Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F02332g1.80ON46946922380.0
Kwal_33.133861.80ON46946817490.0
SAKL0C02574g1.80ON47346614850.0
Ecym_10841.80ON49542713570.0
TDEL0C062101.80ON47946712301e-166
KLLA0C02277g1.80ON46545212071e-163
ZYRO0F16720g1.80ON49242311971e-161
Suva_5.31.80ON48343311691e-157
YEL064C (AVT2)1.80ON48043311571e-155
Skud_5.251.80ON48343311491e-153
AFR671W1.80ON48844611481e-153
NCAS0J018401.80ON44543111371e-152
NDAI0I001301.80ON44443610851e-144
Smik_5.231.80ON48343610851e-144
KNAG0C007801.80ON5134588581e-109
Kwal_27.107027.420ON4673091891e-14
ZYRO0B04026g7.420ON4363311792e-13
KLTH0C06006g7.420ON4453081766e-13
YBL089W (AVT5)7.420ON4593261722e-12
TDEL0C028207.420ON4543531678e-12
SAKL0F13134g7.420ON5103701661e-11
Smik_2.317.420ON4593271633e-11
Kpol_1045.207.420ON4663361623e-11
KNAG0B021907.420ON4613621606e-11
Suva_2.287.420ON4593061589e-11
CAGL0H04587g7.420ON4452811571e-10
KAFR0L019107.420ON4453021552e-10
SAKL0G11462g5.252ON6164241562e-10
Suva_5.2407.420ON4483211508e-10
TBLA0F01390singletonON4282791482e-09
Smik_5.2647.420ON4483111463e-09
Skud_5.2607.420ON4483211454e-09
Skud_2.197.420ON4593091446e-09
TPHA0C034602.295ON4731901436e-09
Ecym_71337.420ON4573211437e-09
NDAI0E040107.420ON4713081437e-09
YER119C (AVT6)7.420ON4483111428e-09
Skud_11.815.252ON7123561412e-08
CAGL0G03619g7.420ON4603121382e-08
KLLA0E06931g7.420ON4563551383e-08
NCAS0F023105.252ON6682861375e-08
TPHA0K006707.420ON4643371356e-08
NCAS0B062102.295ON4811171331e-07
TBLA0C030305.252ON5232801285e-07
Smik_11.905.252ON6803001285e-07
CAGL0M06611g2.295ON4851031268e-07
Suva_9.1122.295ON4912011251e-06
YKL146W (AVT3)5.252ON6922971261e-06
ZYRO0A10538g5.252ON6084271251e-06
KAFR0H036605.252ON6464141242e-06
Suva_11.795.252ON7193541242e-06
KNAG0H023305.252ON6434331223e-06
Skud_9.862.295ON4902021204e-06
NDAI0B035102.295ON4962031204e-06
AGL285C7.420ON4402891196e-06
ZYRO0A02112g2.295ON4671971179e-06
Smik_9.972.295ON4901211171e-05
Kpol_505.52.177ON6873241171e-05
CAGL0E06468g5.252ON6814451161e-05
Kwal_23.28395.252ON6142791161e-05
Kpol_1003.442.295ON4702631152e-05
YIL088C (AVT7)2.295ON4901291152e-05
TPHA0B025305.252ON5964501152e-05
TDEL0E037405.252ON6132871142e-05
SAKL0E07392g2.295ON4721621133e-05
SAKL0E10362g2.177ON7334631109e-05
NCAS0E024407.420ON4951921062e-04
KNAG0A053802.295ON4741171062e-04
ZYRO0B09548g2.177ON7184251062e-04
TDEL0G022502.295ON4671141044e-04
KAFR0J013202.295ON4791221035e-04
TPHA0F017002.177ON4441681026e-04
KLTH0G07502g5.252ON6014171027e-04
KLLA0E08559g2.295ON4601631018e-04
NCAS0G026302.177ON7052091010.001
KLLA0E13795g5.252ON5734091000.001
TPHA0B029802.177ON7494081000.001
Ecym_82495.252ON627311980.002
Kpol_1032.885.252ON575191980.002
NDAI0C037905.252ON721292980.003
ADL205C2.295ON468163970.003
Smik_14.2242.177ON715330970.003
KLTH0D09042g2.177ON718208950.006
Kwal_27.114852.295ON471169930.007
TBLA0F03230singletonON561193930.008
TBLA0F014007.420ON453186910.014
KLTH0G10604g2.295ON468126890.022
AER380C2.177ON716437900.023
Skud_14.2292.177ON713329890.028
KNAG0C033807.420ON545198890.028
ACR051C5.252ON678285890.028
YNL101W (AVT4)2.177ON713329870.054
NDAI0F026602.177ON710478870.054
Kwal_26.84012.177ON720210840.10
Ecym_54082.177ON715141820.17
KAFR0D020002.177ON714332800.31
KLLA0C13277g2.177ON721344780.54
CAGL0G06622g2.177ON733177770.82
TDEL0F013202.177ON715446770.82
Ecym_33352.295ON474161760.93
Kpol_1029.62.177ON767449751.5
Smik_5.3228.207ON216078751.7
Suva_14.2382.177ON716207714.2
CAGL0B00770g1.35ON541125705.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F02332g
         (469 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {...   866   0.0  
Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {...   678   0.0  
SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {...   576   0.0  
Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}...   527   0.0  
TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1...   478   e-166
KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {...   469   e-163
ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} simi...   465   e-161
Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL0...   454   e-157
YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}  AV...   450   e-155
Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON} Y...   447   e-153
AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic ...   446   e-153
NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1....   442   e-152
NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80 ...   422   e-144
Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON} Y...   422   e-144
KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {O...   335   e-109
Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119...    77   1e-14
ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {...    74   2e-13
KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} simila...    72   6e-13
YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative...    71   2e-12
TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {O...    69   8e-12
SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]...    69   1e-11
Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)    67   3e-11
Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON} (42445....    67   3e-11
KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.4...    66   6e-11
Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)    65   9e-11
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    65   1e-10
KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {...    64   2e-10
SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} simila...    65   2e-10
Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON...    62   8e-10
TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {O...    62   2e-09
Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON...    61   3e-09
Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C ...    60   4e-09
Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)    60   6e-09
TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {O...    60   6e-09
Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar t...    60   7e-09
NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420     60   7e-09
YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}  ...    59   8e-09
Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W...    59   2e-08
CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {...    58   2e-08
KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} simila...    58   3e-08
NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {O...    57   5e-08
TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7....    57   6e-08
NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON} Anc_2...    56   1e-07
TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.2...    54   5e-07
Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W...    54   5e-07
CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa] ...    53   8e-07
Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON...    53   1e-06
YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuo...    53   1e-06
ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} simila...    53   1e-06
KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.2...    52   2e-06
Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W...    52   2e-06
KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.2...    52   3e-06
Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}...    51   4e-06
NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295     51   4e-06
AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON} S...    50   6e-06
ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {...    50   9e-06
Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}...    50   1e-05
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    50   1e-05
CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} simila...    49   1e-05
Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -...    49   1e-05
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    49   2e-05
YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}  ...    49   2e-05
TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.2...    49   2e-05
TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.2...    49   2e-05
SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} simila...    48   3e-05
SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {...    47   9e-05
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     45   2e-04
KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.2...    45   2e-04
ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {...    45   2e-04
TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {O...    45   4e-04
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    44   5e-04
TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {O...    44   6e-04
KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} simila...    44   7e-04
KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {...    44   8e-04
NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177     44   0.001
KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]...    43   0.001
TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.1...    43   0.001
Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar t...    42   0.002
Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa] ...    42   0.002
NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {O...    42   0.003
ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON} S...    42   0.003
Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101...    42   0.003
KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {...    41   0.006
Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088...    40   0.007
TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON}               40   0.008
TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {O...    40   0.014
KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {...    39   0.022
AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}...    39   0.023
Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101...    39   0.028
KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.4...    39   0.028
ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON} S...    39   0.028
YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuo...    38   0.054
NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {O...    38   0.054
Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {O...    37   0.10 
Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}...    36   0.17 
KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.1...    35   0.31 
KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} simi...    35   0.54 
CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {...    34   0.82 
TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.1...    34   0.82 
Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}...    34   0.93 
Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON} (11352.....    33   1.5  
Smik_5.322 Chr5 complement(481543..488025) [6483 bp, 2160 aa] {O...    33   1.7  
Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101...    32   4.2  
CAGL0B00770g Chr2 complement(68287..69912) [1626 bp, 541 aa] {ON...    32   5.3  

>KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 469

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/469 (92%), Positives = 432/469 (92%)

Query: 1   MSKDPFNEPFIQGRGSHDQRGPLGDNFELSSFDRSTEVRPERLSVDSEDRFTSTFLHEQR 60
           MSKDPFNEPFIQGRGSHDQRGPLGDNFELSSFDRSTEVRPERLSVDSEDRFTSTFLHEQR
Sbjct: 1   MSKDPFNEPFIQGRGSHDQRGPLGDNFELSSFDRSTEVRPERLSVDSEDRFTSTFLHEQR 60

Query: 61  SKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLRI 120
           SKSNILMAFMNMANSILGAGIIGQPFAVKNC                DWTIRLIVVNLRI
Sbjct: 61  SKSNILMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAIVLLSLLVDWTIRLIVVNLRI 120

Query: 121 SGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLF 180
           SGKTTYQDSVELAMGRKGKLLILLSNGLFA            DTIPHVLRAFFSGHDNLF
Sbjct: 121 SGKTTYQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCIIIGDTIPHVLRAFFSGHDNLF 180

Query: 181 HRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPGTDSAYKGSFN 240
           HRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASM         KGPGTDSAYKGSFN
Sbjct: 181 HRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMVVIVVIVVIKGPGTDSAYKGSFN 240

Query: 241 SSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLM 300
           SSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLM
Sbjct: 241 SSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLM 300

Query: 301 GFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFN 360
           GFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFN
Sbjct: 301 GFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFN 360

Query: 361 SEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVN 420
           SEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVN
Sbjct: 361 SEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVN 420

Query: 421 LKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYINGGDQKHCET 469
           LKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYINGGDQKHCET
Sbjct: 421 LKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYINGGDQKHCET 469

>Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {ON}
           YEL064C - Hypothetical ORF [contig 118] FULL
          Length = 469

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/468 (71%), Positives = 374/468 (79%)

Query: 1   MSKDPFNEPFIQGRGSHDQRGPLGDNFELSSFDRSTEVRPERLSVDSEDRFTSTFLHEQR 60
           MSK+  NE  IQ     D+   LG +F+LSSFDR+++   ERL   SED  T+ FL E R
Sbjct: 1   MSKEAANEASIQEETFSDRDELLGSSFQLSSFDRNSQRNSERLIDGSEDESTTAFLRENR 60

Query: 61  SKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLRI 120
           SKSNI MAFMNMANSILGAG+IGQPFA+KNC                DWTIRLIVVN++I
Sbjct: 61  SKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKI 120

Query: 121 SGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLF 180
           +GKTTYQDSVE AMGRKGKLLILLSNGLFA            DTIPHVLRAFF GH+NLF
Sbjct: 121 TGKTTYQDSVEFAMGRKGKLLILLSNGLFAFGGCVGFCIIIGDTIPHVLRAFFPGHENLF 180

Query: 181 HRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPGTDSAYKGSFN 240
           HRNI+I++VTC ISFPLSLNR+ISKLSKASMLAL SM         KGP  D AYKGSFN
Sbjct: 181 HRNIIIILVTCFISFPLSLNRNISKLSKASMLALVSMVFIVVIVLVKGPMIDDAYKGSFN 240

