LL ELRG ++P  + S  
Sbjct: 1866 IHAESPTPLTTRGTLNIPEDLPSPSKASTLEDQEEISDRAKMLLKELRGSDTPVKQNSIL 1925

Query: 1907 HQRLSKLRARRKNDSSSSGSENRLNF 1932
             + L KLRAR++       + N+L+F
Sbjct: 1926 DEHLEKLRARKERTIGEGSAGNKLSF 1951

 Score =  587 bits (1514), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 340/844 (40%), Positives = 529/844 (62%), Gaps = 59/844 (6%)

Query: 297  DPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCY 356
            D ++  P +YV++I+ + ++   + DLWV+LRTEQLDWV  F++ QG +A+ANV++ + Y
Sbjct: 333  DRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIY 392

Query: 357  RESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVAT 416
            + +P + L  E+L+KE ++FKC +    L +G  E    ++ R++   + EGL S R+AT
Sbjct: 393  KTAPRDSLTKELLEKENSFFKCFRVLSMLSQGLYEF---STHRLMTDTVAEGLFSTRLAT 449

Query: 417  RRVASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAP 476
            R++A+E+ + + +      F  V+ ALD++ R   N+H+      Q+  K P+  S +  
Sbjct: 450  RKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHM-----IQNFKKMPQYFSHLTL 504

Query: 477  TPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLI 536
                  +  ++  + W+  VE TLDGRGKMGSLVGAS++F+  GGENAI+EY   T++ I
Sbjct: 505  ------ESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFI 558

Query: 537  NHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYS 596
            NHLC    ++ QR +LR +L+N G+ RI+NK+KLL+Y+KV +Q+  +D++  DDF+    
Sbjct: 559  NHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLDDFNVRLE 618

Query: 597  QESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTK 656
              +    VD++DP+S+ +NLW++CKGT+ E+ L SL+Q+L +S+ +L  +N++ P++ TK
Sbjct: 619  ANNKAFNVDLQDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQN-PSKLTK 677

Query: 657  QLKLIDALVSNVSMASV-DMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKA 715
            QLK++D+LV++VS+AS  D +S+ N AIQRLYDAMQTDE+ARRAILE+R   K+ EEI+A
Sbjct: 678  QLKVMDSLVTSVSIASTSDEESNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQA 737

Query: 716  DRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHE 775
            +RD+L EKLS AE GLVGQL+DE+  RD IL K+QRV  QL+ EL+E KKK +L KH+ E
Sbjct: 738  ERDSLSEKLSKAEHGLVGQLEDELHGRDRILAKNQRVMQQLEAELEELKKKHLLEKHQQE 797

Query: 776  VELRKTLTAMNSNFEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINVESK 835
            VELRK LT +NS  E + ++ +    +N   L    K  IQK LQ  L +  K+   +SK
Sbjct: 798  VELRKMLTILNSRPEENSSINEGIRGKNS-SLNSSEKANIQKVLQDGLSRAKKDYKDDSK 856

Query: 836  RLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSESE 895
            + G++L+PNKRLK+LR +ME+IEN+AR+LEMTNF++++KD ++ P    +   K +   +
Sbjct: 857  KFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLKKIKHKD 916

Query: 896  E----KAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLE 951
            +    + Q++               Q ESNDISKFNVE R +E+F+ +KSLAL RLK+LE
Sbjct: 917  KKLISRPQEVDMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELE 976

Query: 952  TDYKGFGINFDPDSPLGQALAGKSVSSDDKAR------TLDPKEALNIVEEVSNILSGLD 1005
            T YKGFGI+F+ +  +    + K  S++++        +LDP+   N ++E++ I   L 
Sbjct: 977  TKYKGFGIDFNVEEIME---SPKKNSANERKEDGANYSSLDPRTYQNKLDEINRITDQLL 1033

Query: 1006 SSKAAEKSNETPLRTATXXXXXXXXXXXKNGDKIAADSTLP----------------TSS 1049
              +A  K ++  + + +             G+ +  D+  P                + S
Sbjct: 1034 DLQAQTKQDDGGVSSLSSSSSSAE------GEDVYQDA-FPAQEVRSENSELSVESGSGS 1086

Query: 1050 FLESLSQKYGGAQN---SLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTGA--VPYLGEL 1104
            FL++LSQKYG  QN   S+  R S     I +  S    K+FMN+++++ A   PYL EL
Sbjct: 1087 FLDALSQKYGTGQNNTVSVGLRDSDYVSVIGHMPSKVE-KTFMNKLRKSTASSAPYLEEL 1145

Query: 1105 SGKI 1108
            + K+
Sbjct: 1146 TQKV 1149

 Score =  122 bits (307), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 94/157 (59%), Gaps = 14/157 (8%)

Query: 72  KPLSKQSTLNMASLSAYTDA-----VGAHNRSASNASVGSPTKYSYSRRASQWSNNNSAV 126
           +PL+K+STLN  +LS Y +      V   ++ A + S+ S  KYSYS+R       NS+ 
Sbjct: 84  RPLNKKSTLNTQNLSQYMNGKISADVPVSSQHARSHSMQS--KYSYSKR-------NSSQ 134

Query: 127 SGSKLSRQQTNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKR 186
           + +KL+RQ T                NLSKF  PDG + LE P DP E+E LFE+++YKR
Sbjct: 135 ASNKLTRQHTGQSHSVSSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKR 194

Query: 187 NVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKF 223
           N++QSL    Q  L +Y  EKKWL+V+QDLQ+E+KK 
Sbjct: 195 NIFQSLSGDKQEALMSYSTEKKWLIVKQDLQNELKKL 231

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/672 (54%), Positives = 467/672 (69%), Gaps = 29/672 (4%)

Query: 1312 SVSRNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLY 1371
            + S   S  PSP+  QS S+F++YPRP KKLKQLHWEK+D   +SIW  +KAEKFADDLY
Sbjct: 1354 ATSAKNSPIPSPLFSQS-SIFEKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLY 1412

Query: 1372 EKGVLSRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSK 1431
            EKGVLS LEKAFAARE+                    VSQQFGINLHM+ +LSVEE+V+K
Sbjct: 1413 EKGVLSNLEKAFAAREVKSLSSKKGDDSKITFLTRD-VSQQFGINLHMFGNLSVEELVTK 1471

Query: 1432 ILRCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTEL 1491
            IL+CDR+ L++PSVI+FLSKQE+VEVS NLARN++PY+ DWEGV  +E+AK PEKDP EL
Sbjct: 1472 ILKCDREVLNSPSVIEFLSKQEVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNEL 1531

Query: 1492 QRADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRN 1551
            QRAD+LY+ L VNLQ YWSSRMRALKVITTYE++Y++L+ KL  +DKA  S+QQSENL+N
Sbjct: 1532 QRADQLYMSLMVNLQPYWSSRMRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKN 1591

Query: 1552 VLDVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDF 1611
            VL+VILAVGN+MND+SKQAQGF+LATLQRLTFIKD  NSMTFLNYVEKI+R+ YP FNDF
Sbjct: 1592 VLNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDF 1651

Query: 1612 LKELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPT 1671
            L EL+PV+  VKISI+Q+  DC+EFS SV+NVERS++IGNLSD +KFHPSDRVL+KVLP 
Sbjct: 1652 LNELQPVLDVVKISIDQLVSDCQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPV 1711

Query: 1672 LPEARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYN 1731
            LPEARKK DLL DE+KLT+LEF+NLM+ +GED+ DKFA+NSFFKKFADF+ EYKKAQV N
Sbjct: 1712 LPEARKKADLLTDEVKLTMLEFNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQN 1771

Query: 1732 XXXXXXXXXXXXXXXXVEDQLKRTRESESK-NKGTTDA--GGDS--VRNEVNEDRDVMDR 1786
                            VE+Q ++  E+  +    + DA  G D+  V +E  + R +MD+
Sbjct: 1772 VAAEEEEQQYERHKKIVEEQQRQGEEARKRLESASPDATNGEDTTAVDDETKDRRAIMDK 1831

Query: 1787 LLEKLKNAGPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNS 1846
            LLE+LKNAG  K+DPSS          LL    + S +L + D +D    SLVYSPD   
Sbjct: 1832 LLEQLKNAGTVKADPSSARKRALARRKLLGDKDAASALLHDIDTDDD---SLVYSPDTKR 1888

Query: 1847 SEVQLNEADTSPTPERRVRDSNATSPASHDTGSS---DLTDRARNLLIELRGPESPGVKM 1903
              V  +    SPTP  ++  S  T   S  T      D+TDRA+ LL+ELRG +S  +K 
Sbjct: 1889 QSVG-HLIGGSPTPGDKLLGSTPTKELSSPTAGQDDEDVTDRAKALLMELRGGQSSPMKK 1947

Query: 1904 SAQHQRLSKLRARRKNDSSSSGSE-----NRLNFVGAGQAENSDEQNEPEVLKSKPESAN 1958
            +A      +    R+  +  +G+E     N+L+F  A          E E  ++  ++ N
Sbjct: 1948 NAFLDEQRERIRSRRRRNELAGTEPLRGGNKLSFFEA----------ETETSETAHDADN 1997

Query: 1959 DDDNGEQSDSSD 1970
            D   G+ +D+SD
Sbjct: 1998 DTTKGQTADASD 2009

 Score =  580 bits (1496), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 338/843 (40%), Positives = 509/843 (60%), Gaps = 64/843 (7%)

Query: 297  DPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCY 356
            D ++  P +YV+KII + +S   LNDLWV+LRTEQLDWV  FL+ QG +A+ANV++K+ Y
Sbjct: 412  DKTNRLPIHYVKKIIADQLSQDELNDLWVTLRTEQLDWVDAFLDNQGHIAMANVLMKSLY 471

Query: 357  RESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVAT 416
            + SP+  L   +LDKE +YFKC K    L +G  E       R+I   I  GL S R+ T
Sbjct: 472  KTSPNVSLSGPLLDKEQSYFKCFKVLSMLAQGLREFT---DHRLITDTIARGLFSSRLPT 528

Query: 417  RRVASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAP 476
            R++A+E+ + + +      F+ V+ +LDQ  +   N H+   L      K P     +  
Sbjct: 529  RKMATEIFVCMLETKNQTRFDAVITSLDQNFQIGSNAHMVNNL-----QKMPDYFIHL-- 581

Query: 477  TPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLI 536
                +    ++  + W+  ++ TLDGRGKMGSLVGAS++F+   GEN+++EY   TL+ +
Sbjct: 582  ----NLQSTLKVVQAWLFAIDQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQWTLVFV 637

Query: 537  NHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYS 596
            N  CQ+  ++ QR +LR +L+NAG  RI+NKMKLL+YEK+ +Q+  ++    DDF++L  
Sbjct: 638  NKFCQSSNNLNQRMLLRTKLENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDDFNSLLE 697

Query: 597  QESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTK 656
             ++    +DM++P+S+ QNLW+ C+GTD+E  L SL+Q+L +S+  L   NKD PTQ  K
Sbjct: 698  SQNKHANIDMQNPLSLLQNLWDACRGTDSENLLVSLVQHLFLSSTRLIQNNKD-PTQLAK 756

Query: 657  QLKLIDALVSNV--SMASV-DMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEI 713
            QLKLID+LV+NV  S+++V D +++ +  IQRL+D+MQTDE+ARRAI+E+R   K+ EE+
Sbjct: 757  QLKLIDSLVTNVGSSVSAVADEETTMSMTIQRLFDSMQTDEVARRAIIESRTLTKKMEEL 816

Query: 714  KADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHE 773
            +A++D L +KLS AEGGLVG+LQ ++R+RD IL K+QRVN QL++EL+E K+K ++ KHE
Sbjct: 817  QAEKDRLGDKLSKAEGGLVGELQRDIRERDAILAKNQRVNKQLENELEELKRKTLMEKHE 876

Query: 774  HEVELRKTLTAMNSNFEGSHNMRDEKGS--------ENPRPLRPERKLAIQKALQAKLEK 825
            HEVELRK LT +NS  + S N+     +        +N   L  E++  IQK LQ  L +
Sbjct: 877  HEVELRKMLTIINS--KASPNLAQNPSASVLKSHDPKNKESLLSEQQSKIQKVLQDGLTR 934

Query: 826  TSKEINVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKD---------- 875
            T K+   ++K+ G++++PNKRL+LLR ++EDIEN+AR+LEMTNF+D +K+          
Sbjct: 935  TKKDFTNDAKKFGMTVQPNKRLQLLRMKVEDIENEARQLEMTNFADIEKNATPVILTKGT 994

Query: 876  ---DIKEPEVSNEDDHKAVSESEEKAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRF 932
                 K+   + + D K  +    + Q+I               Q ESNDISKFNVE   
Sbjct: 995  KKKKSKKKLKTAQPDKKQRANQRNENQKIEALNKLRMALTAI--QSESNDISKFNVEEHV 1052

Query: 933  HEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLGQALAGKSVSSDDKARTLDPKEA-- 990
            +E+F+ +K  AL RL+ LE+ + G   NF+ D  +  A   K++++ D   +LDP+ A  
Sbjct: 1053 NELFTERKFKALQRLRDLESKFNGLNTNFNIDDII--ASTEKALTATDDGYSLDPRRADN 1110

Query: 991  -LNIVEEVSNILSGLDSSKAAEKSNETPLRTATXXXXXXXXXXXKNGDKIAADSTLPT-- 1047
             L+ +E ++N LS L  S   ++        ++             G  + +D + PT  
Sbjct: 1111 KLDEIERLTNDLSKLHDSMKEQEQATLQSDNSSESSDSESVESDNEGSTVQSDVSEPTVG 1170

Query: 1048 -SSFLESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTGAVP-YLGELS 1105
              SFL SLSQKY   Q            + N P +  ++K+FM R+KR+   P YL ELS
Sbjct: 1171 SGSFLASLSQKYETGQK-----------QPNSPVT-VNQKAFMTRLKRSSGAPLYLQELS 1218

Query: 1106 GKI 1108
             KI
Sbjct: 1219 KKI 1221

 Score =  112 bits (281), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 96/160 (60%), Gaps = 10/160 (6%)

Query: 72  KPLSKQSTLNMASLSAYTDAVGAHNRSASNASVGSPTKYSYSR-------RASQWSNNNS 124
           KPLSK++T+N  +LS YT  V A + S  +  + SP +Y++SR       R S  S +  
Sbjct: 152 KPLSKKATMNSQNLSHYTSGVSATS-SDGDGGMASP-EYTHSRTQSGQTSRFSYTSPSRR 209

Query: 125 AVSGSKLSRQQTNXXXXXXXXXXXXXXXNLSKFVGP-DGAVRLERPRDPKEIEELFEEVL 183
           + S +KL++  T                  ++F+ P DG +RLE P DP E+E L+E+++
Sbjct: 210 SSSDAKLAKYHTAQSSQNSIASQGSLSTLYNRFISPEDGKLRLEMPDDPAEVELLYEDIM 269

Query: 184 YKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKF 223
           YKRN+ Q+LP   Q EL NYD++KKWL+V+QDLQ+E KK 
Sbjct: 270 YKRNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKL 309

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/628 (56%), Positives = 453/628 (72%), Gaps = 14/628 (2%)

Query: 1314 SRNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEK 1373
            S+ KSA  SP+LPQSPSLF++YPRP KKLKQLHWEK+D  ++SIW   KAEKFADDLYEK
Sbjct: 1323 SQMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEK 1382

Query: 1374 GVLSRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKIL 1433
            GVL+ LEKAFAAREI                    +SQQFGINLHMYSSLSV ++V K+L
Sbjct: 1383 GVLADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVL 1442

Query: 1434 RCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQR 1493
             CDRDFL TPSV++FLSK EI+EVS NLARN+APY+ DWEGV ++++AKPPEKDP +LQR
Sbjct: 1443 NCDRDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQR 1502

Query: 1494 ADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVL 1553
            AD++YL+L +NL++YW SRMRAL V+T+YE++Y++L+ KL  +DKA  ++Q S+NLRNV 
Sbjct: 1503 ADQVYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVF 1562

Query: 1554 DVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLK 1613
            +VILAVGNFMND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKIIR  YP FNDFLK
Sbjct: 1563 NVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLK 1622

Query: 1614 ELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLP 1673
            ELEPV+  VK+SIEQ+  DC++FSQS++NVERSV+IGNLSD +KFHP D+VL+K LP LP
Sbjct: 1623 ELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLP 1682

Query: 1674 EARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXX 1733
            EAR+KGDLL DE+KLT++EF++LM+ +GED+ DKFA+ SFFKKFADF+ EYKKAQ  N  
Sbjct: 1683 EARRKGDLLKDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLA 1742

Query: 1734 XXXXXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNED-RDVMDRLLEKLK 1792
                          VE+Q K+ +E E + + +     +    +  ED RDVMD+LLE+LK
Sbjct: 1743 GEEEERLYEKHKKLVEEQQKKAQEKEKQKERSASPSPEGNEEDEAEDRRDVMDKLLEQLK 1802

Query: 1793 NAGPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLN 1852
            NAGPAK+DPSS           L    S   +L++ D E+    S++YSP+  + +    
Sbjct: 1803 NAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEG---SILYSPEATTPDTYTA 1859

Query: 1853 EADTSPTP--ERRVRD------SNATSPASHDTGSSDLTDRARNLLIELRGPESPGVKMS 1904
                SPTP   R + +      S + +PA  D    +++DRAR LL ELRG E    + S
Sbjct: 1860 VHAESPTPLATRGLMNTPEDLPSPSKAPALED--QEEISDRARMLLKELRGSEISVKQNS 1917

Query: 1905 AQHQRLSKLRARRKNDSSSSGSENRLNF 1932
               + L KLRAR++  SS + + N+L+F
Sbjct: 1918 TLDEHLEKLRARKERASSETNTGNKLSF 1945

 Score =  598 bits (1541), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 348/856 (40%), Positives = 538/856 (62%), Gaps = 48/856 (5%)

Query: 297  DPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCY 356
            D ++  P +YV++I+ + ++   + DLWV+LRTEQLDWV  F+E QG +A+ANV++ + Y
Sbjct: 331  DRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMNSMY 390

