Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F02354g1.81ON73373335320.0
Kwal_33.133891.81ON69457116560.0
SAKL0C02596g1.81ON73457314720.0
AFR670W1.81ON71758112471e-161
Ecym_10851.81ON70558612251e-158
NCAS0A005801.81ON68953211751e-151
TDEL0C062001.81ON70062711751e-151
YNL272C (SEC2)1.81ON75958011731e-150
Skud_14.681.81ON75254711571e-147
Smik_14.651.81ON79054311471e-145
KLLA0C02299g1.81ON65852611311e-145
Suva_14.701.81ON75157811341e-144
Kpol_2000.671.81ON82460311251e-142
CAGL0J08228g1.81ON75257711151e-141
NDAI0F042301.81ON70153110951e-139
KAFR0D039601.81ON66452910651e-135
TPHA0B045001.81ON73354710591e-133
ZYRO0F16698g1.81ON77955410581e-132
KNAG0F004601.81ON6545299681e-120
TBLA0A054301.81ON7955499161e-111
Kpol_1075.6singletonON22552850.086
Skud_5.471.487ON96866781.1
SAKL0F14894g7.488ON129782725.2
KLTH0D07150g2.542ON540113716.0
Suva_8.2698.636ON485107708.6
KNAG0F008702.16ON54060708.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F02354g
         (733 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {...  1365   0.0  
Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {...   642   0.0  
SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {...   571   0.0  
AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic ...   484   e-161
Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}...   476   e-158
NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON...   457   e-151
TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1...   457   e-151
YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON} ...   456   e-150
Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {O...   450   e-147
Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...   446   e-145
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...   440   e-145
Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {O...   441   e-144
Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON} (1441...   437   e-142
CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} simil...   434   e-141
NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1...   426   e-139
KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.8...   414   e-135
TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1...   412   e-133
ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weak...   412   e-132
KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}...   377   e-120
TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa] ...   357   e-111
Kpol_1075.6 s1075 complement(21190..21867) [678 bp, 225 aa] {ON}...    37   0.086
Skud_5.47 Chr5 (68654..71560) [2907 bp, 968 aa] {ON} YEL043W (REAL)    35   1.1  
SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa...    32   5.2  
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    32   6.0  
Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON...    32   8.6  
KNAG0F00870 Chr6 complement(157306..158928) [1623 bp, 540 aa] {O...    32   8.9  

>KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 733

 Score = 1365 bits (3532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/733 (91%), Positives = 669/733 (91%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60
           MTEEEESKR            IESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE
Sbjct: 1   MTEEEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60

Query: 61  QAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR 120
           QAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR
Sbjct: 61  QAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR 120

Query: 121 RETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXX 180
           RETHSVQVKNS                     NLKKVLYNLEEESNDRLKSNQ       
Sbjct: 121 RETHSVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYNLEEESNDRLKSNQASVAAED 180

Query: 181 XXXXXXXXXLEKTMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCASIR 240
                    LEKTMNALNGTA               RYDLVLYNEFLKFIAALPQCASIR
Sbjct: 181 SVASSSESALEKTMNALNGTASPPSPALFSPLLKSLRYDLVLYNEFLKFIAALPQCASIR 240

Query: 241 DSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRV 300
           DSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRV
Sbjct: 241 DSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRV 300

Query: 301 GHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLK 360
           GHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLK
Sbjct: 301 GHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLK 360

Query: 361 TLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNAFSV 420
           TLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNAFSV
Sbjct: 361 TLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNAFSV 420

Query: 421 QTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPEQITTPTT 480
           QTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPEQITTPTT
Sbjct: 421 QTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPEQITTPTT 480

Query: 481 NIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVGDGLVPELGQE 540
           NIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVGDGLVPELGQE
Sbjct: 481 NIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVGDGLVPELGQE 540

Query: 541 ARESFSLHNEEEVDNEEGFDFEKMNSTLESAGLEGKETSQTTQTSSGNPTTLDPRTSEGG 600
           ARESFSLHNEEEVDNEEGFDFEKMNSTLESAGLEGKETSQTTQTSSGNPTTLDPRTSEGG
Sbjct: 541 ARESFSLHNEEEVDNEEGFDFEKMNSTLESAGLEGKETSQTTQTSSGNPTTLDPRTSEGG 600

Query: 601 DAGAKIGASFVQTIADSDTGASSPIQESQTKTARTVEKKAAVPGSIDLDEQNYAQNVEAP 660
           DAGAKIGASFVQTIADSDTGASSPIQESQTKTARTVEKKAAVPGSIDLDEQNYAQNVEAP
Sbjct: 601 DAGAKIGASFVQTIADSDTGASSPIQESQTKTARTVEKKAAVPGSIDLDEQNYAQNVEAP 660

Query: 661 ARMVKSRTSEAPNGEGTAENIIELVAESDTKKITGKAPESASSDHAKSRSELPSQSATDD 720
           ARMVKSRTSEAPNGEGTAENIIELVAESDTKKITGKAPESASSDHAKSRSELPSQSATDD
Sbjct: 661 ARMVKSRTSEAPNGEGTAENIIELVAESDTKKITGKAPESASSDHAKSRSELPSQSATDD 720

Query: 721 EEAGFDDARSTFS 733
           EEAGFDDARSTFS
Sbjct: 721 EEAGFDDARSTFS 733

>Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {ON}
           YNL272C (SEC2) - GDP/GTP exchange factor for Sec4p
           [contig 118] FULL
          Length = 694

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/571 (58%), Positives = 395/571 (69%), Gaps = 13/571 (2%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60
           MTEEEESKR            IESIDKQSHLEEQLLQARKVI+SQR++L++YE + ++LE
Sbjct: 1   MTEEEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLE 60

Query: 61  QAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR 120
           + E+ L+S R+QN K +E L+AA+S    A+ E+ RLNKEVE+LTASLFDEANNMVADAR
Sbjct: 61  ETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADAR 120

Query: 121 RETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQX-XXXXX 179
           +ETHS+QVKN                      NLKKVLY+LEEESN RL+SN+       
Sbjct: 121 KETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTS 180

Query: 180 XXXXXXXXXXLEKTMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCASI 239
                     LE TM+ALNGTA               RYDL LYNEFLKFIAALP  ASI
Sbjct: 181 DNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASI 240

Query: 240 RDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYR 299
           +D+ S SKLLRRL+HDEIQP+LRLDNASG+GWY +R+LM+LM+DG +VVEPVSGINETYR
Sbjct: 241 KDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYR 300

Query: 300 VGHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVL 359
           V H S       Q    EQ+   HLYNYPADSPPVAI+ PCSFCSESRNDILEHGRLYVL
Sbjct: 301 VSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVL 360

Query: 360 KTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNAFS 419
           +TLQK E G TE +SQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLE+VT+   +   S
Sbjct: 361 RTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSS 420

Query: 420 VQTNSVSNSPTLESPPD-KMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPEQITTP 478
            +  S S   T E   + K+K DRKSKR+S MAGL+K+ P KTSY +E       Q+TTP
Sbjct: 421 TEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNSQVTTP 480

Query: 479 TTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVGDGLVPELG 538
           TTNIQ AWAQLCKLRS+LHW HIGIW++ D VETK+GP+   D     +   + ++  L 
Sbjct: 481 TTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPDSAEAVASSSNEVLTHL- 539

Query: 539 QEARESFSLHNEEEVDNEEGFDFEKMNSTLE 569
               +S +  N +E      FDFEK  ++ E
Sbjct: 540 ----QSLASSNNDE------FDFEKTTNSSE 560

>SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 734

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/573 (52%), Positives = 376/573 (65%), Gaps = 18/573 (3%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60
           M+++EESKR            IES+DKQS LEEQL +A+K IASQ ES  +YE LR+QLE
Sbjct: 1   MSDQEESKRVSMQLSSLSTQLIESVDKQSRLEEQLRKAKKTIASQSESAASYESLREQLE 60

Query: 61  QAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR 120
           +A+  L S   ++ +++ +L A  + +  A+ +ID+LNKEVEDLTASLFDEANNMVADAR
Sbjct: 61  KAQQELASRSRESAELERKLAAETTARKMAQDKIDQLNKEVEDLTASLFDEANNMVADAR 120