Query: 241 SSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLM 300
           ++ L  TPRIFQG+SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCF+AMIFCFLM
Sbjct: 241 TTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLM 300

Query: 301 GFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFN 360
           G+TGFLVFKD+TKGNILNNFPG+DN VNVARFCFGFNMLTTFPLEIFVLRDVI+D MFFN
Sbjct: 301 GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFN 360

Query: 361 SEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVN 420
           S+  +Q + LSLKLHVI++T LV  TM ISLTTCNLGALFEL GATTASLMAYILPP VN
Sbjct: 361 SKDTNQSQELSLKLHVILTTILVMTTMLISLTTCNLGALFELTGATTASLMAYILPPSVN 420

Query: 421 LKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYINGGDQKHCE 468
           L L+G     R+++PHY CI FGF IM++SS+QTII+YI GGDQKHCE
Sbjct: 421 LLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCE 468

>SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 473

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/466 (63%), Positives = 343/466 (73%), Gaps = 19/466 (4%)

Query: 21  GPLGD-NFELSSFDRSTEVRPERLS----------------VDSEDRFTSTFLHEQRSKS 63
            P+ D  FELSSFD+   ++P   S                 D ED   S  + E ++KS
Sbjct: 10  APVADLQFELSSFDQ--HMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKS 67

Query: 64  NILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLRISGK 123
           NI MAFMNMANSILGAGIIGQPFA+ NC                DWTIRLIVVNL+++GK
Sbjct: 68  NIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGK 127

Query: 124 TTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFHRN 183
           TTYQDSVE AMGR+GKLLIL +NGLFA            DTIPHVLRAFF  H  LFHRN
Sbjct: 128 TTYQDSVEFAMGRRGKLLILAANGLFAFGGCIGFCIIIGDTIPHVLRAFFPAHTALFHRN 187

Query: 184 IVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPGTDSAYKGSFNSSN 243
            +I  VT  +S+PLSLNRDISKLSKASMLALASM         KGP  D+AYKGS  +S 
Sbjct: 188 AIIFFVTLFVSYPLSLNRDISKLSKASMLALASMLLIVVIVIVKGPMLDAAYKGSLTASK 247

Query: 244 LLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFT 303
           L ITPRIFQG+SVISFALVCHHNTSFIYFSLK PSLKRF++LTH SC ++M+ CF+MG++
Sbjct: 248 LFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYS 307

Query: 304 GFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFNSEP 363
           GFLVFKDKTKGNILNNFP +DN +NVARFCFGFNMLTTFPLEIFVLRDV++DL  F+S  
Sbjct: 308 GFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGE 367

Query: 364 KSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKL 423
            + P  LS K HV +++ALVF TM +SLTTCNLGALFELIGATTAS+MAYILPP  NL L
Sbjct: 368 ATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLL 427

Query: 424 VGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYINGGDQKHCET 469
            G     R ++P+Y CI FGFA+M+ISSTQTI++ INGG+QKHCET
Sbjct: 428 TGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCET 473

>Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}
           similar to Ashbya gossypii AFR671W
          Length = 495

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/427 (60%), Positives = 309/427 (72%), Gaps = 1/427 (0%)

Query: 42  RLSVDSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXX 101
            L++  ED   S   +  R KSN+ MAFMNMANSILGAG+IGQPFA+KNC          
Sbjct: 69  ELNLQFEDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNCGLIGGVCLIV 128

Query: 102 XXXXXXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXX 161
                 DWTIRLIV+NL+++GKTTYQDSVE AMG KGKLLIL  NGLFA           
Sbjct: 129 LLTIIVDWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAFGGCVGFCIII 188

Query: 162 XDTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXX 221
            D+IPHVL+AFF  H  LF RN+VI VVT  IS+PLSLNR+ISKLSKASMLAL S+    
Sbjct: 189 GDSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNISKLSKASMLALVSLLLIV 248

Query: 222 XXXXXKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKR 281
                + P  +  YKG F      ITPR+FQG+S+ISFALVCHHNTSFI+FSLK PSLKR
Sbjct: 249 ALVIIRAPKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKR 308

Query: 282 FDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTT 341
           F  LTH SC I+M+ C + G+ GFL FKDKTKGNILNNFP NDN +N ARFCFGFNMLTT
Sbjct: 309 FGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTT 368

Query: 342 FPLEIFVLRDVIKDLMFFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFE 401
           FPLEIFVLRDV++DL++F S   S+  +L+ K H I+++ LVF +M+ISLTTCNLGAL E
Sbjct: 369 FPLEIFVLRDVVRDLLYFQSA-DSESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLE 427

Query: 402 LIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYING 461
           L+G+TTASL AYILPP   L L G     ++R P+Y CI FGF+IM++SSTQTI+S I G
Sbjct: 428 LVGSTTASLTAYILPPATTLALTGKTKTLKERTPYYACIMFGFSIMIVSSTQTILSAIYG 487

Query: 462 GDQKHCE 468
            + KHCE
Sbjct: 488 TEIKHCE 494

>TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1.80
           YEL064C
          Length = 479

 Score =  478 bits (1230), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 246/467 (52%), Positives = 312/467 (66%), Gaps = 14/467 (2%)

Query: 16  SHDQRGPLGDNFELSSFDRSTEVRPERLSVDSEDRFTST------------FLHEQRSKS 63
              +R PL   FEL  FD       E    DS +   S+             L +   KS
Sbjct: 12  EQSERIPLELEFELVDFDAKPGASDETEENDSNEAKASSSNSAIDESMVINLLRDNDKKS 71

Query: 64  NILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLRISGK 123
            +  AFMNMANSILGAG++GQPFA++NC                DWT+RLIV+NL ++GK
Sbjct: 72  TMRWAFMNMANSILGAGVVGQPFAIRNCGIIGGILAYIILVLLVDWTLRLIVINLTLAGK 131

Query: 124 TTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFHRN 183
            TYQD+VE A+GRKG++L+LLSNGLFA            DTIPH L++ F   +  F RN
Sbjct: 132 KTYQDTVEFALGRKGRILVLLSNGLFAFGGCIGFCIIIGDTIPHFLQSIFHSSNFFFRRN 191

Query: 184 IVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPGTDSAYKG-SFNSS 242
           +VI +VT  IS+PLSL R+I+ LSKAS LAL SM         +GP  D + KG  ++ +
Sbjct: 192 VVITIVTLFISYPLSLQRNIAALSKASFLALISMVVIVFSVVVQGPRVDMSLKGDKWSLT 251

Query: 243 NLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGF 302
           ++ I+  IF+G+SVISFALVCHHNTSFI+FS+K  SL++F RLTH S FI+MIFC LMG+
Sbjct: 252 DIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGY 311

Query: 303 TGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFNSE 362
           +G+ VF+DKTKGNILNNFP +D  +N+AR CFGFNMLTTFPLEIFVLRDVI   ++   E
Sbjct: 312 SGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLYGKKE 371

Query: 363 P-KSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNL 421
             +++   LS +   II+T  V  TM+ISLTTCNLGALFELIGATTAS MAYILPP+ NL
Sbjct: 372 EDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNL 431

Query: 422 KLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYINGGDQKHCE 468
            L      +R ++PHY+CI FGF +M++SSTQTII  + G DQ+HCE
Sbjct: 432 VLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQRHCE 478

>KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 465

 Score =  469 bits (1207), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 240/452 (53%), Positives = 305/452 (67%), Gaps = 8/452 (1%)

Query: 11  IQGRGSHDQRGPLGDNFELSSFDRSTE-----VRPERLSVDSEDRFTSTFLHEQRSKSNI 65
           +  + S ++  P     EL+SFD + +     V     +V+ ED  T        +KSN 
Sbjct: 14  LSDKQSKNEPNPF--ELELTSFDDTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEAKSNR 71