Query: 357  RESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVAT 416
            + +P + L  E+L+KE ++FKC +    L +G  E    ++ R++   + EGL S ++AT
Sbjct: 391  KTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEF---STHRLMTDTVAEGLFSTKLAT 447

Query: 417  RRVASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAP 476
            +++A+E+ + + +      F  V+ ALD++ R   N+H+      Q+  K P+  S +  
Sbjct: 448  KKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHM-----IQNFKKMPQYFSHLTL 502

Query: 477  TPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLI 536
                  +  ++  + W+  VE TLDGRGKMGSLVGAS+DF+  GGENAI+EY   T++ I
Sbjct: 503  ------ESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFI 556

Query: 537  NHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYS 596
            NHLC    ++ QR +LR +L+N G+ RI+NK+KLL+Y+KV +Q+  +D++  DDF+    
Sbjct: 557  NHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLE 616

Query: 597  QESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTK 656
              +    VD++DP+S+ +NLW +CKGT+ E+ L SL+Q+L +S+ +L  +N++  ++ TK
Sbjct: 617  ANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNS-SKLTK 675

Query: 657  QLKLIDALVSNVSMASV-DMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKA 715
            QLKL+D+LV+NVS+AS  D +S+ N AIQRLYDAMQTDE+ARRAILE+R   K+ EEI+A
Sbjct: 676  QLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQA 735

Query: 716  DRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHE 775
            +RD+L EKLS AE GLVGQL+DE+ +RDHIL K+QRV  QL+ EL+E KKK +L KH+ E
Sbjct: 736  ERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMQQLESELEELKKKHLLEKHQQE 795

Query: 776  VELRKTLTAMNSNFEGSHNMRDEKGSENPRP-LRPERKLAIQKALQAKLEKTSKEINVES 834
            VELRK LT +NS  E S ++ +  G+ N  P L    K  IQK LQ  L +  K+   +S
Sbjct: 796  VELRKMLTILNSRPEESSDINE--GTRNIDPSLNFSEKANIQKVLQDGLSRAKKDYKDDS 853

Query: 835  KRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEP-EVSNEDDHKAVSE 893
            K+ G++L+PNKRLK+LR +ME+IEN+AR+LEMTNF++++K+ ++ P ++      K   +
Sbjct: 854  KKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIKKPKLKKNKHK 913

Query: 894  SEE---KAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKL 950
             +    +AQ+                Q ESN+ISKFNVE R +E+F+ +KSLAL RLK+L
Sbjct: 914  DKNFLARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKEL 973

Query: 951  ETDYKGFGINFDPD----SPLGQALAGKSVSSDDKARTLDPKEALNIVEEVSNILSGL-- 1004
            ET YKGFGI+F+ +    SP   ++A +    D +  +LDPK     ++E++ I   L  
Sbjct: 974  ETKYKGFGIDFNVEKIMESPKKLSVADER-EGDARYSSLDPKAYQKKLDEINRITDELLD 1032

Query: 1005 ------DSSKAAEKSNETPLRTATXXXXXXXXXXXKNGDKIAADSTLPTS-----SFLES 1053
                    +K  E    +   +++               +I ++++  ++     SFL++
Sbjct: 1033 LQTQTKQETKEEENGKSSFSSSSSDADDDEVYQDASPTHEIRSENSELSAGSGPGSFLDA 1092

Query: 1054 LSQKYGGAQNSLSNRHSFAGGEINYPGSGYHR--KSFMNRVKRT--GAVPYLGELSGKIG 1109
            LSQKYG  QN  ++      G ++  G    +  K+FMNR+KR+   + PYL EL+ K+ 
Sbjct: 1093 LSQKYGTGQNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVN 1152

Query: 1110 SSSYIKPSEAEENVGI 1125
                ++P E  E+V I
Sbjct: 1153 K---VEPCEQNEHVNI 1165

 Score =  122 bits (307), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 70/163 (42%), Positives = 93/163 (57%), Gaps = 14/163 (8%)

Query: 66  TGEFSHKPLSKQSTLNMASLSAYTDA-----VGAHNRSASNASVGSPTKYSYSRRASQWS 120
           T     +PL+K+STLN  +LS Y        V   ++ A + SV S  KYSYS+R     
Sbjct: 76  TTSIEARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQS--KYSYSKR----- 128

Query: 121 NNNSAVSGSKLSRQQTNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEELFE 180
             NS+ + +KL+RQ T                NLSKF  PDG + LE P DP E+E LFE
Sbjct: 129 --NSSQASNKLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEILFE 186

Query: 181 EVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKF 223
           +++YKRN++QSL    Q  L  Y  EKKWL+V+QDLQ+E+KK 
Sbjct: 187 DIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKM 229

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/618 (56%), Positives = 439/618 (71%), Gaps = 20/618 (3%)

Query: 1317 KSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVL 1376
            ++A PSP+LPQSPSLF  YPR  KKLKQLHWEK+D  ++SIW   KAEKFA DLYEKGVL
Sbjct: 1236 RTAVPSPLLPQSPSLFSSYPRARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVL 1295

Query: 1377 SRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCD 1436
              LEKAFAAREI                    VSQQFGINLHMYS LSVEE+V+KIL+C+
Sbjct: 1296 EDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCE 1355

Query: 1437 RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADR 1496
            RDF+ TPSV++FLSK EI+EVS NLARN++PY+ DW+GVS VE+AK PEKDP ELQRAD+
Sbjct: 1356 RDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQ 1415

Query: 1497 LYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556
            LYL+L  NLQ YW SRMRAL+VIT+YE++YS+LV KL  +DKA   IQ+S NLRNV +VI
Sbjct: 1416 LYLQLIYNLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVI 1475

Query: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616
            LAVGN+MNDS+KQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKI+R+ YP FNDFL++L+
Sbjct: 1476 LAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQ 1535

Query: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676
            PV+  VKISIEQ+  DC+EFSQS+ NVERS+DIGNL+D +KFHP D+VL+KVLP LPEA 
Sbjct: 1536 PVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHPLDKVLVKVLPVLPEAS 1595

Query: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXX 1736
            K+ +LL +E+KL+++EF++LM+ +GED+ DKFA+NSFFKKFADF+ EYK+AQ  N     
Sbjct: 1596 KRVELLDEEVKLSIMEFESLMQRYGEDSADKFAKNSFFKKFADFINEYKRAQAQNLKAEE 1655

Query: 1737 XXXXXXXXXXXVEDQLKRTRESE-SKNKGTTDAGGDSVRNEVNED-RDVMDRLLEKLKNA 1794
                       VE+Q KR  E E S+N    DA      +E NED R +MD+LLE+LKNA
Sbjct: 1656 EERLYQTHKKMVEEQQKRAEEKERSENATEEDA------SEENEDRRAMMDKLLEQLKNA 1709

Query: 1795 GPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNEA 1854
            GP K+DP S          +L  S + S +LD+   ED    S++YSP+         E 
Sbjct: 1710 GPVKADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQEDD---SMIYSPEK-------QEG 1759

Query: 1855 DTSPTPERRVRDSNATSPASHDTGSSDLTDRARNLLIELRGPESPGVKMSAQHQRLSKLR 1914
             T+PT +     S +   A++     ++TDRA+ LL+ LRG ESP  + +  +    KLR
Sbjct: 1760 ITNPTGDS--SQSPSKGAANNQQDEEEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLR 1817

Query: 1915 ARRKNDSSSSGSENRLNF 1932
            ARR+  ++    E    F
Sbjct: 1818 ARRRKTNTDMSPEGSFLF 1835

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/831 (42%), Positives = 513/831 (61%), Gaps = 36/831 (4%)

Query: 303  PDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDN 362
            P +YV++II + ++   +NDLWV+LRTEQLDWV GFLE QG +A+ANV+  + Y+  P+ 
Sbjct: 307  PIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTDPET 366

Query: 363  LLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASE 422
             L  ++L+KE A+F+C +    L +G  E    N   I+   +  GL S+R+ATR++A+E
Sbjct: 367  PLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHN---IMAETVANGLFSVRLATRKMATE 423

Query: 423  LLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDG 482
            + + + +      F  V++ALD++ +  +N+H+   +        P+  S          
Sbjct: 424  IFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYM-----KNSPQHFSHFT------R 472

Query: 483  DRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQT 542
            D   +  + W+  VE +L+GRGKMGSLVGASEDF+ SGGENAI+EY+  T++ INH C  
Sbjct: 473  DSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNG 532

Query: 543  PVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGE 602
               + QR +LR RL+NAG  RI+N+ KLL+Y+KV E +  +++   DD +++    +   
Sbjct: 533  TDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHAS 592

Query: 603  GVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLID 662
             +DM D  S+ + L++ CKGT++E+ L SL+++L +ST  L   N+D PT+ +KQL+L+D
Sbjct: 593  DIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQD-PTKLSKQLRLMD 651

Query: 663  ALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKE 722
            +LV+NVS+++VD  SS N AIQRLYD+MQTDE+ARRAILE+R   K+ EE +A+RD L +
Sbjct: 652  SLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQ 711

Query: 723  KLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTL 782
            KLS    GLVGQL+ EV+QRD ILEK+QRV  QLQ EL+E KKK +L KHEHEVELRK L
Sbjct: 712  KLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDELEELKKKHLLEKHEHEVELRKML 771

Query: 783  TAMNSNFEGSHNMRDEKGSE-NPRPLRPERKLAIQKALQAKLEKTSKEINVESKRLGLSL 841
            T +NS  EG  + +    S+  P  L P++K  IQ+ALQ  L KT K+++V+SKR G+++
Sbjct: 772  TILNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITV 831

Query: 842  EPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSESEEKAQQI 901
            +PNKRLK+LR +MEDIE +ARELEMTNF+D+ K  ++ P V  E  +    E+E +A+++
Sbjct: 832  QPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAP-VKVESSNYVRKENELRAKEL 890

Query: 902  XXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKGFGINF 961
                           Q+ESN +SKFNVE R +E+F  +K  ALDRL  LE  YK +GI+ 
Sbjct: 891  KANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDL 950

Query: 962  DPDSPLGQALAGKSVSSDDKAR---TLDPKEALNIVEEVSNILSGLDSSKA------AEK 1012
                P+ Q    +S  S+  A    TLDP+     ++E+  I   L   K+      A +
Sbjct: 951  STHFPI-QDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKSELKNDKALR 1009

Query: 1013 SNETPLRTATXXXXXXXXXXXKNGDKIAADSTLPTSSFLESLSQKYGGAQNSLSNRHSFA 1072
             +E+P +  T            N D  ++     TSSFLESLSQKYG  +N+    +   
Sbjct: 1010 RHESPSKQDTDDDEIQDTGSMVNEDLQSSG----TSSFLESLSQKYGTGKNAT---NMLT 1062

Query: 1073 GGEINYPG-SGYHRKSFMNRVKRTGAVP-YLGELSGKIGSSSYIKPSEAEE 1121
               +N     G+ R+SFM R+K+   VP YL EL  K+  +  +  +E E+
Sbjct: 1063 NDILNSSERKGHSRQSFMERMKKPSGVPAYLEELPLKVPKAPPLGVAETED 1113

 Score =  125 bits (313), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 115/182 (63%), Gaps = 9/182 (4%)

Query: 49  KLDISDISSPKKINLPDTGEFSH--KPLSKQSTLNMASLSAYTDAVGAHNRSASN----A 102
           +++ SDISSP+K+++P     ++  +PL+K+ST+N  +LS Y +   +    +SN     
Sbjct: 45  RIETSDISSPRKVSVPSRVSNANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSP 104

Query: 103 SVGSPTKYSYSRRASQWSNNNSAVSGSKLSRQQTNXXXXXXXXXXXXXXXNLSKFVGPDG 162
           SV S TKY+YSRR+S  S+ ++    S L+R+ TN               NL+ F+ PDG
Sbjct: 105 SVQSSTKYTYSRRSS--SHLSTPGVNSTLTREPTNQSLSSSSVLSQDSFSNLAIFMTPDG 162

Query: 163 AVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKK 222
            ++L+ P    E+E LFE+++YKRN+ Q+L    Q+EL +YD++KKWL+V+QDLQ++ KK
Sbjct: 163 KIKLDMP-SSHEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKK 221

Query: 223 FM 224
            +
Sbjct: 222 LL 223

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1123 (38%), Positives = 638/1123 (56%), Gaps = 85/1123 (7%)

Query: 31   LKRLTTGS-GNSSVSHNTQKLDISDIS--SPKKINLPDTGEFSH------KPLSKQSTLN 81
            L+RLTT    N + S     LD  +IS  S K IN+       H      +PL+K+STLN
Sbjct: 25   LRRLTTKDRDNRNKSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKKSTLN 84

Query: 82   MASLSAYTDAVGAHN-RSASNA----SVGSPTKYSYSRRAS-QWSNNNSAVSGSKLSRQQ 135
              +LS Y +   A +  S SN     S  S  KYSYSRR+S Q S   S++    L+R  
Sbjct: 85   SQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNINLTRHN 144

Query: 136  TNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPAS 195
            TN               NLS+F+ PDG + L  P DP E+E LFE+++YKRN+ QSLP  
Sbjct: 145  TNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQSLPQE 204

Query: 196  AQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKNXXXXXXXXX--------------XXXX 241
             Q EL +Y +EKKWL+V+QDLQ+E K+   S                             
Sbjct: 205  KQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSMPDLGSDPSNSVSPPGPIS 264

Query: 242  XXXXXXXXXXXXXXXXXXGSFTGLSRPKISTSSVNTSEQFYXXXXXXXXXXXXXQDPSHL 301
                               S +G     IS     TS + Y              D ++ 
Sbjct: 265  SSGSSIFSSDVTSTAPSTYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQSDKANR 324

Query: 302  SPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPD 361
             P +YV+KI+ + +S   + DLWV+LRTEQLDWV  FLE QG +A+AN+++K+ Y+ +P 
Sbjct: 325  PPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYKTTPK 384

Query: 362  NLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVAS 421
            + + + +LDKE A+FKC +    L +G  E  + +   ++   I +GL S R+ATR++A+
Sbjct: 385  DKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHS---LMTDTIAQGLFSGRLATRKMAT 441

Query: 422  ELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGD 481
            E+ + L +      F  V+ +LD+      N H+      +S  K P+  + +    +  
Sbjct: 442  EIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHM-----NESYKKLPQYFTHLTSNSN-- 494

Query: 482  GDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQ 541
                ++  + W+  VE TLDGRGKMGSLVGASED++ +GGENAI+EY   T++ INHLC 
Sbjct: 495  ----LKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCS 550

Query: 542  TPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTG 601
            +  ++ QRT+LR +L+N G+ RI+NK+KLL+YEKV +Q+  ++++  DDF+AL       
Sbjct: 551  SSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKN 610

Query: 602  EGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLI 661
              VD++DPVS+ +NL + CKGT+ E+ L SL+Q++ + T +L  + K DP + TKQLKL+
Sbjct: 611  INVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDE-KQDPNKVTKQLKLM 669

Query: 662  DALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLK 721
            D+LV+NVS+ S +  S+ N AIQRLYD+MQTDE+ARRAILE+R   K+ EE++A+RD L 
Sbjct: 670  DSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLV 729

Query: 722  EKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKT 781
            EKLS AE GLVGQL+ EV++RD IL K+QRV  QL+ EL+E KKK +L KHE EVELRK 
Sbjct: 730  EKLSKAEHGLVGQLEMEVKERDRILAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKM 789

Query: 782  LTAMNSNFEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINVESKRLGLSL 841
            LT +NS    +   + + GS     +    K  +Q+ALQ+ L+K  K+   +SK+ G+++
Sbjct: 790  LTILNSRPAKTKEQKKKIGS-----IEASEKEDLQRALQSGLQKAKKDFKDDSKKFGMTI 844

Query: 842  EPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSE--SEEKAQ 899
            +PN+RLK+LR +ME IEN+AR+LEMTNF++Y+K  +K P  + +   K +SE   E++ Q
Sbjct: 845  QPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLK-PPANVQKKSKPISELNKEQRIQ 903

Query: 900  QIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKGFGI 959
            ++               Q ESND+SKFNV+ R +E+F+ +K  AL RLK+LET YKGFGI
Sbjct: 904  KL-----NELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGI 958

Query: 960  NFDPDSPLGQALAGKSVSSDDKARTLDPKEALNIVEEVSNILSGLDSSKAAEKSNETPLR 1019
            +F  +    ++    + SS++   +LDPK   + ++E++ I   L   K   ++ +T   
Sbjct: 959  DFKVEDFTHES----TDSSNEGYSSLDPKVYQDKLDEITKISEELLQQKNELETTQTSSS 1014

Query: 1020 TATXXXXXXXXXXXK------NGDKIAADST----LPTSSFLESLSQKYGGAQNSLSNRH 1069
             +                   N   I   S+    L + SFL++L+QKYG  Q       
Sbjct: 1015 ESNSDSESSSDSDDSMEDALTNNKDINGTSSNVSDLASGSFLDTLTQKYGTGQ------- 1067

Query: 1070 SFAGGEINYPGSGY---HRKSFMNRVKRTGAVP-YLGELSGKI 1108
                  I  P   Y   + KSF++R+KR   VP Y+ ELS K+
Sbjct: 1068 ---AEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYVEELSKKM 1107

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/626 (54%), Positives = 441/626 (70%), Gaps = 13/626 (2%)

Query: 1317 KSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVL 1376
            K    SP+LPQSPSLF+ YPRP KKLKQLHWEK++  ++SIW   KAEKFADDLYEKGVL
Sbjct: 1240 KKVVSSPLLPQSPSLFENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVL 1299

Query: 1377 SRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCD 1436
            S LEKAFAAREI                    +SQQFGINLHMYS+L+V + V K+L+C+
Sbjct: 1300 SELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCE 1359

Query: 1437 RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADR 1496
            RDF++TPSVI+FLSKQEIVEVS NLARN+APY+ DWEG+  +E+AK PEKDP ELQRAD+
Sbjct: 1360 RDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQ 1419

Query: 1497 LYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556
            +YL+L VNLQ+YW+SRMRA+++IT+YE++Y++L+ KL  +DKA  S+Q S+NL+N+ +VI
Sbjct: 1420 IYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVI 1479