Query: 121 RETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXX 180
           RE H V+V+NS                     NLKKVLY+LE+E++   K+ +       
Sbjct: 121 REKHDVEVRNSKLHEQLHEKDALLETLEMQLKNLKKVLYSLEDENSSLAKTKRNSAFLSS 180

Query: 181 XXXXXXXXXLEKTMNALNGTAXXXXXXXXXX----XXXXXRYDLVLYNEFLKFIAALPQC 236
                    LEKT  A  GT+                   RYDL LYNEFLKF+A LP C
Sbjct: 181 DTATSSNVSLEKT--ATGGTSLGELSGAGGVLFSPVLQSLRYDLGLYNEFLKFVAMLPIC 238

Query: 237 ASIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINE 296
            SI+ +T+ SKLLRRL+HDEIQPVLRLDNASG+GW +RR+LMSLMIDG +VVEP+SG+NE
Sbjct: 239 RSIKGTTTESKLLRRLMHDEIQPVLRLDNASGLGWLVRRSLMSLMIDGLVVVEPLSGVNE 298

Query: 297 TYRVGHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRL 356
           TYR+G+ S Q+ A  Q     Q+   HLYNYP DSPPVAI   C+FCSESRNDILEHGRL
Sbjct: 299 TYRMGYSSPQLHA-QQNAHFGQERAAHLYNYPTDSPPVAIHEACAFCSESRNDILEHGRL 357

Query: 357 YVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNN 416
           YVLKTLQ+ E+G TET++Q+PLCHYCLLKVRQTCEIFAFLRSLK G WHLE VT++    
Sbjct: 358 YVLKTLQRNEDGTTETTNQYPLCHYCLLKVRQTCEIFAFLRSLKEGVWHLEKVTLTSIAT 417

Query: 417 AFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPEQIT 476
             S + + V+ +P   +     K D KSKRMSFMAGLS+    K   TVE A     Q  
Sbjct: 418 GGSSKFSEVTKTPHTSAA----KEDAKSKRMSFMAGLSRPSTTKLMPTVEGAPNFAGQSG 473

Query: 477 TPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVV------AVDRPGNDSIVG 530
            P TNIQRAWAQLCKLR+SLHWAHIG+W++ED V  ++GP++       V+     S+  
Sbjct: 474 QPVTNIQRAWAQLCKLRASLHWAHIGVWSIEDSVALRIGPLMPEEKTEQVEGSSASSMGR 533

Query: 531 DGLVPELGQEARESFSLHNEEEVDNEEGFDFEK 563
           +  VP +     ESF+L  +E+ ++ E FDFEK
Sbjct: 534 EEWVP-MESPDDESFALQKDEDAESAETFDFEK 565

>AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL272C (SEC2)
          Length = 717

 Score =  484 bits (1247), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 261/581 (44%), Positives = 353/581 (60%), Gaps = 26/581 (4%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60
           M+E+EE++R            IESIDKQS LEEQL  A+K +A+Q++ ++  E  R + +
Sbjct: 10  MSEQEENRRISVQVSSLSTQLIESIDKQSRLEEQLQHAKKALAAQKDVVKQCESARGEAQ 69

Query: 61  QAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR 120
           Q  S L    ++  +  EEL+ AR  +L AE  ++RLNKE+EDLT SLFDEAN MV+ AR
Sbjct: 70  QLRSQLADRDTELERQGEELEEARKARLAAELAVERLNKEIEDLTTSLFDEANRMVSKAR 129

Query: 121 RETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXX 180
           +E H V+  N+                     NLK VLY +E+E N R +          
Sbjct: 130 KEKHVVEQHNARLQEQLREKDMLLDTLTIQLKNLKDVLYKVEDEQNTRSRRQSVMDSVNP 189

Query: 181 XXXXXXXXXLEKTMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCASIR 240
                         + +  +                RYD+ +Y E+L+F+A LP C SIR
Sbjct: 190 SHTSLDVDGYASAFDNMLSSGLLFTPAVQSL-----RYDIPMYTEYLRFLAVLPMCKSIR 244

Query: 241 DSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRV 300
           D+   SK LRRL+ DEIQPVLRLD+A+G+GW +RRNLM+LMI+G +VVEP+SGINETYR+
Sbjct: 245 DTRHDSKFLRRLVSDEIQPVLRLDSATGLGWLVRRNLMNLMIEGLVVVEPLSGINETYRM 304

Query: 301 GHMSSQVEAVPQFQGPEQQSRP---HLYNYPADSPPVAIESPCSFCSESRNDILEHGRLY 357
           G+ S      PQ     + S P    ++ YP +SPPVAIE+PC+FCSE+RNDILEHGRLY
Sbjct: 305 GYAS------PQTHSHSKSSEPAAVKMFTYPVNSPPVAIEAPCAFCSEARNDILEHGRLY 358

Query: 358 VLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTIS---KT 414
           VLKTLQK E G   T +Q+PLCH+CLLKVRQTCEIFAFLRSLK+G+W+LE VT+S   + 
Sbjct: 359 VLKTLQKTETGELLTENQYPLCHFCLLKVRQTCEIFAFLRSLKTGSWNLENVTLSCAKQE 418

Query: 415 NNAFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSK-TLPLKTSYTVESASPCPE 473
           ++AF+   NSV  SP +    D+      SKR+SFM+ LS+ +   KT+  +E+ +   E
Sbjct: 419 SDAFTQIPNSVQASPVIHR--DENSITSSSKRLSFMSSLSRVSTTSKTTPRIEAVTDFNE 476

Query: 474 QITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVG--- 530
           +   P TN+QR+W  LCKLR+SLHW+HIG+WTL+D V+TKV P+   D+  + S      
Sbjct: 477 KKGLPPTNVQRSWVHLCKLRASLHWSHIGVWTLDDAVQTKVVPLSPEDKISSVSSESISP 536

Query: 531 -DGLVPELGQEARESFSLHNEEEVDNEEGFDFEKMNSTLES 570
            D       Q    SF    E+E+  EEGFDFE    T+++
Sbjct: 537 QDWTKLPSPQSVENSFIFQKEDEI--EEGFDFEHGEDTIDT 575

>Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}
           similar to Ashbya gossypii AFR670W
          Length = 705

 Score =  476 bits (1225), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 266/586 (45%), Positives = 354/586 (60%), Gaps = 23/586 (3%)

Query: 1   MTEE-EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQL 59
           MTE+ EESKR            IESIDKQS LEE L QA+K +++Q++S+  ++ L+QQL
Sbjct: 10  MTEQQEESKRISIQVSSLSTQLIESIDKQSRLEEHLNQAKKALSAQKDSISQFDSLKQQL 69

Query: 60  EQAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADA 119
              +  L     +    + EL  A+  ++ AE   ++LNKE+EDLT SLFDEAN+MVA+A
Sbjct: 70  SDTKKQLAYTEEELAVKRRELVEAQEVRVAAERAAEKLNKEIEDLTTSLFDEANSMVANA 129

Query: 120 RRETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXX 179
           R+E H V+V NS                     NLK+VLY +E+E N  L S +      
Sbjct: 130 RKEKHDVEVLNSKLQEQLREKDMLLDTLSIQLRNLKEVLYKVEDEHNT-LNSYRQSIIME 188

Query: 180 XXXXXXXXXXLEKTMN-ALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCAS 238
                      E   N  L                   RYD+ LY E+L+F+A LP C  
Sbjct: 189 GSNGSNASLDKEALGNPGLIYDHHHHMNLLFSPLAQSLRYDIPLYTEYLRFLAVLPMCKG 248

Query: 239 IRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETY 298
           I+D+   SK LRRL+ DEIQPVLRLD ASG+GW +RRNLM+LMIDG +VVEP+SGINETY
Sbjct: 249 IKDTRHDSKFLRRLVLDEIQPVLRLDAASGLGWLVRRNLMNLMIDGLVVVEPLSGINETY 308

Query: 299 RVGHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYV 358
           R+G+ S Q  +        +     ++NYP++SPPVAI+ PC+FCSESRNDILEHGRLYV
Sbjct: 309 RIGYASPQSNS----HKVTEVDNAKMFNYPSNSPPVAIQDPCAFCSESRNDILEHGRLYV 364