Query: 66  LMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLRISGKTT 125
            MAFMNMANSILG+G+IGQPFA+KNC                DWTIRLIV+NL+++GK+T
Sbjct: 72  YMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKST 131

Query: 126 YQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFHRNIV 185
           YQ SVE AMG+ G LLIL+SNGLFA            D+IPHVL AFF  H +LFHRN++
Sbjct: 132 YQASVETAMGQWGGLLILVSNGLFAFGGCVGFCIIIGDSIPHVLSAFFPSHTDLFHRNVI 191

Query: 186 IVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPGTDSAYKGSFNSSNLL 245
           I +VT  ISFPLSLNRDISKLSK SMLAL  +         K P     YKG+F+   L 
Sbjct: 192 ITLVTLFISFPLSLNRDISKLSKTSMLALLGLIAIVIIIVVKAPLVSGEYKGTFHLHQLF 251

Query: 246 ITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGF 305
           ITPRIFQG+SVISFALVCHHNTSFI+FSL+ PSLKRF++LTH S  ++ I C    ++GF
Sbjct: 252 ITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGF 311

Query: 306 LVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFNSEPKS 365
           L FKDKT GNILNNFP +DN +N AR   GFNMLTTFPLEIFVLRDVI+D++++N +   
Sbjct: 312 LNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKD-DP 370

Query: 366 QPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVG 425
           +P  L+ K+H +I++ LV   M I+L+T NLGAL E+IGAT+ASLMAYILPP  NL + G
Sbjct: 371 EPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITG 430

Query: 426 GNLKWRDRIPHYVCIGFGFAIMLISSTQTIIS 457
                ++++P+  CI FG  +M +S+ QTI+ 
Sbjct: 431 KKKSLKEKLPYCGCIVFGVILMFVSTAQTILE 462

>ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} similar
           to uniprot|P39981 Saccharomyces cerevisiae YEL064C AVT2
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 492

 Score =  465 bits (1197), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 232/423 (54%), Positives = 294/423 (69%), Gaps = 3/423 (0%)

Query: 46  DSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXX 105
           D++D F +  + E   KS +  AFMNMANSILGAG+IGQP A+KN               
Sbjct: 72  DNDDEFVNDVIRENNKKSTMKWAFMNMANSILGAGVIGQPIAIKNSGIVGAIIAYLVLFV 131

Query: 106 XXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTI 165
             DWT+RLIV+NL ++GK TYQD+V  AMG++G++ +L +NGLFA            DT+
Sbjct: 132 LVDWTLRLIVINLTLAGKKTYQDTVAFAMGKRGRIAVLTANGLFAFGGCIGFCIIIGDTL 191

Query: 166 PHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXX 225
           PHV RAF   +     R ++I +VT  IS+PL+L R+I+ LSKAS LAL SM        
Sbjct: 192 PHVFRAFIHQNSVFLSRRLIITIVTICISYPLALQRNIAALSKASFLALISMVIIVFTVI 251

Query: 226 XKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRL 285
            +GP    A +      ++L+TPRIF+G+SVISFALVCHHNTSFIYFS+K  SL++F+RL
Sbjct: 252 IRGPEIH-AKRDPLTWEDILVTPRIFRGISVISFALVCHHNTSFIYFSIKNRSLRKFNRL 310

Query: 286 THFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLE 345
           TH S  I+++FC +MGF+GF  F   TKGN+LNNF  +D AVN+AR CFGFNMLTTFPLE
Sbjct: 311 THISTSISVVFCMIMGFSGFAAFGQNTKGNVLNNFSADDKAVNIARLCFGFNMLTTFPLE 370

Query: 346 IFVLRDVIKDLMFFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGA 405
           IFVLRDVI   +    +P   P VLS   H II+T LVFGTM+ISL TCNLGA+FELIGA
Sbjct: 371 IFVLRDVIASFI-GGHQPNGDPNVLSKSNHFIITTILVFGTMSISLLTCNLGAIFELIGA 429