Query: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616
            LAVGNFMNDS+KQA+GF+L+TLQRLTFIKD  NSMTFLNYVEKI+R  YPEFN+FL ELE
Sbjct: 1480 LAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELE 1539

Query: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676
            PV+  VK+SIEQ+  DC +F Q + NVERS++IGNLSD +KFHP D+VLLKVLP L EAR
Sbjct: 1540 PVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEAR 1599

Query: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXX 1736
            KKG+LL DEMKLT++EF+ +M+ +GED  DKFA+ SFF+KFADF+ EYKKAQ  N     
Sbjct: 1600 KKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEE 1659

Query: 1737 XXXXXXXXXXXVEDQLKRTRESESK-NKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAG 1795
                       VE+Q ++ +E  SK N+ ++  G      E  + R VMD+LLE+LKNAG
Sbjct: 1660 EEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNSDEEEESEDRRAVMDKLLEQLKNAG 1719

Query: 1796 PAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNEAD 1855
              K+DP+S          +     S S+ L    +    G SL+YSPD    +++L    
Sbjct: 1720 QVKTDPTSARKRALLRKKIHSSEESESSPLAEMQV---GGDSLIYSPD-AKEQIELEIHM 1775

Query: 1856 TSPTPERRV-------RDSNATSPASHDTGSSDLTDRARNLLIELRGPESPGVKMSAQHQ 1908
             SPTP+ +         +SN  SP        ++ DRA+ LL+ELRG ++   + +A  +
Sbjct: 1776 ASPTPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDE 1835

Query: 1909 RLSKLRARRK-NDSSSSGSENRLNFV 1933
               +LRARRK  DS+   S NRL FV
Sbjct: 1836 HKERLRARRKRTDSNKIPSSNRLKFV 1861

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/669 (52%), Positives = 462/669 (69%), Gaps = 31/669 (4%)

Query: 1322 SPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEK 1381
            +P    SP+ F++YPR  KKLKQLHWEK+DD ++SIW + KAE+FADDL+EKGVL RLE 
Sbjct: 1426 APDFSTSPNFFEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLES 1485

Query: 1382 AFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLS 1441
            AFAAREI                    +SQQFGINLHM+S+L+V++++ KI+RCDR  L+
Sbjct: 1486 AFAAREIKSLASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSILN 1545

Query: 1442 TPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLEL 1501
            TPSVIDFLSKQEIVEVS NLAR++APY+ DWEGV  V++AKPPEKDP ELQRAD++YL+L
Sbjct: 1546 TPSVIDFLSKQEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQIYLQL 1605

Query: 1502 FVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGN 1561
             VNLQ+YW SRM ALKV+T+YEKD+ +L+ KL  +D A  SIQ+SENL+NV +VILAVGN
Sbjct: 1606 MVNLQSYWGSRMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVGN 1665

Query: 1562 FMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAA 1621
            FMND+SKQAQGF+LATLQRLTFIKD  N+MTFLNYVE IIR+ YPEFNDFL EL+PV+  
Sbjct: 1666 FMNDASKQAQGFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLDV 1725

Query: 1622 VKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDL 1681
            VK+SIEQ+ +DC+EFSQ +INV RSV+IG LSD +KFHP D+VL+KVLP LPEA KK DL
Sbjct: 1726 VKVSIEQLVRDCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKADL 1785

Query: 1682 LMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXXXXXX 1741
            L DE+KL+++EF+NLM++FGED+ DKFA+NSFFKKFADF+ EYK+AQ  N          
Sbjct: 1786 LSDEVKLSIMEFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERIY 1845

Query: 1742 XXXXXXVEDQLKRTRESESKNKGTTDAGGD-SVRNEVNEDRDVMDRLLEKLKNAGPAKSD 1800
                  +E+Q KR  +S+ K+     +  D +   E  + RDVMD+LLE+LKN GP K+D
Sbjct: 1846 ENHKKRIEEQQKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQLKNVGPVKTD 1905

Query: 1801 PSSXXXXXXXXXXLLQGSSSNSTILDNFDI-EDSDGKSLVYSPDNN--SSEVQLNEADTS 1857
            P+S          L     + S IL  F+  ED    S+VYSP ++  + +   NE   S
Sbjct: 1906 PTSARKRAMVRKKLQNEKETASQILKEFETGED----SIVYSPTDSKITPKKVSNEYLQS 1961

Query: 1858 PTPERR-----------------VRDSNATSPASHDTGSSDLTDRARNLLIELRGPESPG 1900
            PTP  +                   D   T+ +S+D    ++ DRA++LL ELRG ++P 
Sbjct: 1962 PTPGEKSSLADMTSTPNPTTITTTTDGKVTNDSSNDDLDQEIVDRAKSLLFELRGSQTPT 2021

Query: 1901 VKMSAQHQRLSKLRARRKNDSSSSGSENRLNFVGAGQAENSDEQNEPEVLKSKPESANDD 1960
             K S   +R  KLRARR+N  +S  + N+L FV + +  +  E + P++L    + +N +
Sbjct: 2022 RKNSVLEERKEKLRARRRN--TSDLTSNKLKFVSSDKTVDG-EPDSPDLLT---QESNPN 2075

Query: 1961 DNGEQSDSS 1969
            D  E+ + S
Sbjct: 2076 DKIEEENPS 2084

 Score =  554 bits (1427), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 337/874 (38%), Positives = 514/874 (58%), Gaps = 84/874 (9%)

Query: 303  PDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYR-ESPD 361
            P+ Y+++I+ + +S   +NDLWV+LRTEQL WV  FLE QG +A+AN ++K+ YR  +  
Sbjct: 422  PNDYIKEILNDRLSVDEMNDLWVTLRTEQLTWVNTFLEDQGHIAMANSLMKSIYRINTMQ 481

Query: 362  NLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVAS 421
            N L   ++DKE+ +FKC +    L +G  E +     +++   +V+GL S R+ATR++A+
Sbjct: 482  NSLSTYLIDKEYNFFKCFRVLSMLSQGLTEFI---KHKLMTDTLVQGLFSTRLATRKIAT 538

Query: 422  ELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGD 481
            E+ + + Q     G N ++   D+     +N+++   L        P K   +  T    
Sbjct: 539  EIFVLMLQKINDDGLNILLTTFDKTFSINENLNMVYLL-----KNVPDKYHYLNST---- 589

Query: 482  GDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQ 541
                ++    W+  VE TLDGRGKMGSLVGAS+DF+ +GGENAI+EY   T++LIN LC 
Sbjct: 590  NTTQIKVLVSWLYAVESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLINRLCN 649

Query: 542  TPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTG 601
                + QR +LR +L+N G  RI+NK+K L+YEK+ EQL  +++   DD + L  Q+ T 
Sbjct: 650  ASTIINQRVLLRTKLENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLEQD-TK 708

Query: 602  EGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLI 661
              VD+ +P+S+  +L  +CK T+ EQ LTS++Q+L +S+ +L   +KDDPT+ +KQLKL+
Sbjct: 709  SSVDLDNPISLLSHLLEVCKDTEGEQSLTSIIQHLYLSSSKLFD-DKDDPTKLSKQLKLM 767

Query: 662  DALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLK 721
            D+L+++ ++++VD +S  N AIQ LYD+M TD++ARRAILE+R+  K+ EE++A+RD L 
Sbjct: 768  DSLMTDATLSTVDNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAERDFLS 827

Query: 722  EKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKT 781
             +LS AE GLVG+L++E+ QRD IL K+QRV  QL+ ELDE KKK ++ KH+HEVELRK 
Sbjct: 828  NRLSEAENGLVGKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVELRKM 887

Query: 782  LTAMNSNFEG---------SHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINV 832
            LT +NS  E          S   R++   E    L+  RK  I+KALQ  L+KT K++++
Sbjct: 888  LTILNSRPETELDNTMSSISRTKRNKHEIEKLELLK--RKKVIEKALQDGLQKTKKDLSL 945

Query: 833  ESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSD--------------YQKDDIK 878
            +SKR G++++PNKRL+ LR +MEDIEN+AR+LEMTNF+D              + K    
Sbjct: 946  DSKRFGITVQPNKRLQALRLQMEDIENEARQLEMTNFTDPVRTPKKGQEKRDSHNKHPSL 1005

Query: 879  EPEVSNEDDHKAVSESEEKAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSG 938
            +P +     +K  SE   K QQ                QQE+NDIS+FNVE   +E+F+ 
Sbjct: 1006 KPGIPIAKKNKDRSEEMAKKQQ----KLAELRKALADIQQETNDISRFNVEEHVNELFNA 1061

Query: 939  QKSLALDRLKKLETDYKGFGINFDPDSPLGQ-ALAGKSVSSDDKA-RTLDPKEALNIVEE 996
            +K  A++RLK+LET Y+ FG++F+ +  L +   + K +  D  A  TLDP   ++ ++E
Sbjct: 1062 KKIQAMERLKELETMYQNFGVDFNMEEFLEKNNTSTKELDPDSPAYETLDPNLFIDKMDE 1121

Query: 997  --------------VSNILSGLDSSKAAEKSNETPLRTATXXXXXXXXXXXKN------- 1035
                          ++N +S   +S +   SN+    ++T           +N       
Sbjct: 1122 LDKFSMKLDQLTSDLNNTMSAKQNSLSTTNSNQISTPSSTSSSDFESDEENENTALSNNV 1181

Query: 1036 GDKIAADSTLPT----SSFLESLSQKYGGAQNSLSNRHSFAGGEI--NYPGSGYH--RKS 1087
             D  +  S   T    SSFLESLSQKYG  QN        A G +  N P   ++   + 
Sbjct: 1182 NDNSSTFSHQSTTSGGSSFLESLSQKYGTGQN--------ASGPMSSNTPNVSHYNPERK 1233

Query: 1088 FMNRVKRTGAVP-YLGELSGKIGSSSYIKPSEAE 1120
            FM+R+K+  A P Y+ EL+ K+  +  +   E +
Sbjct: 1234 FMSRMKKQHATPNYIRELNQKVSVTHSLSEEETD 1267

 Score =  107 bits (267), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 91/170 (53%), Gaps = 29/170 (17%)

Query: 80  LNMASLSAYTDAVG-AHNRSASNASVGS---PTKYSYSRRASQWSNNNSAVSGS------ 129
           +N    S YT     +H+R+ S  SV S    TKYSYSRR S     N  +S S      
Sbjct: 107 MNQYVTSPYTHEYNNSHSRNTSINSVNSNPLSTKYSYSRRGS-----NQILSPSPTGNSS 161

Query: 130 -----------KLSRQQTNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEEL 178
                      + S    N               NL KF+ PDG V LE P +P E+E L
Sbjct: 162 NNNTSNINPQQRYSVHSNNPNSSSILSQGSLH--NLMKFMTPDGKVNLEMPNNPAEVEAL 219

Query: 179 FEEVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKN 228
           +E+++YKRN+ Q+LPA  QREL +YD+ KKWL+V+QDLQSE+KK M SKN
Sbjct: 220 YEDIMYKRNILQNLPADKQRELMSYDVSKKWLIVKQDLQSELKK-MRSKN 268

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/636 (55%), Positives = 442/636 (69%), Gaps = 32/636 (5%)

Query: 1317 KSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVL 1376
            K    SP+LPQSPSLF+ YPRP KKLKQLHWEK++  ++SIWR  KAE+FADDLYEKGVL
Sbjct: 1331 KKVLSSPLLPQSPSLFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVL 1390

Query: 1377 SRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCD 1436
            S LE AFAAREI                    VSQQFGINLHMY+SL V ++++KIL+CD
Sbjct: 1391 SELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCD 1450

Query: 1437 RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADR 1496
            RDFL TPSVI+FLS+ EIV+VS NLARN+APY  DWEG+ +VE+AKPPEK+P ELQRAD+
Sbjct: 1451 RDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQ 1510

Query: 1497 LYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556
            +YL+L VNLQ+YW SRMRALKVITT+EK+Y++L+ KL  +D+A  S+Q+SENL+NV  VI
Sbjct: 1511 IYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVI 1570

Query: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616
            LAVGN+MND+SKQAQGF+LATLQRLTFIKD  N+MTFLNYVEKI+R  YP FN FL ELE
Sbjct: 1571 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELE 1630

Query: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676
            PV+  VKISIEQ+  DC+EFSQS++NVERS++IGNLSD +KFHP DRVL KVLP+LP+AR
Sbjct: 1631 PVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDAR 1690

Query: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXX 1736
            KKG+LL DE+KLT++EF  LM+++GED+ DKFA+NSFFKKFADF+ EYKKAQ  N     
Sbjct: 1691 KKGELLGDEVKLTIMEFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQNLRLEE 1750

Query: 1737 XXXXXXXXXXXVEDQLKRTRESE-SKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAG 1795
                       VE+Q ++ +E+E S+    TD   D   +   + R +MD LLE+LKN  
Sbjct: 1751 EEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDD-EDGPGDGRAIMDTLLEQLKNVT 1809

Query: 1796 PA-KSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPD-NNSSEVQLNE 1853
            P  K+DPSS          L+  S+SN  IL + D ED    S++YSPD        ++ 
Sbjct: 1810 PTNKTDPSSARKRALVRKKLMGESTSN--ILKDIDTEDD---SIIYSPDAKKPMATTVDM 1864

Query: 1854 ADTSPTPERRVRDSNATSPASH-------------DTGSSDLTDRARNLLIELRGPESPG 1900
            A+T+   E  V     +SP  H             D    ++ +RA+ LLI+L G  SP 
Sbjct: 1865 ANTTLESELDV-----SSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPT 1919

Query: 1901 VKMSA--QHQRLSKLRARRKNDSSSSGSENRLNFVG 1934
             + S   +H+   + R RR  +   SG   +L FVG
Sbjct: 1920 KRHSLLNEHKERLRARRRRTTNEFVSG---KLQFVG 1952

 Score =  575 bits (1481), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 337/843 (39%), Positives = 502/843 (59%), Gaps = 56/843 (6%)

Query: 297  DPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCY 356
            D ++  P  YV+KII + ++++ + DLWV+LRTEQLDWV  F+E QG +A+ANV++K+ Y
Sbjct: 332  DKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIY 391

Query: 357  RESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVAT 416
            + +P+  L  ++L+KE ++FKC +    L +G  E        ++   I  GL S  ++T
Sbjct: 392  KTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFT---KHELMAQTIARGLFSTTLST 448

Query: 417  RRVASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAP 476
            R++A+E+ + +     P  F  +++ LDQ+ +   N+H+   L         K G    P
Sbjct: 449  RKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNL--------KKFGEYFGP 500

Query: 477  TPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLI 536
                   +V R    W+  VE++LDGRGKMGS VGAS+D++ SGGENA +EY   +++ I
Sbjct: 501  LTLDSNLKVTRA---WLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFI 557

Query: 537  NHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYS 596
            NHLC    ++ QR +LR +L+  G+ RI+N++K L+YEKV EQ+  +++S  DD + L  
Sbjct: 558  NHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLE 617

Query: 597  QESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTK 656
              +    +++ DP S+ +NLW+ CKGT+ E+ L SL+Q+L +S+ +L  ++K D TQ +K
Sbjct: 618  LSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQL-IEDKQDATQLSK 676

Query: 657  QLKLIDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAD 716
            QLKL+D+LV+NVS+AS D +S+ N AIQRLYDAMQTDE+ARR+ILE+R   K+ EE +A+
Sbjct: 677  QLKLMDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAE 736

Query: 717  RDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEV 776
             D L +KL NAE GLVGQLQDE+RQRD +  K+QR+  QLQ EL++ KKK +L KHE EV
Sbjct: 737  IDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEV 796

Query: 777  ELRKTLTAMNSNFEGS--HNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINVES 834
            ELRK LT +N+  +         +K    P      +K  IQK LQ  L +T K+  ++S
Sbjct: 797  ELRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDS 856

Query: 835  KRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSES 894
            K  G++++PNKRLK LR +MEDIEN+ARELEMTNF++++K  ++      +   K  +++
Sbjct: 857  KSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFEKKKLEPAPKIKKLKQKKQNKN 916

Query: 895  EEKAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDY 954
            E+K +                 Q ESNDISKFNVE R +E+F+ ++S AL RLK+LET Y
Sbjct: 917  EKKEEDDKIKKLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKY 976

Query: 955  KGFGINFDPDSPLGQALAGKSVSSDDKAR--TLDPKEALNIVEEVSNILSGLDSSKAAEK 1012
            K FGINF+ D  + +   G   S D      +LDP      ++E++ I   L  ++A  K
Sbjct: 977  KDFGINFNIDD-ISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLDAQA--K 1033

Query: 1013 SNETPLRTATXXXXXXXXXXX----------------------KNGDK---IAADSTLPT 1047
             NE  L+ ++                                 K+ D+   I+A ST   
Sbjct: 1034 LNEKNLKDSSNKSTFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRDRQSEISAQSTSSA 1093

Query: 1048 S-SFLESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTGAVP-YLGELS 1105
            + SFLE+LSQKY   QN+ S+       +     S Y    F+NRV++    P +L ELS
Sbjct: 1094 AGSFLEALSQKYAMGQNNPSSPQR----DRPVKASQY---DFINRVRKNNITPQFLEELS 1146

Query: 1106 GKI 1108
            GK+
Sbjct: 1147 GKV 1149

 Score =  110 bits (274), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 112/199 (56%), Gaps = 9/199 (4%)

Query: 31  LKRLTTGSGNSSVSHNTQKLDISDISSPKKINLPDTGEFS-H-----KPLSKQSTLNMAS 84
           LKR  T S  SS + + +  + S+ S  K+ ++P     S H     KPL K +TLN  +
Sbjct: 32  LKRFATNSTGSSNNTSPRTSNSSEPSQVKRESIPQGSTSSLHSSNEIKPLIKNTTLNTQN 91

Query: 85  LSAYTDAVGAHNRSASNASVGSPTKYSYSRRASQWSNNNSAVSGSKLSRQQTNXXXXXXX 144
           LS Y ++    + S S +   S      SRRAS  +N   +V+G KL RQ TN       
Sbjct: 92  LSQYINSKNIPDHSRSQSIQSSSKYSYSSRRASSQTN--PSVTGYKLDRQYTNQSSAVSV 149