Query: 359 LKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTIS----KT 414
           LKTLQK E+G T + +Q+PLCHYCLLKVRQTCEIFAFLRSLKSGAW+LE VT+S     +
Sbjct: 365 LKTLQKNEDGSTTSETQYPLCHYCLLKVRQTCEIFAFLRSLKSGAWNLENVTLSCARPGS 424

Query: 415 NNAFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKT-LPLKTSYTVESASPCPE 473
           +    V  NS +NS +     +K      SKR+SFM+GLS+T    + +  +E+ +   E
Sbjct: 425 DEFTKVDRNSTTNSAS-----NKEANSTSSKRLSFMSGLSRTSSSTRMTPRIETVTDFSE 479

Query: 474 QITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVA---VDRPGNDSIVG 530
           +   P+TN+QR+W  LCKLR+SLHW HIG+WTLED ++ KV P+ A   V      S+V 
Sbjct: 480 RKGLPSTNVQRSWVHLCKLRASLHWCHIGVWTLEDSIQLKVAPMSAQAKVVTSTRSSVVP 539

Query: 531 DGLVPELG--QEARESFSLHNEEEVDNEEGFDFEKMNSTLESAGLE 574
                ++   Q     F   +E+ +++EE FDFE    TL++   E
Sbjct: 540 QNWTEDICSPQSGENFFVFQHEDGLEDEE-FDFENGEKTLDTIKAE 584

>NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON}
           Anc_1.81 YNL272C
          Length = 689

 Score =  457 bits (1175), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 239/532 (44%), Positives = 333/532 (62%), Gaps = 28/532 (5%)

Query: 1   MTEE-EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQL 59
           M+E+ EESKR            IESIDKQS LEE+L  A K+IASQ+ SL  Y +L+ + 
Sbjct: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60

Query: 60  EQAESNLKSERSQ----NIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNM 115
           E+ +  + SE  Q    N K++  ++  R  +  AE E+++L+KEVEDLTA+LFDEANNM
Sbjct: 61  EKLK--ISSEDQQKELDNFKVK--IRRERELRENAEQEVEKLSKEVEDLTATLFDEANNM 116

Query: 116 VADARRETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXX 175
           VADAR++ ++V+V N+                     NLKKVL  +E+E+N  + +N+  
Sbjct: 117 VADARKDKYTVEVLNTKLVEQLHEKDNLLETLNLQLKNLKKVLQTVEDENNSLIGNNRYS 176

Query: 176 XXX-XXXXXXXXXXXLEKTMNALN----GTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFI 230
                          LEK    ++      +               RYDL LY EFLKFI
Sbjct: 177 IIQPDSATTSSSTTSLEKITTTVSSYSQNISNMANGIIYSPIISSIRYDLPLYEEFLKFI 236

Query: 231 AALPQCASIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEP 290
           A +P C +I+D++S SKL+RRL++DEI PVL+LDNASG+GW +R+ ++S M++G +VVEP
Sbjct: 237 AVIPHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEP 296

Query: 291 VSGINETYRVGHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDI 350
           +SG+NET+++G+ +    A    +   Q S P L+ +P  SPP+A+  PCSFC ESR+DI
Sbjct: 297 LSGVNETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDI 356

Query: 351 LEHGRLYVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVT 410
           +EH R+YVLKT  K E+G    ++ FPLCH+CL KVRQTCEIFAFLRSLK+G W+LE VT
Sbjct: 357 IEHARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVT 416

Query: 411 I----SKTNNAFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVE 466
           +    SK ++ FSV T+++  + T          DR+SKRMSF+ GL+K      +  VE
Sbjct: 417 MKSISSKDSSRFSVVTSAIRQTKT---------EDRRSKRMSFIGGLTKNSSAINTAQVE 467

Query: 467 SASPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVV 518
           S +   E    PTTNIQRAW QLCKLRS LHWAH+GIW+++D + +K+GP +
Sbjct: 468 STTSM-EITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEI 518

>TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1.81
           YNL272C
          Length = 700

 Score =  457 bits (1175), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 270/627 (43%), Positives = 371/627 (59%), Gaps = 36/627 (5%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLEQAES 64
           EES+R            IESIDKQ  LEEQL QA++ I SQR SL +Y DL+ + +  ES
Sbjct: 6   EESRRVSVQISSLSTQLIESIDKQFQLEEQLNQAKRTIQSQRNSLDSYNDLKSKFDGVES 65

Query: 65  NLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADARRETH 124
           +L+++     +++EEL   ++ + TAE  +D LNKE+EDLTASLFDEAN MVA AR+E++
Sbjct: 66  SLQTKNQIIEELKEELVKEKTLRTTAERNVDDLNKEIEDLTASLFDEANKMVATARKESY 125

Query: 125 SVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXXXXXX 184
           ++++KN+                     NLKKV+ NLE+ES     S             
Sbjct: 126 TIEIKNNKLKEQLDEKDMILETLNLQLKNLKKVIQNLEKESTTHSGS---RSSFVGNDNS 182

Query: 185 XXXXXLEKTMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCASIRDSTS 244
                L KT  + + +                RYDL LY EFLKFIA LP C +++D++S
Sbjct: 183 TSSISLNKT--STSNSDELSLGPIYSPNITSVRYDLNLYTEFLKFIAVLPYCETLKDTSS 240

Query: 245 YSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRVGHMS 304
            SKLLRRL++DEIQP LRLDNASG+GW +RR LMSLM++G +VVEP+SG+NE ++ G+ +
Sbjct: 241 DSKLLRRLVNDEIQPALRLDNASGLGWIVRRTLMSLMMEGLVVVEPLSGLNENFQYGY-T 299

Query: 305 SQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLKTLQK 364
           S V     F         HL++YP+DSPP+A+   CSFCSE+R+D++EH R+YVLKT  +
Sbjct: 300 SPVLPSSSFNPSMGGKDSHLFSYPSDSPPIAVHDKCSFCSEARDDVIEHARMYVLKTQTR 359

Query: 365 MENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNAFSVQTNS 424
           +E+G    ++ FPLC YCLLKVRQTCEIFAFLRSLK GAW+LE VT++K     S + + 
Sbjct: 360 IEDGSLVVTNSFPLCRYCLLKVRQTCEIFAFLRSLKLGAWNLEKVTLTKIAKGESSEFSQ 419

Query: 425 VSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPEQITTPTTNIQR 484
           VSN    + P    K +++ +RMS + G +++  L     +    P  +QI  PTTNIQR
Sbjct: 420 VSNG-NHKGP---QKEEKRLQRMSLITGKNQSSKLAPQVDI----PV-DQIGAPTTNIQR 470

Query: 485 AWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVGDGLVPELGQEARE- 543
           AW QLCKLR +LHWAHIGIW++ED V  K+GP V  +   +D  +     P L +   E 
Sbjct: 471 AWLQLCKLRITLHWAHIGIWSVEDAVTQKIGPFVKEEDENDDEPISPNENPPLTKVTSED 530

Query: 544 -SFSLHN---EEEVDNEEGFDFEKMNSTLESAGLEGKETSQTTQTSSGNPTTLDPRTSEG 599
            SF+L N    +E+++++ FDFEK           GK   QT + +    T  + RTSE 
Sbjct: 531 GSFTLKNSDEIDEINDDDAFDFEK-----------GKAPVQTAEITEA--TNNESRTSEH 577

Query: 600 GDAGAKIGASF---VQTIADSDTGASS 623
             +    G      V T ADS T  S+
Sbjct: 578 AASQNNAGQPLKDEVITTADSSTTRSA 604

>YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON}
           SEC2Guanyl-nucleotide exchange factor for the small
           G-protein Sec4p; essential for post-Golgi vesicle
           transport and for autophagy; associates with the
           exocyst, via exocyst subunit Sec15p, on secretory
           vesicles
          Length = 759

 Score =  456 bits (1173), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 248/580 (42%), Positives = 350/580 (60%), Gaps = 40/580 (6%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60
           M   EE+KR            IES+DKQSHLEEQL ++ K IASQ+ +++NY  L++   
Sbjct: 1   MDASEEAKRVSIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLKEDYN 60