Query: 406 TTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYINGGDQK 465
           TTAS+MAYILPPWVNL L+  +  +R ++PH+ CI FGF+IMLISS QTI+  +NG D+K
Sbjct: 430 TTASMMAYILPPWVNL-LLTSDKTFRQKLPHFACIAFGFSIMLISSIQTILDTMNGTDEK 488

Query: 466 HCE 468
            CE
Sbjct: 489 QCE 491

>Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL064C
           (REAL)
          Length = 483

 Score =  454 bits (1169), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 236/433 (54%), Positives = 298/433 (68%), Gaps = 13/433 (3%)

Query: 46  DSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXX 105
           D++D+  +  L E   KS++ MAFMN+ANSILGAGII QPFA+KN               
Sbjct: 53  DTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGF 112

Query: 106 XXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTI 165
             DWT+RLIV+NL ++GK TYQ +VE  MG+KGKLLIL +NGLFA            DTI
Sbjct: 113 IVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTI 172

Query: 166 PHVLRAFFSGHDNLFH----RNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXX 221
           PHVLRA FS +D   H    RN++I++VT  ISFPLSL R+I  LSKAS LA+ SM    
Sbjct: 173 PHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIV 232

Query: 222 XXXXXKGPGTDSAYKG-SFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLK 280
                +GP     ++G +   S++ I   IF+ LSVISFALVCHHNTSFI+FS++  S+ 
Sbjct: 233 LTVVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 292

Query: 281 RFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLT 340
           +F +LTH S  I++I C LMG++GF  FK+KTKGN+LN+FPG D A+NVAR CFGFNMLT
Sbjct: 293 KFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLT 352

Query: 341 TFPLEIFVLRDVIKDL-----MFFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCN 395
           TFP+EIFVLRDV+ +L     +  N +  +Q   LS K H II++ LVF TM ISLTTCN
Sbjct: 353 TFPMEIFVLRDVVGNLLHECHLIKNYDEHTQ---LSNKQHTIITSMLVFITMGISLTTCN 409

Query: 396 LGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTI 455
           LGALFELIGATTAS MAYILPP+ NL L      W+ ++P+Y CI FGF IM++SSTQTI
Sbjct: 410 LGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTI 469

Query: 456 ISYINGGDQKHCE 468
           +  +NG D +HC+
Sbjct: 470 LDAVNGPDGQHCQ 482

>YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}
           AVT2Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 480

 Score =  450 bits (1157), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 241/433 (55%), Positives = 299/433 (69%), Gaps = 13/433 (3%)

Query: 46  DSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXX 105
           D +D   +  L E   KS++ MAFMN+ANSILGAGII QPFA+KN               
Sbjct: 50  DMDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGF 109

Query: 106 XXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTI 165
             DWT+RLIV+NL ++GK TYQ +VE  MG+KGKLLIL +NGLFA            DTI
Sbjct: 110 IVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTI 169

Query: 166 PHVLRAFFSGHDNLFH----RNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXX 221
           PHVLRA FS +D   H    RN++IV+VT  ISFPLS+ R+I  LSKAS LA+ SM    
Sbjct: 170 PHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIV 229

Query: 222 XXXXXKGPGTDSAYKG-SFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLK 280
                +GP     +KG S   S+  +   IF+ LSVISFALVCHHNTSFI+FS++  S+ 
Sbjct: 230 LTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 289

Query: 281 RFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLT 340
           +F RLTH S  I++I C LMG++GF VFK+KTKGN+LN+FPG D A+N+AR CFGFNMLT
Sbjct: 290 KFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLT 349

Query: 341 TFPLEIFVLRDVIKDL-----MFFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCN 395
           TFP+EIFVLRDV+ +L     +  N +  +Q   LS K HV+I+++LVF TM ISLTTCN
Sbjct: 350 TFPMEIFVLRDVVGNLLHECNLIKNYDEHTQ---LSGKQHVVITSSLVFITMGISLTTCN 406