Query: 145 XXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYD 204
                   NLSKF+  DG + LE P DP EIE L++E++ KRN+ QSLP + Q EL +YD
Sbjct: 150 LSQGSYS-NLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYD 208

Query: 205 LEKKWLMVRQDLQSEVKKF 223
           + KKWL+V+QDLQ+E KKF
Sbjct: 209 IGKKWLIVKQDLQNEWKKF 227

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/657 (52%), Positives = 437/657 (66%), Gaps = 44/657 (6%)

Query: 1317 KSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVL 1376
            +S   S +L +SPSL+ +YPRP KKLKQLHW+K+DD+E SIW  A AE+FADDLYEKGVL
Sbjct: 1245 RSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVL 1304

Query: 1377 SRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCD 1436
              LEKAFAAREI                    +SQQFGINLHM+ SL+V+E+V KIL+C+
Sbjct: 1305 HNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCN 1364

Query: 1437 RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADR 1496
            RD ++TPSVI+FLSK EI +VS NLARN+APY  DWEGV  VE+AK PEK    LQRAD+
Sbjct: 1365 RDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQ 1424

Query: 1497 LYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556
            +Y++L VNLQ+YW SRMRA+KVIT+YEK+Y++LV KL  ID A  +IQ+S+NL N+ +VI
Sbjct: 1425 IYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVI 1484

Query: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616
            LAVGN+MNDSSKQAQGF+L TLQRLTFIKD  NSMTFLNYVEKIIRE YPEFN F++ELE
Sbjct: 1485 LAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELE 1544

Query: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676
            PV+  VKIS+EQ+  DC EF+QS++NVERS++IGNLSD +KFHP D+V+ KVLP LPEA 
Sbjct: 1545 PVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEAT 1604

Query: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXX 1736
            KK DLL DE+KLT +EF+ LM+ FGED+ DKFA+NSFFKKFADF+ EYKKA+  N     
Sbjct: 1605 KKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEE 1664

Query: 1737 XXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGP 1796
                       VE+Q ++ +E E KN   T            ++R  MD+LL +LKNAGP
Sbjct: 1665 EVRKYERHKQMVEEQQRKAKEQE-KNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGP 1723

Query: 1797 AKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNS-SEVQLNEAD 1855
            A+SDPSS          LL    S S ILD  D+   DG S++YSP  +   +  L E +
Sbjct: 1724 ARSDPSSARKRAVMRKKLLSEKDSTSVILD--DLNAGDG-SIIYSPTTDKVVDTSLGEDE 1780

Query: 1856 T---SPTPERR------------------------VRDSNATSPASHDTGSSD------L 1882
                SPTP+ +                          D+NA +  + D  S+       +
Sbjct: 1781 MILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNGDGEDEVI 1840

Query: 1883 TDRARNLLIELRGPESPGVKMSAQHQRLSKLRARRKNDSSSSGSE------NRLNFV 1933
            TDRA+ LL+ELRG ++P  K S    +  KLR+RR     + G E      NRL FV
Sbjct: 1841 TDRAKALLMELRGSQTPSKKNSHLDDQREKLRSRRNRRRQTFGEESNSTPSNRLTFV 1897

 Score =  579 bits (1492), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 332/829 (40%), Positives = 503/829 (60%), Gaps = 51/829 (6%)

Query: 297  DPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCY 356
            D ++++P +YVRKI+ + +S   LNDLWV+LRTEQLDWV  FLE QG +AIAN +++  Y
Sbjct: 328  DKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIY 387

Query: 357  RESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVAT 416
            + +P + L DE+++KE+ +FKC +    L +G  E       ++++  +  GL S RV+T
Sbjct: 388  KTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFT---KHKLMMDTLAFGLFSTRVST 444

Query: 417  RRVASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAP 476
            R++A E+L+ +        F  V+ +LD+  R  +N+++  ++ITQ        G+    
Sbjct: 445  RKMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNM-LKIITQFG------GAFSRT 497

Query: 477  TPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLI 536
            +PD       + F+ +++ +E TL+GRGKMGS VGAS+DF+ SGGENAI+EY    L+ I
Sbjct: 498  SPDTQ----FKIFQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFI 553

Query: 537  NHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYS 596
            N LC    ++ QR VLR + +N G  R++ K+KL++YEK+  Q+  ++D   DDF++L  
Sbjct: 554  NKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLE 613

Query: 597  QESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTK 656
             +S+   ++M+DP S+  +LW +CKGT+ E+ L SL+Q+L +S+ +L   +K +P + +K
Sbjct: 614  MKSSSAQINMQDPTSLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKL-VDDKREPAKLSK 672

Query: 657  QLKLIDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAD 716
            QLKL+D+L++N++ + VD Q+  N AIQRLYD+MQTD++ARRAILE R   K+ EE+ A+
Sbjct: 673  QLKLMDSLMTNITASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAE 732

Query: 717  RDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEV 776
            ++ LKEKLS AE GLVGQL+ E+ QRD+IL KSQRV  QLQ EL++ KKK +L KHEHEV
Sbjct: 733  KEYLKEKLSKAENGLVGQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEV 792

Query: 777  ELRKTLTAMNSNFEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINVESKR 836
            ELRK LT +N+N +   ++ +            ++K  IQKAL+ +L +T K++N + K+
Sbjct: 793  ELRKILTIVNTNTDADASLNNS----------SDKKHNIQKALETELSRTKKDLNNDVKK 842

Query: 837  LGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSE--- 893
             G+S++PNKRL++LR +MEDIE +ARELEMTNFS++QK  ++ P V N+   +   +   
Sbjct: 843  FGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSKK 902

Query: 894  -----------SEEKAQQIXXXXXXXXXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSL 942
                       + ++A  I               Q E+ND+SKFNV+ R +E+F  +K  
Sbjct: 903  KSKSSKSKEENNRKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHE 962

Query: 943  ALDRLKKLETDYKGFGINFDPDSPLGQALAGKSVSSDDKARTLDPKEALNIVEEVSNILS 1002
            AL+RL+ LE  YK F I+FDP+    QA     + S+    +LDP      + ++  I  
Sbjct: 963  ALNRLQMLEKKYKSFEIDFDPND-FKQA----QLDSNASYESLDPNFVTKKITDIDRIAD 1017

Query: 1003 GLDSSKAAEKSNETPLRTATXXXXXXXXXXXKNGDKIAADSTL-PTSSFLESLSQKYGGA 1061
             LD+      S+ +    +                 I     L   SSFLESLS+KYG A
Sbjct: 1018 ELDAFSGDGTSSYSSSSLSDSEKNYYESNAVPT---IGPQKGLIDGSSFLESLSEKYGTA 1074

Query: 1062 QNSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRT-GAVPYLGELSGKIG 1109
            QN+     S    +      G   KSFMNR KR   ++ +L ELS K+G
Sbjct: 1075 QNTEGTSLSPLSPQNRIASLG--EKSFMNRFKRKPSSMQFLEELSQKVG 1121

 Score =  108 bits (269), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 124/223 (55%), Gaps = 40/223 (17%)

Query: 31  LKRLTTGSGNSSVSHNTQKLDISDISSPK------KINLPDTGEFSHKPLSKQSTLNMAS 84
           LK+LT  S  +S ++   K   SDISSPK      K+++ D      KPL+K+++LN  +
Sbjct: 30  LKKLTNSSSTTSQNNAINK---SDISSPKSQLLTNKLSMDDL-----KPLNKRTSLNNQN 81

Query: 85  LSAYTDAVGAHNRSASNAS----VGSPTKY------------SYSRRASQWSN------- 121
           LS Y +  G   +S S++S    V S  KY            +++R AS  S+       
Sbjct: 82  LSQYIN--GKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASVQSSAKYSYSR 139

Query: 122 -NNSAVSGSKLSRQQTNXXXXXXXXXXXXXXXNLSKFVGPDGAVRLERPRDPKEIEELFE 180
            ++++ + ++LSRQ TN               NLSK++  +G + L+ P D  EIE LFE
Sbjct: 140 RSSNSTAATRLSRQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFE 199

Query: 181 EVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKF 223
           E++YKRN+ Q+L    QR++ NYD +KKW++V+QDLQ+E+K+ 
Sbjct: 200 ELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRI 242

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/633 (51%), Positives = 420/633 (66%), Gaps = 36/633 (5%)

Query: 1321 PSPMLPQSPSLF-----DRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGV 1375
            P   +   PSL      DR PRP KKLKQLHW+K+D  + SIW    AE+FADDLYEKGV
Sbjct: 1252 PYKSVVDQPSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGV 1311

Query: 1376 LSRLEKAFAAREIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRC 1435
            L  LEKAFAAREI                    +SQQFGINLHMY SL+V E++ K+L+C
Sbjct: 1312 LRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKC 1371

Query: 1436 DRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRAD 1495
            DR+ ++TPSVI+FL+K EIVEVS NLARN+APYT DWEGV S++  K         QR  
Sbjct: 1372 DRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRI 1423

Query: 1496 RL-YLELF------VNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSEN 1548
            ++ Y EL       VNLQ+YW+SRMRALKVIT+YE++Y++LV KL  +DKA  ++Q+SEN
Sbjct: 1424 QMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSEN 1483

Query: 1549 LRNVLDVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEF 1608
            L+NV +VILAVGN+MND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKI+R+ YP F
Sbjct: 1484 LKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSF 1543

Query: 1609 NDFLKELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKV 1668
            NDF+ +LEPV+  VK+S+EQ+  DC EFSQS++NVERS++IGNLSD +KFHPSD+VL KV
Sbjct: 1544 NDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKV 1603

Query: 1669 LPTLPEARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQ 1728
            LP LPEA KK  LL DE+KLT++EF+ LM+ +GEDA DKFA+NSFFKKFADF+ EYKKAQ
Sbjct: 1604 LPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGDKFAKNSFFKKFADFITEYKKAQ 1663

Query: 1729 VYNXXXXXXXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLL 1788
              N                +E+Q  +    E +++      G+    E ++ R +MD+LL
Sbjct: 1664 SQNLKQEEEERAYEKHKRMIEEQQHKQDLEEERSREVEGEPGE----EQSDRRAMMDKLL 1719

Query: 1789 EKLKNAGPAKSDPSSXXXXXXXXXXLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSE 1848
            EKLKNAGP K+DPSS          LL      + IL + D  D    S+VYSP+  + E
Sbjct: 1720 EKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDD---SIVYSPNTPTQE 1776

Query: 1849 VQLNEADTSPTPERR----VRDSNATSPASHDTGSSD--LTDRARNLLIELRGPESP--G 1900
               +    SPTP  +    +   + T  ++ D  + D  ++DRA+ LL+ELRG E+    
Sbjct: 1777 GPNDIHLASPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSENMKRN 1836

Query: 1901 VKMSAQHQRLSKLRARRKNDSSSSGSENRLNFV 1933
             ++  Q ++L   R+RR+  + S  S N+L F 
Sbjct: 1837 SQLEEQKEKLKARRSRRRTQTESISS-NKLFFT 1868

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/876 (41%), Positives = 526/876 (60%), Gaps = 67/876 (7%)

Query: 264  GLSRPKISTSSVN-TSEQFYXXXXXXXXXXXXXQDPSHLSPDYYVRKIICNDISAKRLND 322
            G SRP  S+S+ + T+   Y              D  +  P +YV+KII + ++++ +ND
Sbjct: 290  GKSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMND 349

Query: 323  LWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTS 382
            LWV+LRTEQLDWV  FLE QG +A+ANV++ T Y+ +P + L  E+ +KE ++FKC +  
Sbjct: 350  LWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVL 409

Query: 383  LNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNHVMDA 442
              L +G  E       +++   I  GL S R+ATR++A+E+L+ + +      F  V+ +
Sbjct: 410  SMLSQGLYEFA---KHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLAS 466

Query: 443  LDQESRFCDN---VHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEYT 499
            LD+  R  +N   VHL   L  +     P     I               + W++ ++ T
Sbjct: 467  LDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKI--------------IQAWLIALDET 512

Query: 500  LDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNA 559
            L+GRGKMGSLVGAS+D+R S GENAI+EY   T++ INHLC     + QR +LR +L+N 
Sbjct: 513  LNGRGKMGSLVGASDDYR-SAGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENL 571

Query: 560  GLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNL 619
            G  RI+ K+K L+YEK+ EQ+  +D++  DDF+ +   ES    V+M++P S+ +NLW  
Sbjct: 572  GALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWES 631

Query: 620  CKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSF 679
            CKG+D E+ L SL+Q+L +S+ +L  + K+DPT+ +KQLKLID+L++NV+ +  D +S  
Sbjct: 632  CKGSDNEKLLLSLIQHLYLSSSKLMGE-KEDPTKLSKQLKLIDSLLTNVNGSMFDEESHM 690

Query: 680  NSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEV 739
            N AIQRLYD+MQTDE+ARRAILE+R   K+ EE  A+RD L  KLSNAE GLVGQL+ ++
Sbjct: 691  NLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDL 750

Query: 740  RQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDEK 799
            +QRD+ILEK+QRV  QL+ EL++ KKK +L KHEHEVELRK LT +NS            
Sbjct: 751  KQRDNILEKNQRVMKQLESELEDLKKKHLLEKHEHEVELRKMLTILNS----------RN 800

Query: 800  GSENPR------PLRPERKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSR 853
            G++NP        L P +KL IQKAL+ +L KT K+++ +SKR G++++PNKRLK+LR +
Sbjct: 801  GTQNPDVDDVTITLDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQ 860

Query: 854  MEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAV-----SESEEKAQQIXXXXXXX 908
            MEDIEN+AR+LEMTNF+D+++ ++K+P +  ++          +E  +K  ++       
Sbjct: 861  MEDIENEARQLEMTNFADHKRTNLKKPVIVKKEKKLRKKKKINTEEFDKENEMKTKKLMQ 920

Query: 909  XXXXXXXXQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLG 968
                    Q E+NDISKFNVEGR +EMF  +K  AL RLK+LE  YK F I FD      
Sbjct: 921  LRKALAAIQSETNDISKFNVEGRVNEMFQDKKLKALQRLKQLEAKYKDFEIPFDE----L 976

Query: 969  QALAGKSVSSDDKARTLDP---KEALNIVEEVSNILSGLDSSKAAEKSNETPLRTATXXX 1025
            Q L  + +  + +  TLDP   ++ +N ++E+S+ L  ++    A   N       T   
Sbjct: 977  QDLDDRELDDEQQHSTLDPTYLQKKINELDEISDELYLMNYDSDANNGN-------TSDS 1029

Query: 1026 XXXXXXXXKNGDKIAADSTLPT------SSFLESLSQKYGGAQNSLSNRHSFAGGEINYP 1079
                       D + + S  P+       SFLESLSQKYG  QN++S+  S         
Sbjct: 1030 SSSSEADGDGTDSMRSVSNAPSKGISEAGSFLESLSQKYGTGQNAISSPTSITSPNERIA 1089

Query: 1080 GSGYHRKSFMNRVKR-TGAVPYLGELSGKIGSSSYI 1114
              G   KSFMNR+KR T A P+L EL+ K+  +S I
Sbjct: 1090 SQG--EKSFMNRLKRQTMAAPFLEELTQKVNDTSSI 1123

 Score =  139 bits (351), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 81/186 (43%), Positives = 112/186 (60%), Gaps = 22/186 (11%)

Query: 53  SDISSPKKINLPDTGEFSH---KPLSKQSTLNMASLSAYT----------DAVGAHNRSA 99
           +DISSPKK  +P   +F+    +PL+K+STLN  +LS Y           + +  +N S 
Sbjct: 43  ADISSPKKPIVPK--QFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSH 100

Query: 100 SNA-SVGSPTKYSYSRRASQWSNNNSAVSGSKLSRQQTNXXXXXXXXXXXXXXXNLSKFV 158
           + A S  S TKYSYSRR+S      +A    KLSRQQT                NL K++
Sbjct: 101 TRAHSSQSATKYSYSRRSS------TATGPIKLSRQQTTQSLGSSSVLSQGSYTNLLKYI 154

Query: 159 GPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQS 218
             DG + LE PRDP E+E LFE+++YKRN++Q+LP   Q+EL +YD+ KKW +V+QDLQ+
Sbjct: 155 DSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQN 214

Query: 219 EVKKFM 224
           E+KK M
Sbjct: 215 EIKKLM 220

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  305 bits (782), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 152/396 (38%), Positives = 245/396 (61%), Gaps = 13/396 (3%)

Query: 1336 PRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIXXXXXXX 1395
            P+ + +LKQ+HWEK+DD   ++W D       D L ++GV S++EK F   E        
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLWEDVSGIPL-DHLKDEGVFSQIEKYFKILEPVKKTKVL 874

Query: 1396 XXXX---XXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQ 1452
                            ++QQFGINLHMYS LSVEE V+K+L+C+ D +   SV+ F +K+
Sbjct: 875  AENENKPTKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTKE 934

Query: 1453 EIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSR 1512
            ++ ++ + L R FAPY+ ++    S      PEKDP EL+RAD +YLELF NL++YWS+R
Sbjct: 935  DLTQIPSGLERKFAPYSTNYLTDDS------PEKDPRELERADHIYLELFYNLRSYWSAR 988

Query: 1513 MRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQG 1572
               L V+TTYE+DY DL++KL  ID+A   +  S  ++ +L +I  +GN+MN  S    G
Sbjct: 989  SHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VTG 1046

Query: 1573 FRLATLQRLTFIKDD-KNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQ 1631
             +L +L +L+F+K   + +++FL++VE+++RE++P+   F +++  V    K+++E V  
Sbjct: 1047 IKLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVEL 1106

Query: 1632 DCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLL 1691
            +C EF++ V +V  S+  G LSDPTK HP D +  K+   +  A+ K +LL+++ +LT  
Sbjct: 1107 ECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTKR 1166

Query: 1692 EFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKA 1727
              + LM+ +GE+ MDK ++N+FF  F +F + +KK 
Sbjct: 1167 SLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKC 1202