Query: 61  QAESNLKSERSQNIK-IQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADA 119
             +  L S+R   +K ++E++      +  AE E D+LNKEVEDLTASLFDEANNMVADA
Sbjct: 61  TLKREL-SDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADA 119

Query: 120 RRETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXX 179
           R+E +++++ N                      NLKKV+++L+ ES     SN+      
Sbjct: 120 RKEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILS 179

Query: 180 XXXXXXXXXXLEKTMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCASI 239
                      +   +    +                RYD+ LYNEFLKF+AALP+C +I
Sbjct: 180 DSATSSSTSLNKVPTSYSLASQDIYSGIVYSPSISSIRYDISLYNEFLKFVAALPRCENI 239

Query: 240 RDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYR 299
           + +++ SKL+RRL++DEIQP+L++DNASGIGW +++ L+SL+IDG +VVEP+SG+N TY+
Sbjct: 240 KATSTESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVVEPLSGVNATYQ 299

Query: 300 VGHMSSQVEAVPQFQGPEQQS---RPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRL 356
           +G+ SS          P +Q+    P ++ +P DSPPVA+ + CSFC ESR+DI+EH R+
Sbjct: 300 IGYNSS---------SPAKQATSNMPKMFKFPLDSPPVAVHAACSFCGESRDDIIEHARM 350

Query: 357 YVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVT---ISK 413
           Y+LKTL K ++G  + ++ +PLCH+CLLK+RQTCEIFAFLRSLK GAWHLE +T   I+K
Sbjct: 351 YILKTLHKTDDGKEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLTTQNITK 410

Query: 414 TN-NAFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGL-----SKTLPLKTSYTVES 467
            +   FS  T        + S       D+K+KR+SFMAGL     +K  P    ++ E+
Sbjct: 411 EDLEKFSEVTKHTKRDGRVSS------QDKKTKRLSFMAGLGINSSTKNKPKMEIFSSET 464

Query: 468 ASPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVA--VDRPGN 525
            +  P Q   PTTNIQRAW QLCKLR  LHW HIGIW ++D + +K+GP+V    D   N
Sbjct: 465 NAK-PGQ---PTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVEDDSDEDQN 520

Query: 526 DSI---VGDGLVPELGQEARESFSLHNEEEVDNEEGFDFE 562
           D+I   + D  +    Q+A+  FS  + EE    + FDFE
Sbjct: 521 DAISVRLQDKAL--WKQDAKRPFSSSSAEESQKSDAFDFE 558

>Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {ON}
           YNL272C (REAL)
          Length = 752

 Score =  450 bits (1157), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 244/547 (44%), Positives = 335/547 (61%), Gaps = 42/547 (7%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60
           M   EE+KR            IES+DKQSHLEEQL ++ K IASQ+ +++NY     QLE
Sbjct: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENY----NQLE 56

Query: 61  QAESNLK---SERSQNIK-IQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMV 116
              + LK   SER   +K + E++      +  AE E D+LN+EVEDLTASLFDEAN MV
Sbjct: 57  TDHNTLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMV 116

Query: 117 ADARRETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXX 176
           ADARRE +++++ N                      NLKKV+++L+ ES     SN+   
Sbjct: 117 ADARREKYAIEILNKRLTEQLREKDVLLETLTLQLKNLKKVMHSLDNESTVTNNSNRYST 176

Query: 177 XXXXXXXXXXXXXLEK--TMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALP 234
                        L K  T+N+   +                RYD+ LYNEFLKF+AALP
Sbjct: 177 ILSDSATSSSTS-LNKVPTLNSF-ASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALP 234

Query: 235 QCASIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGI 294
           QC +I+ ++S SKL+RRL++DEIQP+L++DNASGIGW +++ L+SL+IDG ++VEP+SG+
Sbjct: 235 QCENIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGV 294

Query: 295 NETYRVGHMSSQVEAVPQFQGPEQQS---RPHLYNYPADSPPVAIESPCSFCSESRNDIL 351
           N TY +G+ SS          P +QS    P ++ +P +SPPVA+ + CSFC ESR+DI+
Sbjct: 295 NATYHIGYNSS---------SPVKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDII 345

Query: 352 EHGRLYVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTI 411
           EH R+YVLKTL K ++G  + ++ +PLCH+CLLK+RQTCEIFAFLRSLK GAWHLE + +
Sbjct: 346 EHARMYVLKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVM 405

Query: 412 SKTNNAFSVQTNSVSNSPTLESPPDKMKP-DRKSKRMSFMAGL-----SKTLPLKTSYTV 465
                   V+ + V+     E   D++   D+KSKR+SFMAGL     +K+ P    ++ 
Sbjct: 406 QNIAKGDLVKFSEVTQRTKTE---DRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSS 462

Query: 466 E-SASPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVV---AVD 521
           E +A P       PTTNIQRAW QLCKLR  LHW HIGIW ++D + +K+GP+V     D
Sbjct: 463 EINAKPGQ-----PTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVDDEDSD 517

Query: 522 RPGNDSI 528
              ND+I
Sbjct: 518 DNQNDAI 524

>Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {ON}
           YNL272C (REAL)
          Length = 790

 Score =  446 bits (1147), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 239/543 (44%), Positives = 331/543 (60%), Gaps = 34/543 (6%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60
           M   EE+KR            IES+DKQSHLEEQL ++ K I+SQ+E++ NY  L+   E
Sbjct: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60

Query: 61  QAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR 120
             +  +  +  +  K++E++      +  AE E D+LNKEVEDLTASLFDEANNMV+DAR
Sbjct: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120

Query: 121 RETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXX 180
           +E +++++ N                      NLKKV+++L+ ES     SN+       
Sbjct: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND 180

Query: 181 XXXXXXXXXLEKTMNALNGTAXXXXXX--XXXXXXXXXRYDLVLYNEFLKFIAALPQCAS 238
                    L K +  LN +A                 RYD+ LYNEFLKF+AALP C +
Sbjct: 181 SATSSSTS-LNK-VPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDN 238

Query: 239 IRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETY 298
           I+ ++S SKL+RRL++DEIQP+L++DNASGIGW +++ L+SL+IDG +V+EP+SG+N TY
Sbjct: 239 IKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATY 298

Query: 299 RVGHMSSQ--VEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRL 356
           ++G+ SS    +A P          P ++ +P DSPPVA+ + CSFC ESR+DI+EH R+
Sbjct: 299 QIGYNSSSPVKQATPNM--------PRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARM 350

Query: 357 YVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWH---LEAVTISK 413
           Y+LKTL K ++G  + ++ +PLCH+CLLK+RQTCEIFAFLRSLK GAWH   LEA +I+K
Sbjct: 351 YILKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITK 410

Query: 414 TN-NAFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVE----SA 468
            +   FS  T        + S       D+K+KR+SFMAGL      K+   +E     A
Sbjct: 411 GDLGKFSEVTKRTKTDGRVSS------QDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEA 464

Query: 469 SPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVA---VDRPGN 525
           +  P Q   PTTNIQRAW QLCKLR  LHW+HIGIW ++D + +K+GP V     D   +
Sbjct: 465 NAKPGQ---PTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDENRD 521

Query: 526 DSI 528
           DSI
Sbjct: 522 DSI 524

>KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 658

 Score =  440 bits (1131), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 228/526 (43%), Positives = 322/526 (61%), Gaps = 33/526 (6%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60
           M ++EESKR            IESIDKQS LEEQLL A+K I++Q+    +Y +L+Q+L+
Sbjct: 1   MADQEESKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTISTQQNIANSYNELKQELQ 60

Query: 61  QAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR 120
             +   ++++++  K QEE+ A       AE ++  LN+E+EDLTASLFDEANNMVADAR
Sbjct: 61  SLKLQYETDKTK-FKKQEEICA------DAEKKVATLNQEIEDLTASLFDEANNMVADAR 113

Query: 121 RETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXX 180
           +E ++V++ NS                     NLK VLY  E   ND   S         
Sbjct: 114 KEQNAVEILNSKLKEQLKEKDLLLDTLSMQLKNLKNVLYKFE---NDFNSSKNVSLSDSA 170

Query: 181 XXXXXXXXXLEKTMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCASIR 240
                        + ++N  +               RYD+ LY E+LKF+A LPQC +++
Sbjct: 171 TSSTTSIDRSTTNLTSVNDNSLSFQGVLFSPLLHSLRYDVPLYTEYLKFLAVLPQCENLQ 230

Query: 241 DSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRV 300
            +TS SKLLRRLI+ EI PVLRLDNASG+GW ++RNLM+LM++G + +EP+SGINETYR 
Sbjct: 231 QTTSESKLLRRLINYEISPVLRLDNASGVGWLVKRNLMNLMMEGLVSIEPISGINETYRT 290

Query: 301 GHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLK 360
           G+ S  +   P+ +  +     HL++ P +SPPVA+  PC+FC E+RNDILEHGRLY+ K
Sbjct: 291 GYSSPSIPDSPEVENKDS----HLFSRPVNSPPVAMVEPCAFCGENRNDILEHGRLYIFK 346

Query: 361 TLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTN----N 416
           T QK+ENG  E ++QFP+CHYCLLK+RQ CEIFAFLRSL+SGAWHLE V ++  +    N
Sbjct: 347 TYQKLENGKNELTNQFPVCHYCLLKLRQVCEIFAFLRSLRSGAWHLEKVALASIHQGKVN 406

Query: 417 AFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPEQIT 476
           A+S  T +              +P  KSKR+S   GL ++    ++  +E+     ++  
Sbjct: 407 AYSEVTKA-------------SRPKMKSKRLSIFQGLKQS--QSSTPIIENGPQFADKNG 451

Query: 477 TPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDR 522
            PTTNIQR+WA+L +LR+SL W+HIG+W+L++ V T + P   + +
Sbjct: 452 LPTTNIQRSWARLSQLRASLQWSHIGVWSLDESVATDIAPSTDISK 497

>Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {ON}
           YNL272C (REAL)
          Length = 751

 Score =  441 bits (1134), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 245/578 (42%), Positives = 331/578 (57%), Gaps = 35/578 (6%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60
           M   EE+KR            IES+DKQSHLEEQL ++ K IA Q+ ++ NY  L+   +
Sbjct: 1   MEASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIAGQKAAIDNYNKLKTDYD 60

Query: 61  QAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR 120
             +  L    ++ +K+   +      +  AE E D+LN+EVEDLTASLFDEAN+MVADAR
Sbjct: 61  TLKKTLLERDNEVMKLNGNIAKETQLRTKAEDESDKLNREVEDLTASLFDEANHMVADAR 120

Query: 121 RETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXX 180
           +E +++++ N                      NLKKV+++L+ ES     S +       
Sbjct: 121 KEKYAIEILNKRLTEQLREKDALLETLTLQLKNLKKVMHSLDNESTVTNNSGRYSTILSD 180

Query: 181 XXXXXXXXXLEKTMNALNGTAXXXXXXXXXX-XXXXXRYDLVLYNEFLKFIAALPQCASI 239
                    L K   + + T+                RYD  LYNEFLKF+AALP C +I
Sbjct: 181 SATSSSTS-LNKVPTSNSFTSQDLYSGIVYSPTISSIRYDSNLYNEFLKFVAALPHCENI 239

Query: 240 RDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYR 299
           + ++S SKL+RRL++DEIQP+L++DNASGIGW +++ L+SL+IDG +VVEP+SG+N TY+
Sbjct: 240 KATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGMVVVEPLSGVNATYQ 299

Query: 300 VGHMSSQ--VEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLY 357
           +G+ SS    +A P          P ++ +P DSPPVA+ + CSFC ESR+DI+EH R+Y
Sbjct: 300 IGYNSSSPVKQAAPNM--------PKMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMY 351

Query: 358 VLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNA 417
           VLKTL K ++G    ++ +PLCH+CLLKVRQTCEIFAFLRSLK GAWHLE VT+      
Sbjct: 352 VLKTLHKADDGTEHVTNTYPLCHWCLLKVRQTCEIFAFLRSLKVGAWHLEKVTMQNIVKG 411

Query: 418 ----FSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPE 473
               FS  T        + SP DKM     +KR+SFMAGL      K+   VE   P  E
Sbjct: 412 DLERFSEVTKRTKADGRV-SPHDKM-----AKRLSFMAGLGINSSTKSKPRVE--VPSSE 463

Query: 474 QITT---PTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVG 530
                  PTTNIQRAW QLCKLR  LHW+HIGIW ++D + +K+GP   VD  G D    
Sbjct: 464 MTVKPGHPTTNIQRAWIQLCKLRCILHWSHIGIWAVDDSISSKIGPF--VDDEGTDEGQN 521

Query: 531 DGLVPEL------GQEARESFSLHNEEEVDNEEGFDFE 562
           D +   L       + A    S  + +E    + FDFE
Sbjct: 522 DTIPVRLQDKSLWKKNADTPLSSSSTDESQKSDTFDFE 559

>Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON}
           (144161..146635) [2475 nt, 825 aa]
          Length = 824

 Score =  437 bits (1125), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 248/603 (41%), Positives = 343/603 (56%), Gaps = 25/603 (4%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLEQAES 64
           +ESKR            +ESI+KQ+ LE++L ++R+ I  Q+ +++ Y DL+ + +Q + 
Sbjct: 6   DESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQLDK 65

Query: 65  NLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADARRETH 124
           N    + +  K++ E +     +L+AE ++D LNKEVE+LTASLFDEANNMVADARR   
Sbjct: 66  NFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARRGAQ 125

Query: 125 SVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXXXXXX 184
            + +KN                      NLK VL++L+ +  +   SN+           
Sbjct: 126 EIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNSLISTTSASS 185

Query: 185 XXXXXLEKTMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCASIRDSTS 244
                 +   +                     RYDL LYNEFLKFIA LP C SI+ +TS
Sbjct: 186 SSVSLKKTITSNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKHTTS 245

Query: 245 YSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRVGHMS 304
            SKLLRRLI+DEIQPVLRLDNASG+GW ++R LM+LMI+G +V+EP+SG+NE YR    S
Sbjct: 246 ESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFSS-S 304

Query: 305 SQVEAVPQFQGPEQQSR-PHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLKTLQ 363
           + V  V     P+  S+  HL+ YP++SPP+A+  PC+FC E+RND+LEH R+Y+LKT  
Sbjct: 305 APVSNVNSNNDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLKTQT 364

Query: 364 KMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTI-------SKTNN 416
           K E+     ++QFPLC  CL+KVRQTCEIFAFLRSLK GAW+LE VT+       SK  +
Sbjct: 365 KNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDSKKFS 424

Query: 417 AFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLS-KTLPLKTSYTVESASPCPEQI 475
           + +  T+S+S S   E    K+      KR S MAG    ++   T+   E++    +Q 
Sbjct: 425 SVTAATSSISKSKIEEKFDSKLM-----KRRSIMAGFGISSISNTTTTKSETSVGVVDQS 479

Query: 476 TTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVGDGLVP 535
             PTTNIQRAW  L KLRS LHWAHIGIW  ++ V TK+ P ++        +    ++ 
Sbjct: 480 GLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELEDQQILA 539

Query: 536 ELGQEARESFSLHNE--EEVDNE--EGFDFEKMNSTLESA------GLEGKETSQTTQTS 585
            +   + ESF+   E  E  DNE  E FDFE   ST++ A        +G ET   T+  
Sbjct: 540 NINNTSEESFTSVRESVEPSDNEDDEPFDFETNESTIQDAVPANAEVNDGGETETETENH 599

Query: 586 SGN 588
            GN
Sbjct: 600 LGN 602

>CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} similar
           to uniprot|P17065 Saccharomyces cerevisiae YNL272c SEC2
           protein transport protein
          Length = 752

 Score =  434 bits (1115), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 236/577 (40%), Positives = 334/577 (57%), Gaps = 42/577 (7%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLEQAES 64
           EES R            IESID+QS LE++L  A+ +I  Q+  +  +E L+Q+ ++   
Sbjct: 6   EESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINKQKHVMHEFETLKQKNKELSD 65

Query: 65  NLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADARRETH 124
             +S   +   +  +L+  +S +L AE E+D+L +EVEDLTASLFDEANNMV+DARRE H
Sbjct: 66  GQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEVEDLTASLFDEANNMVSDARREKH 125

Query: 125 SVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXXXXXX 184
            ++++NS                     NLKKVL  ++ ES+                  
Sbjct: 126 DIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVDSESSINANIRSPISTENSTTTS 185

Query: 185 XXXXXLEKTMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCASIRDSTS 244
                L +  + L  +                RYD  LYNEFLKF+A LP  +S++ +++
Sbjct: 186 ASGNKLTRRQSQL--SISHNESPLFSPYVTTLRYDQSLYNEFLKFLAVLPSSSSLKATST 243

Query: 245 YSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRVGHMS 304
            SKLL+RL+ DEIQPVL++DNASGIGW +R++L++ M++G +VVEP+SGINE Y++G+ +
Sbjct: 244 ESKLLKRLVSDEIQPVLKIDNASGIGWLVRKSLLTSMMEGQVVVEPLSGINEAYQLGYET 303

Query: 305 SQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLKTLQK 364
              E V Q +G E    PH++N+P +SPP+A+  PC+FC+E R+DI+EH R+YV+KT  K
Sbjct: 304 K--EHVSQNEGEEM---PHMFNFPLNSPPIAVRDPCAFCAEQRDDIIEHARMYVMKTFNK 358

Query: 365 MENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNA-----FS 419
             +G T  ++ FPLCH+CL+KVRQTCEIFAFLRSLK G WHLE VT++  +       FS
Sbjct: 359 ENDGSTTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWHLEKVTLNTISKGESLSKFS 418

Query: 420 VQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPEQITTPT 479
             T S + S + E        ++KS R SF+  L K  P K+S  VE+      +   PT
Sbjct: 419 EVTKSTNGSTSNE--------EKKSNRKSFIPSLPKGSPKKSSPVVETHIDTT-KAGQPT 469

Query: 480 TNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVGDGLVPELGQ 539
           +NIQRAW  LCKLRS LHWAH+GIW +ED +  K+GP+   D P +     + L+P L +
Sbjct: 470 SNIQRAWVHLCKLRSMLHWAHVGIWNMEDSISLKMGPI--TDHPTHSQ---ELLLPVLSE 524

Query: 540 EA-------------RESFSLHNEEEVDNEEGFDFEK 563
                           ESF+L   E  +    FDFEK
Sbjct: 525 SESLNMLEEYVPANDSESFNLKKTETSNT---FDFEK 558

>NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1.81
           YNL272C
          Length = 701

 Score =  426 bits (1095), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 231/531 (43%), Positives = 316/531 (59%), Gaps = 25/531 (4%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLEQAES 64
           EESKR            IESI KQS LEE+L QA + I SQ++SL+    L ++  + E 
Sbjct: 6   EESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQ 65

Query: 65  NLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADARRETH 124
           +L +   +  K++E L      + +AE E+++L+KEVEDLTA+LFDEANNMVADAR+E H
Sbjct: 66  SLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARKEAH 125

Query: 125 SVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXXXXXX 184
           + ++ NS                     +LKKVL N+E E+N                  
Sbjct: 126 AKEILNSRLMGQLREKDNLLETLTLQLKSLKKVLQNVETENN-------RYSMILPDSAT 178

Query: 185 XXXXXLEKTMNALNGTAXXXXXXXXXXXX---XXXRYDLVLYNEFLKFIAALPQCASIRD 241
                L+K     + +                   RYDL LY EFLKFIA +P C SI+D
Sbjct: 179 ISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKD 238

Query: 242 STSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRVG 301
           ++S SKL+RRLI DEI PVL++DNA+G+GW +++ L+S M++G ++VEP+SGINE Y++G
Sbjct: 239 TSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMG 298

Query: 302 HMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLKT 361
           H +  +    Q +   Q+  P ++ +P+ SPPVA+  PC+FC E RNDI+EH R+Y+LKT
Sbjct: 299 HTTPPLGMNTQEEADAQRKVPKMFKFPSSSPPVAVRDPCAFCGEERNDIIEHARMYLLKT 358

Query: 362 LQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKT----NNA 417
               ++G    ++ +PLCH+CL K+RQTCEIFAFLRSLK+  W+LE V +S      ++ 
Sbjct: 359 QTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGSSK 418

Query: 418 FSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLK-TSYTVE---------S 467
           FS  T + +N             ++KSKRMSFMAGL +T   K T+  VE         +
Sbjct: 419 FSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVEPHGNHNNNNT 478

Query: 468 ASPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVV 518
            SP  E I  PTTNIQRAW QLCKLRS LHWAHIGIW+++D V TKVGP V
Sbjct: 479 NSPI-ENIGQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEV 528

>KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.81
           YNL272C
          Length = 664

 Score =  414 bits (1065), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 224/529 (42%), Positives = 313/529 (59%), Gaps = 20/529 (3%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLEQAES 64
           EE+ R            +ESI ++S LEE+L   +KV  SQ  S+  Y+ L+   ++ ++
Sbjct: 6   EENNRISAQVTSLSTQLMESIQRESELEEKLKHLKKVALSQEGSIAKYDILKADYDKLKT 65

Query: 65  NLKSERSQNIK-IQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADARRET 123
            + SER++ I+ +Q  L+     + +AE E+  L++EVEDLTASLF EAN+MVADARRE 
Sbjct: 66  TV-SERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARREK 124

Query: 124 HSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXXXXX 183
           H  ++ N+                     NLKKVL N E+E N   K++           
Sbjct: 125 HITEILNTKLVEQLREKDTLLQTLDLQLKNLKKVLQNFEDE-NVTNKASSIAPDFLGSEQ 183

Query: 184 XXXXXXLEKTMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCASIRDST 243
                 L       N                  RYDL LYNEFLKFIA LP C +++D++
Sbjct: 184 KSASASLS------NEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDTS 237

Query: 244 SYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRVGHM 303
           S SKL+RRLI+DEIQP+LR+D+A+GIGW  ++++++LMIDG +V+EP+SG+NE Y++GH+
Sbjct: 238 SESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGHV 297

Query: 304 SSQVEAVPQFQGPEQQSR--PHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLKT 361
           SS      Q   P  +S+   HL+NYP DSPPVA+  PCSFC E+R+DILEH R++VLKT
Sbjct: 298 SSS----DQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKT 353

Query: 362 LQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNAFSVQ 421
             K E+G    ++ +PLC +CL KVRQTCEIFAFLRSLK G W+LE VT++      S +
Sbjct: 354 QSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNK 413

Query: 422 TNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPEQITTPTTN 481
              V+ +  ++S       ++K KR SFM GL        +  VE  +        PTTN
Sbjct: 414 FTEVTRA--IKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGNAGQPTTN 471

Query: 482 IQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVG 530
           IQRAW QLCKLRS LHW ++GIW++++ +  K+GP V  D   N+ I G
Sbjct: 472 IQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDD---NNEITG 517

>TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1.81
           YNL272C
          Length = 733

 Score =  412 bits (1059), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 220/547 (40%), Positives = 313/547 (57%), Gaps = 31/547 (5%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLEQAES 64
           +E KR            +ESI+KQS LE++L Q+RK+I  Q+ ++  Y +LR + +Q + 
Sbjct: 6   DEDKRVSVQLTSLSTQLLESIEKQSSLEDKLRQSRKIIEEQKTTITQYNELRIKYDQLDK 65

Query: 65  NLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADARRETH 124
           N   ++    +++++LQA + GK  AE ++D LNKEVE+LTASLFDEANNMVADAR+ET 
Sbjct: 66  NFSKKKVDLQRLEQQLQAEKLGKAEAERKVDELNKEVEELTASLFDEANNMVADARKETD 125

Query: 125 SVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSN-----QXXXXXX 179
           S++ KN                      NLK VL +L+ ES+  + +N     +      
Sbjct: 126 SIETKNKKLTEQLLEKDTILETLNLQLKNLKTVLQDLQTESSMSIINNGNISLKGDVPLS 185

Query: 180 XXXXXXXXXXLEK--TMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCA 237
                     L+K  T  +                    RYD  LYNEFLKF+A LP C 
Sbjct: 186 NENGGSSSHSLKKMSTTTSFQSQQEVVNYAIFTPKITNIRYDTFLYNEFLKFVAVLPHCN 245