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  303 bits (777), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 157/394 (39%), Positives = 241/394 (61%), Gaps = 15/394 (3%)

Query: 1341 KLKQLHWEKIDDAEDSIWRDAKAE-KFADDLYEKGVLSRLEKAF----AAREIXXXXXXX 1395
            KLKQ+HW+KIDD   ++W D K     + +L   GV   +E+ F    AA ++       
Sbjct: 815  KLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMFTA 874

Query: 1396 XXXXXXXXXXXXX-VSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEI 1454
                          ++QQFGINL+++S+ SVEE+V K+L CD + +   SVI+F SK +I
Sbjct: 875  QNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKDDI 934

Query: 1455 VEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMR 1514
              +  ++ R FAPY  ++           PEKD   L RADR+YLELF NL++YW+ R +
Sbjct: 935  NHIPQSIQRMFAPYETNYL------TGDKPEKDSRSLDRADRIYLELFYNLRSYWAPRAK 988

Query: 1515 ALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFR 1574
             L  + TYEKDY D+++KL  ID  T +I+ S+ L+ +L +I+ VGN+MN+  KQA G +
Sbjct: 989  YLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALGIQ 1046

Query: 1575 LATLQRLTFIKDDK-NSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDC 1633
            L++L +L F K  K N+++F++ +E I+R  YP+ + F+ +LE ++    I ++ V Q+ 
Sbjct: 1047 LSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQEA 1106

Query: 1634 REFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEF 1693
            +EF + +  +ERS+ +G LSD +KFHP D+ L+     +  A KK DLL  +  LT+ EF
Sbjct: 1107 QEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMGEF 1166

Query: 1694 DNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKA 1727
            D LM  +GED  + F++N+FF+KF DF L +KKA
Sbjct: 1167 DKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKA 1200

 Score = 35.4 bits (80), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/126 (20%), Positives = 54/126 (42%), Gaps = 7/126 (5%)

Query: 516 FRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKM----KLL 571
           F     +  +++Y   T+ L+N + Q      ++    A LK AG+ RI  K+    K  
Sbjct: 305 FIIQKPQQLMIDYCVSTMFLVNSIVQGLPSYNEKRKTLAMLKYAGIHRIFQKISNSKKRF 364

Query: 572 NYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTS 631
           + E + +Q+A++ D   D       ++   + +      S    + NL + T  E  +  
Sbjct: 365 DSEILLDQIAKYRDREVDVASKFTIEQHIEQNISF---ASQVNTILNLAQSTSLEPSMAK 421

Query: 632 LLQNLL 637
           L ++++
Sbjct: 422 LFESVI 427

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  301 bits (772), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 166/459 (36%), Positives = 262/459 (57%), Gaps = 24/459 (5%)

Query: 1339 SKKLKQLHWEKIDDAEDSIW-RDAKAEKFADDLYEKGVLSRLEKAFAARE---IXXXXXX 1394
            +KK+KQ+HWEKI+D E++ W  + + E+   +L   G+  ++E  F  +    I      
Sbjct: 817  TKKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSVIMKKKKV 876

Query: 1395 XXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEI 1454
                          ++QQFGINLH++  LS +E+VSK+LRCD D L   SV++F  K+E+
Sbjct: 877  VSSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLEFFCKEEM 936

Query: 1455 VEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMR 1514
              ++ +L R+  PY+ D+    SV     P K+P ELQRAD+++L+L  NL++YW+ R +
Sbjct: 937  THINPSLVRHLTPYSTDYMNPESV-----PTKNPDELQRADKIFLKLSFNLRSYWNERSQ 991

Query: 1515 ALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFR 1574
             L ++ TYEKDY DL++KL  ID A   I  SE  +N+L +I+ +GNFMN  ++   G R
Sbjct: 992  CLLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--TRPVSGIR 1049

Query: 1575 LATLQRLTFIK-DDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDC 1633
            L+ L +L FIK ++ N+++FL+Y+E++IR  Y +   F+ +L  V    KIS++QVA  C
Sbjct: 1050 LSALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISMDQVALQC 1109

Query: 1634 REFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEF 1693
             EF   +  +  ++  G LSDP K HP D++L KV   +  AR KG+LL D  KL+  +F
Sbjct: 1110 EEFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHFKLSNNDF 1169

Query: 1694 DNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXXXXXXXXXXXXVEDQLK 1753
            + +MR +GED  D  +++ FF+ F +F   +KK    N                V  Q K
Sbjct: 1170 EKVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKEN--------MEREEAERVYAQRK 1221

Query: 1754 RTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLK 1792
            +  E+ ++     D+G D++  E       +D LL +L+
Sbjct: 1222 KIMEASTRKDSDVDSGTDNIDGE----NTAVDSLLAQLR 1256

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 92/188 (48%), Gaps = 24/188 (12%)

Query: 525 IMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFD 584
           I +Y    L LIN + Q       +  + A LK + +  +L  ++ ++   + EQ+  F 
Sbjct: 339 ISDYFSSMLFLINSIVQGFQSFTTKKNILAELKRSEVYTLLYLLEDIDCNVIQEQVKLFK 398

Query: 585 DSTTDDFDALYSQESTGEGVDMKDPV-SMTQNLWNLCKGTDAEQHLTSLLQNLLISTGEL 643
           D T ++   + S+ES   GV +  P  S+ Q L NL   T  E  + SLL   LI    L
Sbjct: 399 D-TEENILEVTSRES---GVHIDSPYGSILQQLTNLTSNTQLEPQINSLLD--LI----L 448

Query: 644 GSKNKDDPTQRTKQLKLIDALVSNVSMASVDM---------QSSFNSAIQRLYDAMQTDE 694
            S NK   ++ +K L+ +++ +      S+D          ++ F  ++  L D++Q+DE
Sbjct: 449 KSVNKKTYSESSKLLQFMESFLQ----YSLDNSNHNHYEHPETLFQESVNNLMDSLQSDE 504

Query: 695 IARRAILE 702
           IA+RA+LE
Sbjct: 505 IAKRAMLE 512

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  299 bits (765), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 169/471 (35%), Positives = 266/471 (56%), Gaps = 43/471 (9%)

Query: 1341 KLKQLHWEKIDDAEDSIWRD--------AKAEKFADDLYEKGVLSRLEKAFAA-----RE 1387
            KLKQ+HW+KID+ ++++W +         K E F       GV   +E  F       + 
Sbjct: 771  KLKQIHWDKIDNIKETVWNEHNERISTSTKLETF-------GVFKEIEDLFKVVPATPKT 823

Query: 1388 IXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVID 1447
                                 ++Q FGINLH++S  S EE++  +L C  + L    VI+
Sbjct: 824  ASSNSPTQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQNQRVIE 883

Query: 1448 FLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQT 1507
            F SK +I  +  +  R FAPY  ++         K P+KDP  L+RADR+YLELF NL++
Sbjct: 884  FFSKDDINHIPQSTQRMFAPYETNYL------TGKTPDKDPAVLERADRIYLELFYNLRS 937

Query: 1508 YWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSS 1567
            YW++R + L V+ TYE+DY D+++KL  ID AT +I+ S+ L+ +  +I+ +GN+MN+  
Sbjct: 938  YWAARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGNYMNN-- 995

Query: 1568 KQAQGFRLATLQRLTFIKDDK-NSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISI 1626
            KQA G +L+++ +L F K  K N+++F++ +E+IIR  YPE ++F ++LE V     I +
Sbjct: 996  KQALGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQDMANIIV 1055

Query: 1627 EQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEM 1686
            + V Q+ +EF + + N+ERS+ +G LSD ++FHP D+ L K   ++  ARKK +LL+D+ 
Sbjct: 1056 QHVQQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAELLIDQS 1115

Query: 1687 KLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXXXXXXXXXXX 1746
             LT+ +F+ L+  +GED  D  +RN+FF+KF DF+  +KKA   N               
Sbjct: 1116 TLTMGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENIEREEIR-------- 1167

Query: 1747 XVEDQLKRTRE---SESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNA 1794
                Q+KR  E   S  K K    +   SV  EV+E   V D LL++L++ 
Sbjct: 1168 --RSQVKRVIERVPSPEKTKSVARSTPLSVGTEVDEQHAV-DVLLKRLRDV 1215

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  301 bits (770), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 160/477 (33%), Positives = 267/477 (55%), Gaps = 25/477 (5%)

Query: 1328 SPSLFDRYPRPSK---KLKQLHWEKIDDAEDSIWRDAKAE-KFADDLYEKGVLSRLEKAF 1383
            +P++  + P P     KLKQ+HW+KI++ ++++W D +     + +L   G+   +E+ F
Sbjct: 1149 APTMLTQQPSPPSTRIKLKQIHWDKIENIKETVWCDEQQRVSKSSELESLGIFKEIEELF 1208

Query: 1384 AAREIXXXXXXXXXXXXXXXXX-----XXXVSQQFGINLHMYSSLSVEEVVSKILRCDRD 1438
              +                           ++Q+FGINLH++S  +VEE+V K+L CD +
Sbjct: 1209 EIKPASTNLANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSCDSE 1268

Query: 1439 FLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLY 1498
             +    V++F  K+E   V  ++ R F PY  ++         + PEKDP EL+RADR+Y
Sbjct: 1269 VMKNQGVLEFFCKEEANNVPQSIQRLFGPYETNYL------TGERPEKDPAELERADRIY 1322

Query: 1499 LELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILA 1558
            LELF NL++YW++R   L VI+T+E+DY D+++KL  ID AT +IQ S  L+ +  +I+ 
Sbjct: 1323 LELFYNLRSYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFFIIVE 1382

Query: 1559 VGNFMNDSSKQAQGFRLATLQRLTFIKDDK-NSMTFLNYVEKIIRETYPEFNDFLKELEP 1617
            +GN+MN   K  QG +L++L +L F K  K N+++F++ +E+I+R  YP  +DF++ +  
Sbjct: 1383 IGNYMNQ--KPVQGIQLSSLNKLAFTKTIKDNNLSFIHVLERIVRTRYPSVHDFVEGINS 1440

Query: 1618 VVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARK 1677
            +     I ++ V Q+  EF   + N++RS+  G LSDP+KFHP DR L +    L +A+K
Sbjct: 1441 ITGVANIIVQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLAQAKK 1500

Query: 1678 KGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXX 1737
            K  LL D+  LT+ +F+ LM  +GE+  +  ++N+FF+KF DF+L ++KA   N      
Sbjct: 1501 KARLLRDQCSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENTEREEL 1560

Query: 1738 XXXXXXXXXXVEDQLK-RTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKN 1793
                      +E     + R   S       + GDS       D+D +D L+ +L++
Sbjct: 1561 DRTYEKRRRLLEQTAALQDRRRSSGLSSVPSSAGDSA------DKDAVDTLMRRLRD 1611

 Score = 38.9 bits (89), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 105/246 (42%), Gaps = 49/246 (19%)

Query: 481 DGDRVMRKFEQ----WMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLI 536
           D  RV ++ EQ    W+  VE T+    +          FR    +  +++Y   T+ LI
Sbjct: 268 DSTRVSQELEQHYSRWLAAVETTITDEAQW-----RRSPFRAQSPQQFMIDYCVSTMFLI 322

Query: 537 NHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVD-----EQLARFDDSTTDDF 591
           N L Q     + +      L++AG+ RI +++ + + EK D     ++++++    T + 
Sbjct: 323 NALIQGMPSYQAKGKTIRLLRDAGIHRIFHRI-VSSGEKFDSEILLDEISKYQTRET-EI 380

Query: 592 DALYSQES-----TGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSK 646
           +A +  E+           +K  VS+TQ       GT  E  +  +L ++          
Sbjct: 381 NAKFVPETPPSRYVSFAAQIKTIVSLTQ-------GTSLESSMALVLDSI---------- 423

Query: 647 NKDDPTQRT-----KQLKLIDALVSNVSMASVD-----MQSSFNSAIQRLYDAMQTDEIA 696
            +   T RT     K L+L  ++   +   S D      +S   +A+ +L D +Q+ ++ 
Sbjct: 424 -RQIITSRTSAEAAKLLQLFHSIFKYLIAHSYDREELGTESVLRAALNKLMDDLQSTQVN 482

Query: 697 RRAILE 702
           +RA+ E
Sbjct: 483 QRAVQE 488

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  299 bits (766), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 164/482 (34%), Positives = 269/482 (55%), Gaps = 21/482 (4%)

Query: 1322 SPMLPQSPSL--FDRYPRPSKKLKQLHWEKIDDAEDSIWRD-AKAEKFADDLYEKGVLSR 1378
            SP  P  P L        P  KLKQ+HW+KIDD ++++W D ++    + +L   G+   
Sbjct: 940  SPGAPDIPKLGNVTLLSAPKLKLKQIHWDKIDDIKETVWCDQSQRVSKSTELASFGIFQE 999

Query: 1379 LEKAFAAREIXXXXXXXXXXXXXXXXXXXXV-----SQQFGINLHMYSSLSVEEVVSKIL 1433
            +++ F                         +     +Q+FGINLH++S  +VEE+ SK+L
Sbjct: 1000 IDELFQLNPTSPAIANATANLLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKVL 1059

Query: 1434 RCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQR 1493
             CD + L   SVI+F  K+EI  +  ++ + FAPY+ ++         + P++DP EL R
Sbjct: 1060 NCDNEVLKNQSVIEFFCKEEINNIPKSVQQLFAPYSANYI------TGEQPDRDPNELDR 1113

Query: 1494 ADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVL 1553
            ADR+YLELF NL++YW +R + L VI T++KDY D++HKL  ID AT ++Q S  L+ + 
Sbjct: 1114 ADRIYLELFYNLRSYWGARSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELF 1173

Query: 1554 DVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDK-NSMTFLNYVEKIIRETYPEFNDFL 1612
             +I+ +GN+MN   +   G +L++L +L F K    N+M+F++ +E+I+R  YP  +DF+
Sbjct: 1174 FIIVEIGNYMNQ--RPVAGIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFV 1231

Query: 1613 KELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTL 1672
            + L+ ++    I ++ V Q+  EF   + ++ER   IG LSDP++FHP D+ +LK    +
Sbjct: 1232 EGLDKILEVQNIIVQHVQQEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKI 1291

Query: 1673 PEARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNX 1732
              A+KK DLL D+  LT+ +F+ LM  +GE+  +  ++NSFFKKF DF+  ++KA   N 
Sbjct: 1292 LLAKKKADLLKDQCTLTMSDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENS 1351

Query: 1733 XXXXXXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLK 1792
                           +E      R+    ++ +T A  D    +  +  D +D L++KL+
Sbjct: 1352 EREEMTRIYEKRRRALEQSASSQRQRRRASRLSTAASMD----DGTQQEDAVDTLIKKLR 1407

Query: 1793 NA 1794
            N 
Sbjct: 1408 NV 1409

 Score = 40.4 bits (93), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 108/237 (45%), Gaps = 27/237 (11%)

Query: 489 FEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQ 548
           + QW+  VE T+    +    V +++       +  +++Y   T+ LIN L Q     + 
Sbjct: 286 YTQWLEAVETTIKDETQWHDDVPSNQK-----PQQLMIDYCVSTMFLINSLIQGIPTYRG 340

Query: 549 RTVLRARLKNAGLPRILNKMKLLNYEKVD-----EQLARFDDSTTDDFDALYSQESTGEG 603
           ++ L   LK+AG+ RI +++ + + EK D     ++++++     +          T   
Sbjct: 341 KSRLIRLLKDAGIHRIFHRI-VSSGEKFDSEILLDEISKYQSREGEINSKFVIDTPTHLN 399

Query: 604 VDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLL-ISTGELGSKNKDDPTQRTKQLKLID 662
           V  K   S  + +  L +GT  E ++T +L ++  I T    +       + TK L+L  
Sbjct: 400 VSFK---SQIKTIVTLTQGTSLESYMTLVLDSIRQIVTSRTSA-------EATKLLQLFQ 449

Query: 663 ALVSNVSMASVD-----MQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIK 714
           ++   +   S +      + +  +++ +L D +Q+ ++ +RA+ E  +   + EE+K
Sbjct: 450 SIFKYLIEHSYEDEELGTEIALQASLNKLMDDLQSKQVNQRAVQELEEMKVKMEEMK 506

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  294 bits (752), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 159/464 (34%), Positives = 272/464 (58%), Gaps = 24/464 (5%)

Query: 1341 KLKQLHWEKIDDAEDSIWRDAKAEKFADD-LYEKGVLSRLEKAFAAREIXXXX---XXXX 1396
            KL+Q+HW+ I+D  ++ W + +  K     L E GV   +E+ F  ++            
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1397 XXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVE 1456
                        ++QQFGINLHM+S+ +V E+V K+L C+ + +   SV++F +K+++  
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1457 VSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMRAL 1516
            +S ++ +NF PY+      ++V   + P KD +EL+RADR++LEL  NL++YW +RMR L
Sbjct: 979  ISQSVKKNFEPYS------TNVLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMRCL 1032

Query: 1517 KVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLA 1576
             ++ TYEKDY D+++KL  ID AT +I+ S+ L+ +L +I+ +GN+MN+  +QA+G +L+
Sbjct: 1033 LILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIKLS 1090

Query: 1577 TLQRLTFIK-DDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCRE 1635
            +L +L F+K    N+M+FL+Y+E+I+R  Y +    + +L  +    K++++QV  DCRE
Sbjct: 1091 SLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDCRE 1150

Query: 1636 FSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDN 1695
            F++ + N+ERS   G+LS    FHP D ++ K    +P A++K  LLMD+ KLT+ + + 
Sbjct: 1151 FNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDLEK 1210

Query: 1696 LMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXXXXXXXXXXXXVEDQLKRT 1755
            LM   GE+  D  A+N+FF+ F DF+  +KKA   N                + +Q K+ 
Sbjct: 1211 LMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAAREN--------IEKEEVERIYEQRKKL 1262

Query: 1756 RESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPAKS 1799
             E + ++ G  ++      +E  E+ D +D L+ KL+     K+
Sbjct: 1263 LEIKERSCGNMESQNS---DESAENNDTVDVLIHKLRGVTFEKT 1303