Query: 238 SIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINET 297
           SI+++++ SKLLRRLI DEI PVLRLD ++G+GW  +R LM+ +++G +V+EP+SGINET
Sbjct: 246 SIKNTSAESKLLRRLISDEIHPVLRLDTSNGLGWLTKRTLMNQIVEGLVVIEPLSGINET 305

Query: 298 YRVGHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLY 357
           YR   +  +V         +Q ++  ++N+PADSPP+A+  PC+FC ESR+D + H R+Y
Sbjct: 306 YRQSALY-EVSISKSSIKSDQITKAKMFNFPADSPPIAVRDPCAFCDESRSDCIGHARMY 364

Query: 358 VLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNA 417
           +LKT  + ++     ++Q+PLC  CL+KVRQTC+IFAFLRSLKSG W LE VT+S  +  
Sbjct: 365 MLKTQTRNDDDTLSITNQYPLCQACLIKVRQTCDIFAFLRSLKSGVWQLEKVTLSTISKG 424

Query: 418 FSVQTNSVSNSPTLESPPDKMKPD-------RKSKRMSFMAGLSKTLPLKTSYTVESASP 470
                     S  L+   ++ K +       +K KR S ++ L K+    +SY       
Sbjct: 425 --------DTSSFLKVAENQFKQNEKATAQEKKQKRKSIISSLGKS---HSSYVNAKLDC 473

Query: 471 CPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVG 530
             E +  P+TNIQRAW QLCKLRS LHW+HIGI   ED V +   PV       N+ +V 
Sbjct: 474 TVEPVGLPSTNIQRAWLQLCKLRSILHWSHIGISNTEDCVTSTFAPVAT-----NNKVVA 528

Query: 531 DGLVPEL 537
           D L P L
Sbjct: 529 DKLEPSL 535

>ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weakly
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 779

 Score =  412 bits (1058), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 222/554 (40%), Positives = 318/554 (57%), Gaps = 36/554 (6%)

Query: 2   TEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLEQ 61
           +E EES+R            IESI++QS LE++L QA K+I     ++Q YE L++   +
Sbjct: 5   SEVEESRRVSTQIMSLSTQLIESIERQSTLEKELNQANKIIEGHGGAMQEYEKLKKNFAE 64

Query: 62  AESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADARR 121
            E    ++ +Q  K++EEL+  +  +  A+   D+LN EVE+LTASLFDEANNMVADAR+
Sbjct: 65  LEKRESNKDAQLNKLREELRKQKEARTEADSNADKLNHEVEELTASLFDEANNMVADARK 124

Query: 122 ETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXXX 181
            +H+ +++N+                     +LKKV+  L+++S   + S Q        
Sbjct: 125 ASHATELRNAKLVEQLHERDALLETLNLQLRHLKKVIQTLDDDS---MASEQVKTLANAS 181

Query: 182 XXXXXXXXLEKTMNALNGTAXXXXXXXXXX-XXXXXRYDLVLYNEFLKFIAALPQCASIR 240
                   L K +++ +G                  RYDL LY+EFLKF+A LP    I+
Sbjct: 182 DNANLAASLSKNLSSSHGRQIEAPLGPIFSPNITAVRYDLGLYHEFLKFLAVLPDYQDIK 241

Query: 241 DSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRV 300
           D+ S SKLLRRL++DEIQPVL+L+NASG+GW L+R L++LMI+G + VEP+SG+NE ++ 
Sbjct: 242 DTASDSKLLRRLVNDEIQPVLKLENASGLGWILKRTLVNLMIEGLVAVEPISGLNEMHQY 301

Query: 301 GHMSSQVEAVPQFQGPEQQS----------------RPH-----------LYNYPADSPP 333
           G+ S  +    +  G    S                R H           L+NYP+DSPP
Sbjct: 302 GYASPMLNQHSKMGGNNSNSLENSPATTSNTSTTTKRNHSRSSSMTKSLNLFNYPSDSPP 361

Query: 334 VAIESPCSFCSESRNDILEHGRLYVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIF 393
           VA+   C+ C E R+D++EH RL++LKT  + ++G    ++ FPLC YC+LK+RQTCEIF
Sbjct: 362 VALREKCAICGECRDDLVEHARLHILKTQSRADDGTVTVNNTFPLCKYCVLKIRQTCEIF 421

Query: 394 AFLRSLKSGAWHLEAVTISKTNNAFSVQTNSVSNSPTLESPP--DKMKPDRKSKRMSFMA 451
           AFLRSLK GAW LE V+++  +   S + + VS   + E  P  D  K +RK+ R SFMA
Sbjct: 422 AFLRSLKLGAWKLEKVSLTSVSKGDSKEFSQVSMVNSNEDKPNRDSKKENRKTARKSFMA 481

Query: 452 GLSKTLPLKTSYTVESASPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVE 511
           G++      T+ T E       Q   PTTNIQ AW QLC+LRS LHW HIGIW ++D + 
Sbjct: 482 GMNALNSKNTTVTPEVPV---SQAGAPTTNIQWAWIQLCRLRSMLHWTHIGIWNVDDCIT 538

Query: 512 TKVGPVVAVDRPGN 525
           +K+GP+V  D   N
Sbjct: 539 SKIGPLVINDGSNN 552

>KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}
           Anc_1.81 YNL272C
          Length = 654

 Score =  377 bits (968), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/529 (37%), Positives = 300/529 (56%), Gaps = 37/529 (6%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLEQAES 64
           +ESKR            +ESI  QS LEE+L +A K  A+ +E   +Y++L+ ++ + E+
Sbjct: 17  DESKRISLQITSMSTQLMESIQNQSLLEEKLNRANKAAAALKEQTVHYDELKGRVAKLEA 76

Query: 65  NLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADARRETH 124
           +L +   +   ++  L   +S +  ++  ++ L  EVEDLTASLF EANNMVADAR+E H
Sbjct: 77  SLTNRDEEMAALKSALAEEKSKRAASDKSVEELQSEVEDLTASLFSEANNMVADARKEKH 136

Query: 125 SVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXXXXXXXXX 184
           + ++ N                      +L+K+L  ++  S                   
Sbjct: 137 TTEILNRKLLEAVNEKDNALETMKIQLKHLRKMLEKVDVGS-------------PSATGR 183

Query: 185 XXXXXLEKTMNALNGTAXXXXXXXXXXXX---------XXXRYDLVLYNEFLKFIAALPQ 235
                 +   N+L G                          RYDL LY+EFLKF+ +LP+
Sbjct: 184 SSMTSADTDTNSLKGIVTRSSNQSQSDTAPLVVYSPSVGSVRYDLSLYSEFLKFLVSLPR 243

Query: 236 CASIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGIN 295
           C  IRD+ S SKL+RRLI+DEI P+LR+D+A GIGW  +++LM++M++G +++EP SG+N
Sbjct: 244 CTQIRDTESESKLVRRLINDEIAPILRIDSAPGIGWMAKKSLMNVMLEGMVIIEPNSGVN 303

Query: 296 ETYRVGHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGR 355
           E Y+ GH S  +      Q    +S+PHL++YPADSPP+A    C+ C ESR+DI EH R
Sbjct: 304 ENYQHGHSSPSIS-----QHSLGKSQPHLFSYPADSPPIASFESCALCGESRSDIYEHER 358

Query: 356 LYVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTN 415
           L+ +K  QK ++G  E  + +PLC +CLL+VRQTCEIF+FLRSLK+G W LE +    + 
Sbjct: 359 LHKMKIQQKRDDGTLEVVNLYPLCLWCLLRVRQTCEIFSFLRSLKTGVWGLETIKTRGSP 418

Query: 416 NAFSVQTNSVSNSPTLESPPDKMKPD-RKSKRMSFMAGLSKTLPLKTSYT------VESA 468
            +   +   ++N+P      +K K    ++KRMS+MAGL    P  +S        +E +
Sbjct: 419 TSAKSKKFDLNNAPIRR---NKTKNSANRTKRMSWMAGLGLNTPTSSSSAPNDVSLMEPS 475

Query: 469 SPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPV 517
           +   ++   P TNI+RAW QLCKLRS LHWAHIGIW++ D ++ K+GP+
Sbjct: 476 TTFTDKNGLPNTNIKRAWLQLCKLRSILHWAHIGIWSVSDALDLKIGPI 524

>TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa]
           {ON} Anc_1.81 YNL272C
          Length = 795

 Score =  357 bits (916), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 212/549 (38%), Positives = 299/549 (54%), Gaps = 42/549 (7%)

Query: 1   MTEEE---ESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQ 57
           M+E+E   ES+R            +ESI KQS LE++L QA K +A+Q+ +++    ++ 
Sbjct: 1   MSEQEIADESQRVTDQVTLLSTQLMESISKQSQLEDKLNQANKKLAAQKLTIEKNSQIKA 60

Query: 58  QLEQAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVA 117
                + N     SQ      EL   R  +  AEGE   LNKEVEDLTASLFDEAN+MVA
Sbjct: 61  TGSALQKNANDLESQLKIANAELVKERQLREKAEGECTALNKEVEDLTASLFDEANHMVA 120

Query: 118 DARRETHSVQVKNSXXXXXXXXXXXXXXXXXXXXXNLKKVLYNLEEESNDRLKSNQXXXX 177
           DAR+E  +V+++N+                     NLKKVL   ++E ++  K N     
Sbjct: 121 DARKEKAAVELRNTKLMEQLKEKDTVLETLELQLKNLKKVLQEFQDEDSNN-KRNSMLSE 179

Query: 178 XXXXXXXXXXXXLEKTMNALNGTAXXXXXXXXXXXXXXXRYDLVLYNEFLKFIAALPQCA 237
                           ++  N  +               RYDL LY EFLKF+A LP   
Sbjct: 180 VTIHSGSSQRAGSPTIISTTN--SESFANIIYSPNISDIRYDLPLYGEFLKFVAVLPFVK 237

Query: 238 SIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINET 297
           +I+ +T+ SKLLRRL++DEIQPVLRLDNA G+GW ++R L++ M++G ++VEP+SG+NE 
Sbjct: 238 NIKQTTNDSKLLRRLVNDEIQPVLRLDNADGLGWVVKRTLLTQMMEGLVMVEPLSGVNEL 297

Query: 298 Y-----RVGHMSSQVEAVPQ------FQGPEQQSRPHLYNYPADSPPVAIESPCSFCSES 346
           Y     R    S+      +        G   Q   HL+N+P +SPPVA+  PC+FC+E 
Sbjct: 298 YTHSRNRRSATSNNTTGSTRDISGKDTNGSSNQKNSHLFNFPTNSPPVAVHEPCAFCNEK 357

Query: 347 RNDILEHGRLYVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHL 406
           R+D ++H R+++LKT  + E G    ++QFPLC  C+LKVRQT EIFAFLRSL  G W L
Sbjct: 358 RDDSVQHARIHLLKTQSRSETGKITVTNQFPLCQSCVLKVRQTGEIFAFLRSLALGTWKL 417

Query: 407 EAVTISKTNNAFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVE 466
           E + I+  + +   +      SPT +      K  +K+KR SF+ GL+     +T+  + 
Sbjct: 418 EKIAIANLSKSDPTKIKGSPASPTKDK----EKEKKKAKRKSFIKGLNMA---QTASVLN 470

Query: 467 SASPCP--EQITT----------------PTTNIQRAWAQLCKLRSSLHWAHIGIWTLED 508
            A+  P  +Q  T                PTTNIQRAW QLCKLR  LHW+H+GIW+L+D
Sbjct: 471 PATSNPFFQQTQTNPVGDTSLTDVDTFGQPTTNIQRAWLQLCKLRCMLHWSHMGIWSLDD 530

Query: 509 VVETKVGPV 517
            +E K  P+
Sbjct: 531 SIEAKFAPL 539

>Kpol_1075.6 s1075 complement(21190..21867) [678 bp, 225 aa] {ON}
           complement(21190..21867) [678 nt, 226 aa]
          Length = 225

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 35/52 (67%), Gaps = 2/52 (3%)

Query: 241 DSTSYSKLLRRLIHDEIQPVLR--LDNASGIGWYLRRNLMSLMIDGSIVVEP 290
           D+T  +KLL RL  DE++ +++  +D +S + +Y  +N + L ++ SI+++P
Sbjct: 6   DNTQINKLLDRLNDDELRRLIKYNVDKSSTLAFYCEKNNLKLTVEESIIIDP 57

>Skud_5.47 Chr5 (68654..71560) [2907 bp, 968 aa] {ON} YEL043W (REAL)
          Length = 968

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 41  VIASQRESLQNYEDLRQQLEQAESNLKSERSQNIKIQEEL----QAARSGKLTAEGEIDR 96
           V++ Q   LQ++++ R +LE    NLK+  S  I +++ L    ++  + KL  + +I++
Sbjct: 236 VLSQQTSLLQDFQESRSELELELDNLKTHWSHEIDLRKSLKSNIKSLENSKLLTDLKIEK 295

Query: 97  LNKEVE 102
           LNK+V+
Sbjct: 296 LNKKVD 301

>SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa]
           {ON} similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1297

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 44/82 (53%), Gaps = 4/82 (4%)

Query: 26  DKQSHLEEQL---LQARKVIASQRESLQ-NYEDLRQQLEQAESNLKSERSQNIKIQEELQ 81
           DK++  +++L    Q +  I S+  +L+ +Y+   QQ E+ ES L   R     +Q+EL 
Sbjct: 593 DKKARAQQELQRVTQLKTSIESKLATLRASYDQEVQQTEKVESLLLQSRKDTETLQQELS 652

Query: 82  AARSGKLTAEGEIDRLNKEVED 103
            A +     EG++  L KE++D
Sbjct: 653 VAEANYHAVEGKLTELQKELQD 674

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 63/113 (55%), Gaps = 14/113 (12%)

Query: 26  DKQSHLEE-QLLQARKVIASQRESLQNYEDLRQQLEQAESNLKSERSQNIKIQE-ELQAA 83
           DK+ HLE  Q+L ++  + SQRE    YE   +QLE  E  LKS  S   +IQE +LQA 
Sbjct: 390 DKEYHLEYVQVLLSQ--LESQREY---YESKLRQLEINEEELKSVHSLQQQIQELKLQAV 444

Query: 84  RSGKLTAEGEIDRLNKEVED---LTASL---FDEANNMVADARRETHSVQVKN 130
            + +  +E +++ + K++E+   L+ +L    D  +N + D +++     ++N
Sbjct: 445 VT-RSKSEHKVNEMRKQLEEERLLSRALQKNLDHLSNTIGDLQKQQEQSVIEN 496

>Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON}
           YOR216C (REAL)
          Length = 485

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 22/107 (20%)

Query: 42  IASQRESLQNYEDLRQQLEQAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEV 101
           I+S +      ++ ++QLE+ +  L    SQN+K++++L+A +      +  I  +NKE+
Sbjct: 145 ISSMKSIFNKMKESQKQLEEVQEQLTEYESQNLKLKKKLEATKIENSELQSTIVTINKEL 204

Query: 102 EDL-----------------TASLFDEANNMVADARRETHSVQVKNS 131
           E+L                   +L DE  NM+     ETHS ++K S
Sbjct: 205 ENLEKEQESAEDIFLEYESKIEALQDEQRNMI-----ETHSKELKAS 246

>KNAG0F00870 Chr6 complement(157306..158928) [1623 bp, 540 aa] {ON}
           Anc_2.16 YNL225C
          Length = 540

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 55  LRQQLEQAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLT----ASLFD 110
           ++ +L+ AE NLK  +  NIK++ EL  ARS   T   +I + N  ++ L      +LFD
Sbjct: 208 VQSKLDMAEMNLKQSQENNIKLETELNEARSEIRTKNEKISKSNARMKILDYIEGVTLFD 267

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.125    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,581,028
Number of extensions: 2785002
Number of successful extensions: 14997
Number of sequences better than 10.0: 419
Number of HSP's gapped: 15525
Number of HSP's successfully gapped: 588
Length of query: 733
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 616
Effective length of database: 40,065,477
Effective search space: 24680333832
Effective search space used: 24680333832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 70 (31.6 bits)