 Score = 57.4 bits (137), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/285 (21%), Positives = 129/285 (45%), Gaps = 28/285 (9%)

Query: 479 DGDG-DRVMRKFE----QWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTL 533
           D DG D+V+ + E    QW   +E  +       S++           +  + +Y   TL
Sbjct: 269 DHDGRDKVVEQLEPYYSQWFSSIETAISSPK---SMLTQDTSVILPKPQQQLTDYCLSTL 325

Query: 534 LLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDA 593
            LIN + Q     +++ +L  + K  G+ R+  K K      +D+++ ++ +   +    
Sbjct: 326 FLINSIIQVTTSYREKELLIKKFKECGIHRMFYKTKDFGSGLLDDEIRKYKEVEEEVITR 385

Query: 594 LYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLL-ISTGELGSKNKDDPT 652
              +  T   +      S+ + L    + T  E  L  LL+ +L IS     S++     
Sbjct: 386 SSPELPTFLDISYG---SILKTLILETRSTPLEHPLYQLLEGVLQISVTRTSSES----- 437

Query: 653 QRTKQLKLIDALVSNVSMASVDM------QSSFNSAIQRLYDAMQTDEIARRAILENRDW 706
              K  KL  +++  +   + D       +S+  +++ ++ D++Q+DEIARRA+ E    
Sbjct: 438 --IKLFKLFHSILCYLKDHTFDSDSGEGPESALKTSLNQMMDSLQSDEIARRAMKELNSL 495

Query: 707 VKRYEEIKADRDNLKEKLSNAEGGLVGQLQ---DEVRQRDHILEK 748
            +  +++ A+ ++LKE+    +G ++ QL+   + +R +D  L++
Sbjct: 496 QETVDQLTAEVESLKEERKVTKGEVIMQLEEARESLRDKDETLKQ 540

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  292 bits (747), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 152/397 (38%), Positives = 228/397 (57%), Gaps = 14/397 (3%)

Query: 1337 RPSKKLKQLHWEKIDDAEDSIWRD-AKAEKFADDLYEKGVLSRLEKAFAAREIXXXXXXX 1395
            +P + LKQ+HWEKIDD E ++W D  + E+   +L   G+  +++  F  +         
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1396 XXXXXXXXXXXXXVS----QQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSK 1451
                         +S    QQFGINLHMYS   VEE V K+LRCD D L   SV++F + 
Sbjct: 908  DNSTKKTTQLKSFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFFNN 967

Query: 1452 QEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSS 1511
            +E+  +  +L+R+FAPY+ D++     EN K P  DP EL+R DR++LEL  NL++YW  
Sbjct: 968  EELTNIPASLSRSFAPYSADFQ-----EN-KSPTVDPNELERPDRIFLELCYNLRSYWRE 1021

Query: 1512 RMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1571
            R + L +  TYE+DY DLV+KL  ID A   I+ +  L+ +L +I+ +GN+MN   K   
Sbjct: 1022 RSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKNVS 1079

Query: 1572 GFRLATLQRLTFIKDD-KNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVA 1630
            G RL +L +L+F+K    N+++FL+++EK++R  YP+   F  +L    A   IS + + 
Sbjct: 1080 GIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDHIQ 1139

Query: 1631 QDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTL 1690
             +C E+   V +V R    G LS  +  HP D ++ KV   +  A+ K  LL D+ KL  
Sbjct: 1140 SECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKLIS 1199

Query: 1691 LEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKA 1727
             + D LM+ FGE+ MDK A+NSFF  F +F + +KK 
Sbjct: 1200 ADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKC 1236

 Score = 58.5 bits (140), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 100/416 (24%), Positives = 177/416 (42%), Gaps = 71/416 (17%)

Query: 317 AKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYF 376
           ++ L+ L   LR E   + + FL+     A+A+     C+R  P+N         +F Y 
Sbjct: 228 SRVLHQLEKQLRHE--SFCKTFLDENHITALADC----CHRIQPNN---------QFVYL 272

Query: 377 KCLKTSLNLREGADEAV-MSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHG 435
           +C KT +N  EG    +  S+      S + +    L++  R ++ ELL+ L+      G
Sbjct: 273 RCFKTIMNYAEGRQFILNCSHLVDYFCSLLNDKYTYLKI--RTLSCELLLLLTYVDDQLG 330

Query: 436 FNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLV 495
           +  V++            HL  RL +     +    S   P  + D +++          
Sbjct: 331 YEKVLN------------HLSPRLKSWLQQVNISLSSKTDPILNSDMEKL---------- 368

Query: 496 VEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRAR 555
             YT D           S   + +  E   +++A  TL LIN + Q   D +++  L  R
Sbjct: 369 --YTQDN----------SFFLQFTNTEQLRIDFASTTLFLINSILQALTDKQRKLQLVKR 416

Query: 556 LKNAGLPRILNKMK-LLNYEKVDEQLARFDDSTTDDFDALYSQESTGE---GVDMKDPVS 611
           LK  G+ R    MK  L  E +DEQ+  + ++          + S  +   G  ++  V+
Sbjct: 417 LKENGIHRCFYLMKDNLKNEIIDEQIEIYINTEHVLIAQFADKPSLADLFYGNALESIVA 476

Query: 612 MTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLI-DALVSNV-S 669
            T+N       T  EQ   +L+Q++   +  L SK   +  +  K L ++   L SN+ +
Sbjct: 477 NTKN-------TSLEQPFGTLIQSI---SEMLKSKTTSESVKVLKALIIMFQFLESNLYN 526

Query: 670 MASVDMQSSFNSAIQRLYDAMQTDEIARRAILEN---RDWVKRYEEIKADRDNLKE 722
               D +S F  +I  L D +++DEIA+RA+ E    +D V+  +E K   + L++
Sbjct: 527 NMEFDPESVFQDSINTLVDNLESDEIAKRAMGEINFLQDAVRSLQEEKGQLEKLRD 582

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  289 bits (740), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 161/479 (33%), Positives = 268/479 (55%), Gaps = 31/479 (6%)

Query: 1332 FDRYPRPS-KKLKQLHWEKIDDAEDSIWRDAKAEK-FADDLYEKGVLSRLEKAF---AAR 1386
            F   P+P  K LKQ+HW+KI+D  D++W +        +DL EKGV + +   F   A R
Sbjct: 792  FVSKPKPEVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLFEQKAVR 851

Query: 1387 EIXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVI 1446
                                  ++QQFGINLHM+SS SVE+++ K+LRCD D +   SV+
Sbjct: 852  MKKKSNVTASKKNEKVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSVL 911

Query: 1447 DFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQ 1506
            +F +K +   +  ++ R+F PY  DW+        K P++D ++L+RADR+YLE+F N++
Sbjct: 912  EFFNKDDFETIPQSIIRSFEPYASDWK------TGKAPKEDVSKLERADRIYLEMFYNMR 965

Query: 1507 TYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDS 1566
             YW  R  +L +  TYEKDY D++++L  ID  T  I+ S  L+    +++ +GNFMN+ 
Sbjct: 966  YYWKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNN- 1024

Query: 1567 SKQAQGFRLATLQRLTFIK--DDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKI 1624
             K+ QG +L++L +L+ +K   DKN ++FL+ +E+IIRE YP+  DF ++L  +    KI
Sbjct: 1025 -KKTQGIKLSSLNKLSMVKTNSDKN-LSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKI 1082

Query: 1625 SIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMD 1684
            +IE +  +  E+ + ++ ++ S + G LS   K HP D+   K+   LP A +K +LL +
Sbjct: 1083 NIESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHN 1142

Query: 1685 EMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXXXXXXXXX 1744
            + KLT+ +F++ M+  GED  +  A+N+FF+ F++FL  + K    N             
Sbjct: 1143 QCKLTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQ- 1201

Query: 1745 XXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPAKSDPSS 1803
                  QL +   +E++ + + D          +E  D +D L++KL++  P ++ P S
Sbjct: 1202 ----RQQLLQKASTETQVEKSAD----------DEAADTIDILIKKLRSVDPQQTIPGS 1246

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  283 bits (724), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/400 (37%), Positives = 238/400 (59%), Gaps = 12/400 (3%)

Query: 1332 FDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKA-EKFADDLYEKGVLSRLEKAF--AAREI 1388
             +R  + S++LKQ+HW+KI+D +++IW + +     A  L E G+L  +   F       
Sbjct: 911  MERKEQDSQRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAP 970

Query: 1389 XXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDF 1448
                                ++QQFGINLHM+S+LSVE+ V K+L CDR  ++  SV++F
Sbjct: 971  TKANTGRLNEEGPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLEF 1030

Query: 1449 LSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTY 1508
             ++ ++V + ++L+  F PY+ D+         K P KD ++L+RADR++L L  NL++Y
Sbjct: 1031 FARDDLVNIPHSLSLKFEPYSSDFRL------GKGPLKDSSKLERADRIFLALCYNLRSY 1084

Query: 1509 WSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSK 1568
            W  R   L  + TYEKDY D+++KL  +D A   I+ S  L++ L +I+ +GN+MN   K
Sbjct: 1085 WRQRSICLLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--RK 1142

Query: 1569 QAQGFRLATLQRLTFIKDDKN-SMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIE 1627
            QA G +L++LQ+L F+K  K+ +++FL+ VE+ +R        F+ EL  V+    + + 
Sbjct: 1143 QAPGIKLSSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVVG 1202

Query: 1628 QVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMK 1687
            QV QD +E+ + +  V++S+D G LSD   FHP DR+L+KV P +  A +K  LL ++ K
Sbjct: 1203 QVEQDFQEYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQFK 1262

Query: 1688 LTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKA 1727
            LT+   +NLMRL+GED      RN FF  F  F++++KKA
Sbjct: 1263 LTMRALENLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKA 1302

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 130/296 (43%), Gaps = 38/296 (12%)

Query: 483 DRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQT 542
           +R+  ++ QW   VE+ L    +  S    S     +  +  + +Y   +L LIN + Q 
Sbjct: 307 ERLNYQYSQWFQFVEHLLTHGDQDCS---NSLMLPAARPQQMLRDYCLTSLFLINSILQI 363

Query: 543 PVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGE 602
              V ++     RLK   + R+   M  L + ++D ++        D + +L  +E   +
Sbjct: 364 TSSVAEKLAYFKRLKELNIHRLFQLMHQLEHHEIDGEI--------DKYKSL--EEEVIQ 413

Query: 603 GVDMKDP----VSMTQNLWNLCKGTDA---EQHLTSLLQNLLISTGELGSKNKDDPTQRT 655
             + + P    VS  + L N+   T     E  +  L + L   +  L ++   D     
Sbjct: 414 KTNPEFPQLLNVSYGKFLTNIIHQTHQNPLEHCMHQLFETL---SKTLVARTMSD---NL 467

Query: 656 KQLKLIDALVSNVSMAS-----VDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRY 710
           K L L  +++  +   S     +++ S  N ++  L D +Q+DEIA+RA+ E     K  
Sbjct: 468 KVLTLFHSVIDYLKEYSYGEENINIDSVVNISLNHLVDGLQSDEIAKRAMSELELAQKEI 527

Query: 711 EEIKADRDNLKEKLSNAEGGLVGQL---QDEVRQRDHILEKSQ----RVNAQLQHE 759
           E ++++   L++     +GG++ +L   Q  + +++  +EK +    R N Q +HE
Sbjct: 528 ENLESEIRALRKDKEITKGGVLSELRQTQQALAEKETAIEKLEKELKRCNDQRKHE 583

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  278 bits (712), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 156/462 (33%), Positives = 253/462 (54%), Gaps = 29/462 (6%)

Query: 1337 RPSKKLKQLHWEKIDDAEDSIWRDA-KAEKFADDLYEKGVLSRLEKAFAAREIXXXXXXX 1395
            +P + LKQ+HWEK++D E+++W D  + ++   +L   G+ S++E++F  +E        
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1396 XXXXXXXXXXXXX---VSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQ 1452
                            V+QQFGINLHM+S  S E+ V K+L+CD + +   + ++F +++
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1453 EIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSR 1512
            ++V V+ +L R F PY+ D+       +   P KDP EL R DR++LEL  NLQ YW  R
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYL------SEDGPSKDPAELDRPDRIFLELCYNLQYYWYER 971

Query: 1513 MRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQG 1572
               L  +TTYE+DY D +++L  ID     ++     +++L +I+ +GN+MN   + A+G
Sbjct: 972  SFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAEG 1029

Query: 1573 FRLATLQRLTFIKD--DKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVA 1630
             +L++L +L F+K   DKN+ +FL+++E+IIR  YP+   F  +L  V    KIS++ + 
Sbjct: 1030 IKLSSLNKLAFVKSSVDKNT-SFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLE 1088

Query: 1631 QDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTL 1690
            Q+C EF   +  V  ++  G LSD ++ HP D ++ K+   +  A+ K DLL D+ KL  
Sbjct: 1089 QECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLIN 1148

Query: 1691 LEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXXXXXXXXXXXXVED 1750
            ++   LM  FGED  D  A+NSFF+ F +F + +KK    N                +E 
Sbjct: 1149 IDLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLES 1208

Query: 1751 QLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLK 1792
               R R + + N   +D  G        ED D +D LL KL+
Sbjct: 1209 ---RQRTASNHN---SDLQG--------EDEDAVDVLLAKLR 1236

 Score = 53.1 bits (126), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 93/433 (21%), Positives = 176/433 (40%), Gaps = 85/433 (19%)

Query: 304 DYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDNL 363
           DY +++   +   +K L+ L   LRT  +D+ + FLE           +K  ++ S  +L
Sbjct: 167 DYLIKRKTTD--HSKLLHQLEKYLRT--VDFTEEFLERDN--------VKGLFQNS--SL 212

Query: 364 LGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASEL 423
           +G    D  + Y +C KT +N ++G  + +      +    ++   ++ R+  + V++E+
Sbjct: 213 IGP---DDFYVYLRCFKTLMNHKQGRLQILNKPPLLMFFCKLLNDDVT-RLKCKVVSAEM 268

Query: 424 LISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDGD 483
           L+ L+     +G+  V+  L                               +P       
Sbjct: 269 LLMLTYVDEDYGYEKVLHHL-------------------------------SPC------ 291

Query: 484 RVMRKFEQWMLVVEYTLD---GRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLC 540
                F+ W   +  TL       +  S +G  +       E    ++   +LL++N + 
Sbjct: 292 -----FQGWFNYMAKTLSRDPSEFRDASFLGGLK------PEKCRADFMTTSLLVVNSIL 340

Query: 541 QTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQEST 600
           Q      Q+  L   LK  G+    + +K L  +  D+Q+A + +  T+  +A     S 
Sbjct: 341 QALPTKDQKVSLMQTLKECGIHHCFHLIKQLQVDDTDKQIAIYLELETELIEA----TSA 396

Query: 601 GEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQL-K 659
            + +D          L +  KGT  EQ L  L ++L      L ++   +  +  + L  
Sbjct: 397 ADQIDDSVYQPALHYLLSRTKGTLIEQDLAHLFESL---NKILATRTTSESIKLFRSLGS 453

Query: 660 LIDALVSNVSMA-SVDMQSSFNSAIQRLYDAMQTDEIARRAI-----LENRDWVKRYE-- 711
           ++D L+ N   A S +  S    +I +  D ++++EI RRA+     LEN   V R E  
Sbjct: 454 ILDYLIDNFCQAVSTEPASLVQESINKFLDNLESEEIGRRAMKEMTELENTIVVLRKELS 513

Query: 712 EIKADRDNLKEKL 724
           E++  +D  KEKL
Sbjct: 514 ELRDFKDISKEKL 526

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  277 bits (708), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 159/474 (33%), Positives = 258/474 (54%), Gaps = 13/474 (2%)

Query: 1337 RPSKKLKQLHWEKIDDAEDSIWRDAKAEK-FADDLYEKGVLSRLEKAFAAREIXXXXXXX 1395
            +P KKLKQ+HW+K++D ED+IW + +  +     L   GVL  +E  F  +E        
Sbjct: 867  KPVKKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKS 926

Query: 1396 XXXXXXXXXXXXX-----VSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLS 1450
                              ++Q FGINLHM+S+LSV+E V K+L CD D +    V++F +
Sbjct: 927  CATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFN 986

Query: 1451 KQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWS 1510
            ++E+  +S++  R +APY + +       N    E  P  L+R D ++L+L   L+ YWS
Sbjct: 987  REELGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLPP-LERGDEIFLKLCYVLRDYWS 1045

Query: 1511 SRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQA 1570
             R   L V+ TYEKDY D+V+KL  ++ A   +++S  L+N L +I+ +GN+MN  +K A
Sbjct: 1046 VRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKAA 1103

Query: 1571 QGFRLATLQRLTFIK--DDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQ 1628
             G ++++L +L FIK  D+KN ++FL+Y+E++IR  YP+   F+ +L+ V    K++++Q
Sbjct: 1104 SGVKISSLNKLVFIKSSDNKN-LSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQ 1162

Query: 1629 VAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKL 1688
            +  +C E+   +  +  +V  G LSDP K +P D VL K+      A  K  LL  +MKL
Sbjct: 1163 LELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKL 1222

Query: 1689 TLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXXXXXXXXXXXXV 1748
            +  + + LM+ +GED  D   +N FF  FA+FL  +KK    N                +
Sbjct: 1223 SSNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLL 1282

Query: 1749 ED-QLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPAKSDP 1801
            ED Q  R++  +  +     AGG+   +E  ++ D +D+LL+KL+        P
Sbjct: 1283 EDKQSSRSKSGKGNSAAADAAGGNEDDDENEDEEDAVDKLLDKLREVAKPVGKP 1336

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  274 bits (701), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 149/462 (32%), Positives = 252/462 (54%), Gaps = 24/462 (5%)

Query: 1337 RPSKKLKQLHWEKIDDAEDSIWRDAKAEK-FADDLYEKGVLSRLEKAFAAREIXXXXXXX 1395
            +  KKLKQ+HW ++++  ++IW+D   ++    +L   GV  R++ +F  +++       
Sbjct: 1138 KEDKKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKKNTD 1197

Query: 1396 XXXXXXXXXXXXXVS----QQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSK 1451
                         +S    QQFGINLH+++S  V E++ K+LRCD D     ++++F +K
Sbjct: 1198 EAKTKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEFFNK 1257

Query: 1452 QEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSS 1511
            +E   +S ++ARN+APY +D++            KD +EL+RADR++LELF NL+ YW+ 
Sbjct: 1258 EEFTHISGSVARNYAPYGVDYQT------NNEATKDASELERADRIFLELFYNLRAYWAE 1311

Query: 1512 RMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1571
            R + L ++ TYEKDY DL+ KL  ID A   +  S   +  L ++L +GNFMN   K A+
Sbjct: 1312 RSQCLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN--KKPAE 1369

Query: 1572 GFRLATLQRLTFIKD-DKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVA 1630
            G  +++L +L FIK  + N+++FL+++EK IR  +PE   F+ +L  V     +S++ + 
Sbjct: 1370 GILISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLDHIT 1429

Query: 1631 QDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTL 1690
             +C+EF   V     +V  G LS P   HP D++L KV   + +A+ K + L D+  LT 
Sbjct: 1430 MECKEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQILTN 1489

Query: 1691 LEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXXXXXXXXXXXXVED 1750
                 +++ +GED  D+ +++ FFK  A+F   +KK    N                +++
Sbjct: 1490 HSIVKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYMLDN 1549

Query: 1751 QLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLK 1792
            +L++   S          G DS   +  E+ D +D+LL KL+
Sbjct: 1550 KLQKNNSS----------GDDSDLEKNTENDDAVDKLLLKLR 1581

 Score = 42.0 bits (97), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 123/265 (46%), Gaps = 28/265 (10%)

Query: 527 EYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDS 586
           EY+ ++L L+N + +   +++++  +   LK  G+ +I   MK+L  ++ ++++    +S
Sbjct: 386 EYSTVSLFLLNSIMEVLPNIERKYKIINGLKEFGIHQIFYLMKILCTDE-EQEIEIISNS 444

Query: 587 TTDDFDALYSQESTGEGVDMKDPVSMT---------------QNLWNLCKGTDAEQHLTS 631
            T     L  Q +    ++    +S++               Q L +  + T  E+ +  
Sbjct: 445 NTFSKTVLSEQINLYSKIEQDVIMSISHHKPMFVDISFGNELQLLVSQVQKTPLEKPIGD 504

Query: 632 LLQNL--LISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSFN--------S 681
           LL  L  LI++       K   T  +    LI++L SN ++  +D    F+        S
Sbjct: 505 LLTTLIKLITSRTQSESLKVMKTFESMLAYLINSLFSNSNIHMLDRDDDFDISPELVVQS 564

Query: 682 AIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQ 741
           +I  L D + +DEIA+RA+ E         ++K++ ++LKE+     G L+ +LQ+   Q
Sbjct: 565 SINDLMDRLHSDEIAKRAMDEMTGLEHNLIKLKSELESLKEERHADTGELIKELQETNLQ 624

Query: 742 RDHILEKSQRVNAQLQHELDESKKK 766
            + +  + + +   LQ  L E K+K
Sbjct: 625 NEKLHLELKGMQKMLQ--LSEEKRK 647

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  269 bits (688), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 141/391 (36%), Positives = 235/391 (60%), Gaps = 12/391 (3%)

Query: 1341 KLKQLHWEKIDDAEDSIW-RDAKAEKFADDLYEKGVLSRLEKAFAAREIXXXXXXXXXXX 1399
            KLKQ+HW+K++D  ++IW ++ + +  A  L   G L  + + F   +            
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELFRVNQSLPIKAKSETSS 979

Query: 1400 XXXXXXX--XXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVEV 1457
                       ++QQFGINLHM+S+LSV+E V+K+L CDRD ++  SV++F +++++  +
Sbjct: 980  GKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLSII 1039

Query: 1458 SNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMRALK 1517
              ++A    PY  D +        + P  D  +L+RADR++LEL  NL++YW  R   L 
Sbjct: 1040 PRSIASKLEPYATDHQP------NEAPLLDREKLERADRIFLELCYNLRSYWRPRSLCLL 1093

Query: 1518 VITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLAT 1577
             ++TYEKDY DL++KL  +D A   I+ S  L++ L +I+ +GN+MN   KQA G RL++
Sbjct: 1094 TLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRLSS 1151

Query: 1578 LQRLTFIKDDKN-SMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCREF 1636
            LQ+LTF+K  K+ +M+ L+ VE+ +R        F+++L  V+    + + Q+ QD  E+
Sbjct: 1152 LQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFHEY 1211

Query: 1637 SQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDNL 1696
            +Q +  V++S++ G LS P  FHP DR+L+KV P +  A +K  LL ++  LT+   +NL
Sbjct: 1212 TQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALENL 1271

Query: 1697 MRLFGEDAMDKFARNSFFKKFADFLLEYKKA 1727
            M+L+GED  +  ++N FF+ F +F+ ++KK 
Sbjct: 1272 MKLYGEDPSNIDSKNEFFQHFINFVSQFKKV 1302

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  265 bits (678), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 158/484 (32%), Positives = 255/484 (52%), Gaps = 44/484 (9%)

Query: 1336 PRPS-KKLKQLHWEKIDDAEDSIWRDA-KAEKFADDLYEKGVLSRLEKAFAARE------ 1387
            P P+ K+LKQ+HW+K++D +D++W D  + ++    L   G+ S++E  F  +       
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRGLQTDGIFSQIEDIFKMKSPTKIAN 929

Query: 1388 ---------IXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRD 1438
                     +                    ++QQFGINLHM+S LS  E V K+L+CD D
Sbjct: 930  KTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDND 989

Query: 1439 FLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLY 1498
             +   +++ F  K+E+V +  +L   + PY       S  EN K      ++LQRADR++
Sbjct: 990  IVQNVNILKFFCKEELVNIPKSLLNKYEPY-------SRGENGKAA----SDLQRADRIF 1038

Query: 1499 LELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILA 1558
            LEL +NL+ YW+ R ++L  ++TYE+DY DL+ KL  ID     + +S+  +N++ +I  
Sbjct: 1039 LELCINLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIITE 1098

Query: 1559 VGNFMNDSSKQAQGFRLATLQRLTFIKDDKN-SMTFLNYVEKIIRETYPEFNDFLKELEP 1617
            +GN MN   +  +G +L +L +L F++   + +M+FL+++EKIIR  YP+   F+ +L+ 
Sbjct: 1099 IGNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLKK 1156

Query: 1618 VVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARK 1677
            V    KIS+E +  +C EF   + N+      G LS+     P D+++ KV   +  AR 
Sbjct: 1157 VEDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRARI 1216

Query: 1678 KGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXX 1737
            K +LLMD+ KLTL++ + LMR +GED  DK ++N FF+ F +FL  +KK    N      
Sbjct: 1217 KSELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKEN------ 1270

Query: 1738 XXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPA 1797
                      V +Q K   E  +      D   ++   EVN   D +D L+ KL+     
Sbjct: 1271 --IEKEEMERVYEQRKNLLEMRTNGNKKCDGNDENEGEEVNT--DAVDLLISKLR---EV 1323

Query: 1798 KSDP 1801
            K DP
Sbjct: 1324 KKDP 1327

 Score = 41.2 bits (95), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 63/126 (50%), Gaps = 8/126 (6%)

Query: 677 SSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQ 736
           S F  ++ +L D++Q+DEIARRA+ E  D  K+         +L EKL   E      L 
Sbjct: 506 SVFQDSVNKLLDSLQSDEIARRAVTEIDDLNKKIS-------HLNEKLDLVENCSKDHLI 558

Query: 737 DEVRQRDHILEKSQRVNAQLQHELDESKKKL-ILAKHEHEVELRKTLTAMNSNFEGSHNM 795
            ++ + + ++    +    L+ +L  +KKKL  +  H+   +   +LT+ N +  GS  +
Sbjct: 559 KKLDESEALISLKTKEIENLKVQLKTNKKKLDQITTHQRLYDQPASLTSSNVSVNGSTTI 618

Query: 796 RDEKGS 801
            + +G+
Sbjct: 619 NNSQGN 624

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  266 bits (679), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 153/463 (33%), Positives = 256/463 (55%), Gaps = 28/463 (6%)

Query: 1336 PRPSKKLKQLHWEKIDDAEDSIWR-DAKAEKFADDLYEKGVLSRLEKAFAAREIXXXXXX 1394
            P+  K LKQ+HW+K+++ +++IW+ + +  +   +L    + +++E +F  +E+      
Sbjct: 995  PQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKKSK 1054

Query: 1395 XXXXXXXXXXXXXX---VSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSK 1451
                             ++QQFGINLHMYS+ + +E +  +L C  + +   SV++F  K
Sbjct: 1055 TEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFFCK 1114

Query: 1452 QEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSS 1511
            ++++ +  +++RN+APY+ D+         + P KD +EL+RAD+L+LEL  NL+ YW+ 
Sbjct: 1115 EDLINIPGSISRNYAPYSRDYLS------GEEPVKDSSELERADKLFLELCYNLRYYWAD 1168

Query: 1512 RMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1571
            R + L ++ TYE+DY DLV KL  ID A   +  S+  R+ L ++L +GN+MN   K  +
Sbjct: 1169 RSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKTVE 1226

Query: 1572 GFRLATLQRLTFIKDD-KNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVA 1630
            G ++++L +L FIK    N+++FL+++EK+IR  YPE   F+ +L  V    K+++E + 
Sbjct: 1227 GVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEHIG 1286

Query: 1631 QDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTL 1690
             +C EF   V +V  SV  G LS   K HP+D +L KV   +  A+ K +LL D+  LT 
Sbjct: 1287 TECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNLTK 1346

Query: 1691 LEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXXXXXXXXXXXXVED 1750
             +   L+  +GED  DK + +SFF    +FL  +KK    N                V +
Sbjct: 1347 HDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKEN--------IEREESERVYE 1398

Query: 1751 QLKRTRESESKNKGTTDAGGDSVRNEVNEDR-DVMDRLLEKLK 1792
            Q K   ES+SK +      GD +  E ++   D +D LL KL+
Sbjct: 1399 QRKNMLESQSKKE------GDGINEEDDKSTSDAVDLLLSKLR 1435

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 103/223 (46%), Gaps = 14/223 (6%)

Query: 520 GGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQ 579
           G +  I EY    L LIN + Q   + +++  L   LK  G+  I + +K L    + EQ
Sbjct: 350 GFDKLIEEYLTTCLFLINSILQVVPNFERKYKLIENLKEFGIHHIFHLLKDLASTVIKEQ 409

Query: 580 LARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLIS 639
           ++ +     D   ++ +  S    V   + + +   L +  + T  EQ +  LL  L   
Sbjct: 410 ISIYSKIEQDIILSISNNNSMFIDVSYGNEIQL---LLSQSQKTPLEQPIGELLNFL--- 463

Query: 640 TGELGSKNKDDPTQRTKQL-----KLIDALVS-NVSMASVDMQSSFNSAIQRLYDAMQTD 693
              L S+ + +  +  K        L+D     N ++ S   +S+  ++I  L D +Q+D
Sbjct: 464 NKILTSRTQSESMKLFKSFGSTLGYLLDHFYKDNDTLLSP--ESTVQNSINELMDRLQSD 521

Query: 694 EIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQ 736
           EIARRA+ E +   +  + ++++  +LKE+    +G L+ QL+
Sbjct: 522 EIARRAMNEMKSLEQIIDNLQSEISSLKEERQLDKGELIAQLK 564

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  263 bits (671), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 156/484 (32%), Positives = 253/484 (52%), Gaps = 45/484 (9%)

Query: 1336 PRPSKKLKQLHWEKIDDAEDSIWRDA-KAEKFADDLYEKGVLSRLEKAFAARE------- 1387
            P P ++LKQ+HW++++D +D++W DA + ++   +L   GV S++E  F  R        
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1388 --------IXXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDF 1439
                    +                    ++QQFGINLHM+S LS  E V K+L CD D 
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1440 LSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYL 1499
            +   +++ F  K+E+  +  +L   + PY+   EG           K  ++LQRADR++L
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIFL 1039

Query: 1500 ELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAV 1559
            EL +NL++YW+ R + L  ++TYE+DY DL+ KL  ID     +  S   +N++ +I  +
Sbjct: 1040 ELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEI 1099

Query: 1560 GNFMNDSSKQAQGFRLATLQRLTFIKD--DKNSMTFLNYVEKIIRETYPEFNDFLKELEP 1617
            GN MN   K  +G +L +L +L F++   D+N M+FL+++EKIIR  YP+   F+ +L+ 
Sbjct: 1100 GNHMN--KKIVKGIKLKSLTKLAFVRSSVDQN-MSFLHFIEKIIRIKYPDLYGFVDDLKK 1156

Query: 1618 VVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARK 1677
            +    KIS+E +  +C EF   + N+      G LS      P D+++ KV   +  A+ 
Sbjct: 1157 IEDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKI 1216

Query: 1678 KGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXX 1737
            K +LLM + KLTL++ + LM+ +GED  DK ++N FF+ F +FL  +KK    N      
Sbjct: 1217 KSELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKEN------ 1270

Query: 1738 XXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPA 1797
                      V +Q K   E  + N   ++   ++   EVN   D +D L+ KL+     
Sbjct: 1271 --IEKEEMERVYEQRKSLLEMRTNNNKKSNGNDENEGEEVNT--DAVDLLISKLR---EV 1323

Query: 1798 KSDP 1801
            K DP
Sbjct: 1324 KKDP 1327

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  259 bits (663), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 156/510 (30%), Positives = 269/510 (52%), Gaps = 56/510 (10%)

Query: 1321 PSPMLPQ----------SPSLFDRYPRPS-KKLKQLHWEKIDDAEDSIWRDA-KAEKFAD 1368
            P+P LP           +P+  D  P P+ K+LKQ+HW+K++D +D++W D  + ++   
Sbjct: 846  PAPPLPNGLLSSSSVSINPTTTDLKPPPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIK 905

Query: 1369 DLYEKGVLSRLEKAFAARE---------------IXXXXXXXXXXXXXXXXXXXXVSQQF 1413
            +L   G+ S++E  F  +                +                    ++QQF
Sbjct: 906  ELQTDGIFSQIEDIFKMKSPTKIANKRNAESSIALSSNNGKSSNELKKISFLSRDLAQQF 965

Query: 1414 GINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWE 1473
            GINLHM+S LS  E V K+L CD D +   +++ F  K+E+V +  ++   + PY+   +
Sbjct: 966  GINLHMFSQLSDMEFVMKVLNCDNDIVQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKD 1025

Query: 1474 GVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKL 1533
            G           K  ++LQRADR++LEL +NL+ YW++R ++L  ++TYE+DY DL+ KL
Sbjct: 1026 G-----------KAVSDLQRADRIFLELCINLRFYWNARSKSLLTLSTYERDYYDLIFKL 1074

Query: 1534 SMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLATLQRLTFIKD--DKNSM 1591
              ID A   + +S   ++++ +I  +GN MN   +  +G +L +L +L F++   D+N +
Sbjct: 1075 QKIDDAISHLNRSPKFKSLMFIITEIGNHMN--KRIVKGIKLKSLTKLAFVRSSIDQN-V 1131

Query: 1592 TFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGN 1651
            +FL+++EK+IR  YP+   F+ +L+ +    KIS+E V  +C EF + + ++     +G 
Sbjct: 1132 SFLHFIEKVIRIKYPDIYGFVDDLKNIEDLGKISLEHVESECHEFHKKIEDLVTQFQVGK 1191

Query: 1652 LSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARN 1711
            LS      P D+++ KV   +  A+ K +LL+ + KLTL++ + LM+ +GED  DK ++N
Sbjct: 1192 LSKEENLDPRDQIIKKVKFKINRAKTKSELLIGQCKLTLIDLNKLMKYYGEDPKDKESKN 1251

Query: 1712 SFFKKFADFLLEYKKAQVYNXXXXXXXXXXXXXXXXVEDQLKRTRESESKNKGTTDAGGD 1771
             FF+ F +FL  +KK    N                ++    RT  S  K+ G+ +  G+
Sbjct: 1252 EFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRKSLLD---MRT-SSNKKSNGSDENDGE 1307

Query: 1772 SVRNEVNEDRDVMDRLLEKLKNAGPAKSDP 1801
             V      +RD +D L+ KL+     K DP
Sbjct: 1308 KV------NRDAVDLLISKLRE---VKKDP 1328

 Score = 35.4 bits (80), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 58/115 (50%), Gaps = 8/115 (6%)

Query: 679 FNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDE 738
           F  ++ +L D++Q+DEIARRA+ E        +++ A   +L EKL+  E      L  +
Sbjct: 508 FQDSVNKLLDSLQSDEIARRAVTE-------IDDLNAKISHLNEKLNLVENHDKDHLIAK 560

Query: 739 VRQRDHILEKSQRVNAQLQHELDESKKKL-ILAKHEHEVELRKTLTAMNSNFEGS 792
           + + + ++    +    L+ +L  +KK+L  +  H+   +   +L + N +  GS
Sbjct: 561 LDESESLISLKTKEIENLKLQLKATKKRLDQITTHQRLYDQPPSLASSNLSIAGS 615

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  259 bits (662), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 138/393 (35%), Positives = 227/393 (57%), Gaps = 12/393 (3%)

Query: 1340 KKLKQLHWEKIDDAEDSIWRDAKAEK-FADDLYEKGVLSRLEKAFAAREIXXX---XXXX 1395
            KKLKQ+HW+KI++ ++++W  A   +    +L   G+  +++  F+ +++          
Sbjct: 857  KKLKQIHWDKIENVKNTLWDHADGRQDTILELEHAGIFEKVQGMFSVQDLVVKPKRAVNV 916

Query: 1396 XXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIV 1455
                          SQQ  INLH+++ L+ +EV+ K+L CD D +   SV++F  K E+V
Sbjct: 917  RESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFFCKDEMV 976

Query: 1456 EVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMRA 1515
             + +   R+F PY+ D+   S     + P K+P EL+RAD+L+L L  NL+ YW+ R + 
Sbjct: 977  NIGSARIRHFTPYSADYLNAS-----EQPAKNPDELERADKLFLYLPFNLRRYWAERSQC 1031

Query: 1516 LKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRL 1575
            L VI+TYE++Y D+++ L  ID A  +I+ SE  +  L +I+ +GN+MN  +K  +G RL
Sbjct: 1032 LLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKAVEGIRL 1089

Query: 1576 ATLQRLTFIK-DDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCR 1634
             +L +L FIK +D  + +FL++VEK++R  YP+   F+ +L  V    KI+I+QV   C 
Sbjct: 1090 NSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQVQLQCE 1149

Query: 1635 EFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFD 1694
            E+   +  +  SV  G LSDPT+ HP D++L KV   +  A+ K +LL  + KLT  +F 
Sbjct: 1150 EYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKLTNNDFR 1209

Query: 1695 NLMRLFGEDAMDKFARNSFFKKFADFLLEYKKA 1727
              M  +GED  D   + +FF +F +F   ++K 
Sbjct: 1210 KSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKC 1242

 Score = 42.0 bits (97), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 109/238 (45%), Gaps = 18/238 (7%)

Query: 525 IMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFD 584
           + +Y    L LIN L Q    +  +  +   ++   L +I+   + L+   + EQ+    
Sbjct: 343 LCDYFCSNLFLINSLIQGFPTIPLKATILEEMRKCDLHQIIYLSEKLDSTSIQEQIKEIK 402

Query: 585 DSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLC---KGTDAEQHLTSLLQNLLISTG 641
                  + +YS+      +++ + VS   ++  L    K T  E  L  LL  L   + 
Sbjct: 403 TQE----ETIYSRGYGSNHMNLPE-VSYAPDIELLITKSKDTPVEDSLGKLLATL---SK 454

Query: 642 ELGSKNKDDPTQRTKQLK-LIDALVSNV--SMASVDMQSSFNSAIQRLYDAMQTDEIARR 698
            L SK   +  +  K    L+  L+ N   +  SV  ++ F  A+ +L D++ ++EI +R
Sbjct: 455 ALNSKTYSETIKIYKSTNSLVTYLMDNFQNNQKSVASETLFQEAVTKLMDSLHSNEITKR 514

Query: 699 AILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQL 756
           A+ E ++  K  + +  + D L+E ++N + G V +   E++Q + ++E   R N +L
Sbjct: 515 AMSELKELEKTVQSLNEEIDRLRE-INNMDKGDVLE---ELKQANELIESRDRENEEL 568

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  253 bits (646), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 217/391 (55%), Gaps = 19/391 (4%)

Query: 1341 KLKQLHWEKIDDAEDSIWRD-AKAEKFADDLYEKGVLSRLEKAFAAREIXXXXXXXXXXX 1399
            +LKQ+HWEK++D E ++W D A+ E+ A +L   G+  ++   F  + I           
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKMKKRDTTTAS 911

Query: 1400 XXX--XXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVEV 1457
                       ++QQFGINLHM+SSL  +E V K+L C+ D +S  SV++F +K+E+  +
Sbjct: 912  KKQNGTLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEELTSI 971

Query: 1458 SNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMRALK 1517
              +L + F PY          EN K       EL+RADR++ EL   L +YW  R   L 
Sbjct: 972  PTSLIQKFTPY---------AENIK----SKFELERADRIFFELCFQLHSYWRERSNCLL 1018

Query: 1518 VITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLAT 1577
            ++ TYEKDY DL++KL  +D     +  S   R+ L +I+ +GN+MN   K   G R+ +
Sbjct: 1019 ILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGIRIGS 1076

Query: 1578 LQRLTFIKDD-KNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCREF 1636
            L +L F+K    N+++FL+++EKIIR  YP+   F+ EL  +    K+SI+Q+  D +EF
Sbjct: 1077 LNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYDSQEF 1136

Query: 1637 SQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDNL 1696
               +  +   ++ G LS   +  P D++L K    +  A+ K +L+  ++KL   ++  +
Sbjct: 1137 CSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHDYAKI 1196

Query: 1697 MRLFGEDAMDKFARNSFFKKFADFLLEYKKA 1727
            MR FGEDA D+ ++N+FF    +F+  +KK 
Sbjct: 1197 MRYFGEDASDRDSKNAFFTNIFEFIQVFKKC 1227

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 111/226 (49%), Gaps = 24/226 (10%)

Query: 525 IMEYAYLTLLLINHLCQ-TPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARF 583
           I EY    + LIN + +  P+  ++ +VL  +LK+  LP++  ++  L+ + + EQ+ R+
Sbjct: 323 ITEYLSSCMFLINSIIEGFPLQNEKYSVLE-KLKDVELPKLFFELSALDSKVIQEQIYRY 381

Query: 584 DDSTTDDFDALYSQESTGEGVDMKDPVSM--------TQNLWNLCKGTDAEQHLTSLLQN 635
             +           E+    +  ++P+S+           L    K T  E+ + +LL +
Sbjct: 382 KKN----------DENIRLKIINENPLSIPDISYGATLMLLIEKSKSTPLEEPIGALLDS 431

Query: 636 LL--ISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMA--SVDMQSSFNSAIQRLYDAMQ 691
           +L  + T       K   +  +    L+D L S +S A  +  ++     +I+RL D ++
Sbjct: 432 VLKILDTRTYSESIKLFASVSSLLTYLVDKLDSTISSAENANSLKPVLQDSIERLIDNLE 491

Query: 692 TDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQD 737
           +DE+ARRA+ E R+     +++  +  NLK + ++++  ++ QL++
Sbjct: 492 SDEVARRAMKELRESETVIKDLNTEIHNLKREKNSSKEDILEQLEE 537

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  253 bits (647), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 151/460 (32%), Positives = 249/460 (54%), Gaps = 26/460 (5%)

Query: 1338 PSKKLKQLHWEKIDDAEDSIWRDAKAE-KFADDLYEKGVLSRLEKAFAARE--IXXXXXX 1394
            P+K +KQ+HWEK+     S+W D         +L   G+ S +E  F +++  I      
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPK 1025

Query: 1395 XXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEI 1454
                          ++QQFGINLHM+S +S +++  K+L+CD       SVI+F + +++
Sbjct: 1026 DQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDL 1085

Query: 1455 VEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMR 1514
              + +N+ R F PY+ID++   S      P KD +EL R D ++L L  NL++YW  R +
Sbjct: 1086 TNIPSNICRTFEPYSIDYKTPGS-----KPTKDISELSRVDHIFLLLCYNLRSYWKERSQ 1140

Query: 1515 ALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFR 1574
             L ++ TYEKDY DL+ KL  +D+A  +I+ S+ L++VL +I+A+GNFMN   K   G R
Sbjct: 1141 CLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIR 1198

Query: 1575 LATLQRLTFIKDDKNS-MTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDC 1633
            L++L +LT+IK +  S  +FL+++E++IR  YPE   F  +L  V     ++++ +  + 
Sbjct: 1199 LSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEY 1258

Query: 1634 REFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEF 1693
             + S  +  V RS+  G LS+    HP D +L KV   +  A  K  +L D+  LT ++ 
Sbjct: 1259 DDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNIDL 1318

Query: 1694 DNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNXXXXXXXXXXXXXXXXVEDQLK 1753
            + L+  FGED  D   + +FFK  ++FL  ++K    N                V +Q +
Sbjct: 1319 EKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKEN--------IEKEEADRVYEQRR 1370

Query: 1754 RTRESESKNKGTTDAGGDSVRNEVNED-RDVMDRLLEKLK 1792
            +  +S+        A  DS  +E+ ED +D +D+LL+KL+
Sbjct: 1371 QLLDSK------IQAQWDSSMDEIEEDQQDAVDQLLKKLR 1404

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  247 bits (631), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 130/401 (32%), Positives = 226/401 (56%), Gaps = 28/401 (6%)

Query: 1341 KLKQLHWEKIDDAEDSIWRDA-KAEKFADDLYEKGVLSRLEKAFAARE-----------I 1388
            +LKQ+HW+K+++ +D++W D  + ++   +L   G+ S++E  F  ++            
Sbjct: 881  RLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKNGNS 940

Query: 1389 XXXXXXXXXXXXXXXXXXXXVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDF 1448
                                ++QQFGINLHM+S +S  E V K+L CD + +   +++ F
Sbjct: 941  STSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNILKF 1000

Query: 1449 LSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTY 1508
              K+E+V +  ++   + PY+    G           K  ++LQRADR++LEL +NL++Y
Sbjct: 1001 FCKEELVSIPKSMLSKYEPYSQGKGG-----------KSVSDLQRADRIFLELCINLRSY 1049

Query: 1509 WSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSK 1568
            W++R ++L  ++TYE+DY DL+ KL  ID     + +S   ++++ +I  +GN MN   K
Sbjct: 1050 WNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN--KK 1107

Query: 1569 QAQGFRLATLQRLTFIKD--DKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISI 1626
              +G +L +L +L F++   D+N ++FL+++EK+IR  YP+   F+ +L+ +    K+S+
Sbjct: 1108 MVKGIKLKSLTKLAFVRSSADQN-LSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVSL 1166

Query: 1627 EQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEM 1686
            E V  +CREF   V         G LS+     P D+++ KV   +  A+ K DLL+D+ 
Sbjct: 1167 EHVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQC 1226

Query: 1687 KLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKA 1727
            KLTL++   LM+ +GED  DK ++N FF+ F +FL  +KK 
Sbjct: 1227 KLTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKC 1267

 Score = 44.3 bits (103), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 62/120 (51%), Gaps = 8/120 (6%)

Query: 674 DMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVG 733
           ++ S F  +I +L D++Q+D+IARRA++E        +++      L E++S  E     
Sbjct: 508 NVDSVFQDSIDKLLDSLQSDDIARRAVIE-------IDDLNCKISTLNERISLVENYSKD 560

Query: 734 QLQDEVRQRDHILEKSQRVNAQLQHELDESKKKL-ILAKHEHEVELRKTLTAMNSNFEGS 792
           QL  ++ + + +L    + N  L+ +L E KKKL  +A H+   +   +L   N +  GS
Sbjct: 561 QLLTKLDESEILLSLKTKENENLKLQLKEIKKKLDQIATHQRLYDQPPSLATSNLSVAGS 620

>Skud_16.402 Chr16 (719673..722714) [3042 bp, 1013 aa] {ON} YPR115W
            (REAL)
          Length = 1013

 Score = 38.5 bits (88), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 3/98 (3%)

Query: 1633 CREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLE 1692
            CRE  Q +++   +V+  N       HP+  + LK    LP+ RK  D++   MK  L +
Sbjct: 442  CRELQQGILSRPPAVEWDNF---VTHHPTCLMDLKSNDPLPQPRKVSDIVYPNMKSPLAK 498

Query: 1693 FDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVY 1730
               +  L  +     +   S+F    ++L E+K +  +
Sbjct: 499  CIRVGYLLRKTEHSSYFSRSYFVLTTNYLHEFKSSDFF 536

>NCAS0F01000 Chr6 complement(199877..201046) [1170 bp, 389 aa] {ON}
           Anc_7.115 YIR018W
          Length = 389

 Score = 36.6 bits (83), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 72/143 (50%), Gaps = 19/143 (13%)

Query: 696 ARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQ 755
           + R  ++NRD  + Y E +A++              +  L+D V     +++K QR   +
Sbjct: 101 SERKKIQNRDAQRAYRERRANK--------------LKVLEDAVDSLQQLVKKWQRKYKE 146

Query: 756 LQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDEKGSENPRPLRPERKLAI 815
            + EL + K+ L L+ +E++ +L+++LTA N+    S  ++     E+P P R E ++A 
Sbjct: 147 TEKELQQYKETLELSLNENK-QLKESLTASNNGLVCSICLQP---IEDPSPQRSEVRIAK 202

Query: 816 QKALQAKLEKTSKEINVE-SKRL 837
                 ++EK S E   E +KRL
Sbjct: 203 PSRKTGRVEKVSVENGTEQNKRL 225

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 36.6 bits (83), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query: 625 AEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSFNSAIQ 684
           A QH T       I++G LG+     P+    Q+   DALV +     +D  +SFN ++Q
Sbjct: 494 AAQHWTWKNPRTFITSGGLGTMGYGLPSAIGAQVAKPDALVID-----IDGDASFNMSLQ 548

Query: 685 RLYDAMQTDEIARRAILENRD 705
            L  A+Q +   +  +L N +
Sbjct: 549 ELSSAVQANAPVKILVLNNEE 569

>ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 868

 Score = 36.2 bits (82), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 92/228 (40%), Gaps = 41/228 (17%)

Query: 554 ARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMT 613
           A+L+N   PR  N       EK++ +L    D  TD+ D   S   T E +D +      
Sbjct: 602 AQLRNELKPRSQN-------EKLESELPISRDIFTDNLDDWRSLSQT-ECLDNQLYCGNQ 653

Query: 614 QNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMAS- 672
                LCK  DA   L            EL ++N+ +P  R     L  A+V +++ A  
Sbjct: 654 DEFQMLCKLLDAPSRL-----------DELQAENRLEPDIRQNYAPLEKAIVQSITNACL 702

Query: 673 ---VDMQSSFNSAIQRL--------YDAMQTDEI--ARRAILENRDWVKRYEEIKADRDN 719
              V   SSF S I           +D + TD I   R  IL +  +   Y+++     +
Sbjct: 703 SFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKD 762

Query: 720 LKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRV---NAQLQHELDESK 764
           +K  + N EG   G  +DE      + EK Q V     +  HEL ES+
Sbjct: 763 IKNSVKNGEGKSNGPQEDE-----QLKEKVQEVIKKELERYHELIESQ 805

>Suva_16.443 Chr16 (762629..766081) [3453 bp, 1150 aa] {ON} YPR115W
            (REAL)
          Length = 1150

 Score = 35.8 bits (81), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 42/98 (42%), Gaps = 3/98 (3%)

Query: 1633 CREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLE 1692
            C E  Q +++   +++  N       HP+  + LK    LP+ RK  D++   MK  L +
Sbjct: 443  CHELQQGILSRPPALEWDNF---VTHHPTCLMNLKSNDPLPQPRKLSDIVYPNMKSPLAK 499

Query: 1693 FDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVY 1730
               +  LF      K     +F    ++L E+K +  +
Sbjct: 500  CIRVGYLFKRSEPSKGFTKGYFVLTTNYLHEFKSSDFF 537

>Smik_16.358 Chr16 (632912..636007) [3096 bp, 1031 aa] {ON} YPR115W
            (REAL)
          Length = 1031

 Score = 35.4 bits (80), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 47/101 (46%), Gaps = 9/101 (8%)

Query: 1633 CREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTL-- 1690
            C E  Q +++   +V+  N       HP   + LK   ++P  RK  D++   MK +L  
Sbjct: 443  CHELQQGILSRPPAVEWDNF---VSHHPDCLMNLKSNDSIPHPRKLSDIVYPNMKSSLAK 499

Query: 1691 -LEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVY 1730
             + F  L++    ++  KF +  FF    ++L E+K +  Y
Sbjct: 500  CIRFGYLLK--KTESSKKFIKGFFFLT-TNYLHEFKSSDFY 537

>KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} some
            similarities with Saccharomyces cerevisiae YPR115W
            Hypothetical ORF and to YGR097W uniprot|P48361
            Saccharomyces cerevisiae YGR097W ASK10 Component of the
            RNA polymerase II holoenzyme phosphorylated in response
            to oxidative stress has a role in destruction of Ssn8p
            which relieves repression of stress-response genes
          Length = 1010

 Score = 33.9 bits (76), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 51/253 (20%), Positives = 102/253 (40%), Gaps = 34/253 (13%)

Query: 1506 QTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATC----SIQQSENLRN-VLDVILAVG 1560
            Q   SS+   L++I   E    DL HK+  I +       +IQ+   L   +L   +A  
Sbjct: 268  QQVKSSKEITLQIIPKLEDLRKDLSHKIKEIKELNADFKTNIQEHVALTGQLLHKYIAAV 327

Query: 1561 NFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYV----------EKIIRETYPEFND 1610
            NF+ND++ ++    L  L+R + +K   +       +          E  ++E Y     
Sbjct: 328  NFLNDNASRSD---LIKLKRNSSLKSKHDPYLLKLQLDLQLKRQLLEENYLQEAYINLQS 384

Query: 1611 FLKELEPVV-AAVKISIEQ------------VAQDCREFSQSVINVERSVDIGNLSDPTK 1657
               ELE ++ + ++ ++++            +   CRE  + +++    V+  N      
Sbjct: 385  SGMELEKIIFSTIQKTLQKFSAIIDVQARTSINNLCRELQRGILSKPPCVEWDNF---VS 441

Query: 1658 FHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKF 1717
             HP   +  K    +P+ RK  D+   +MK +L +      L  +    K     +F   
Sbjct: 442  HHPRCLLNWKSTDPIPQPRKLSDIRYPKMKSSLAKCIRAGYLLKKSKYLKQYNKGYFVLT 501

Query: 1718 ADFLLEYKKAQVY 1730
            +++L E+K +  +
Sbjct: 502  SNYLHEFKSSNFF 514

>Kpol_1013.46 s1013 complement(104156..105835) [1680 bp, 559 aa] {ON}
            complement(104156..105835) [1680 nt, 560 aa]
          Length = 559

 Score = 33.1 bits (74), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1919 NDSSSSGSENRLNFVGAGQAENSDEQNEPEVLKSKPESANDDDNGEQSDSSDGEFL 1974
            NDS +SGSEN  + V  G    SD+  EP   K +   ++ DD  E SDSS+GE +
Sbjct: 445  NDSGASGSENDSSDVWEGLENGSDD--EPVQEKDETSGSDMDDIDEGSDSSEGELI 498

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.127    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 188,768,265
Number of extensions: 8112327
Number of successful extensions: 34979
Number of sequences better than 10.0: 583
Number of HSP's gapped: 35564
Number of HSP's successfully gapped: 843
Length of query: 1976
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1851
Effective length of database: 39,148,149
Effective search space: 72463223799
Effective search space used: 72463223799
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 74 (33.1 bits)