Query: 396 LGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTI 455
           LGALFELIGATTAS MAYILPP+ NL L      W++R+P Y+CI FGF IM+ISSTQTI
Sbjct: 407 LGALFELIGATTASTMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFMIMIISSTQTI 466

Query: 456 ISYINGGDQKHCE 468
           I  +NG D +HC+
Sbjct: 467 IDAVNGSDGQHCQ 479

>Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  447 bits (1149), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 240/433 (55%), Positives = 299/433 (69%), Gaps = 7/433 (1%)

Query: 43  LSVDSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXX 102
           ++ D++D   ++ L E   KS++ MAFMN+ANSILGAGII QP A+KN            
Sbjct: 50  ITSDTDDPLVNSVLRENDKKSSMRMAFMNLANSILGAGIITQPVAIKNAGILGGLIAYIA 109

Query: 103 XXXXXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXX 162
                DWT+RLIV+NL ++GK TYQ +VE  MG+KGKLLIL +NGLFA            
Sbjct: 110 LGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIG 169

Query: 163 DTIPHVLRAFFSGHDNLFH----RNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMX 218
           DTIPHVLRA FS +D   H    RN++IV+VT  ISFPLSL R+I  LSKAS LA+ SM 
Sbjct: 170 DTIPHVLRAVFSQNDGEVHFWLRRNVIIVLVTIFISFPLSLKRNIEGLSKASFLAVISMI 229

Query: 219 XXXXXXXXKGPGTDSAYKG-SFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTP 277
                   +GP     +KG S    + L+   IF+ LSVISFALVCHHNTSFI+FS++  
Sbjct: 230 IIVLTVVIRGPMLPYDWKGHSLKWPDFLVKTTIFRSLSVISFALVCHHNTSFIFFSMRNR 289

Query: 278 SLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFN 337
           S+ +F RLTH S  I++I C LMGF+GF  FK+KTKGN+LNNFPG D A+NVAR CFGFN
Sbjct: 290 SVAKFTRLTHISIIISVICCGLMGFSGFAAFKEKTKGNVLNNFPGTDTAINVARLCFGFN 349

Query: 338 MLTTFPLEIFVLRDVIKDLMFFNSEPKS--QPRVLSLKLHVIISTALVFGTMAISLTTCN 395
           MLTTFP+EIFVLRDV+ + +      KS  +   LS K H II++ LVF TM+ISLTTCN
Sbjct: 350 MLTTFPMEIFVLRDVVGNSLHECHLIKSYDEHTQLSDKQHTIITSLLVFITMSISLTTCN 409

Query: 396 LGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTI 455
           LGALFELIG+TTAS MAYILPP+ NL L      W+ ++P+Y+CI FGF IM++SSTQTI
Sbjct: 410 LGALFELIGSTTASTMAYILPPYTNLLLTSKKKNWKAKLPYYLCICFGFMIMIVSSTQTI 469

Query: 456 ISYINGGDQKHCE 468
           +  ING D++HCE
Sbjct: 470 LDAINGADEQHCE 482

>AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL064C (AVT2)
          Length = 488

 Score =  446 bits (1148), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 231/446 (51%), Positives = 291/446 (65%), Gaps = 3/446 (0%)

Query: 24  GDNFELSSFDRSTEVRPERLSVDSEDRFTSTFLHEQRSKSNILMAFMNMANSI-LGAGII 82
           GD  EL  +   +        ++ ED      + E + K   +         + L     
Sbjct: 44  GDRIELIDYPTKSSTLSSGFDLE-EDSVLGAIVQESKGKVQYVYGLHEHGEQVSLELVWS 102

Query: 83  GQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLI 142
           G    +KNC                DWTIRLI++NL+++GKTTYQD+VE AMGR GK  +
Sbjct: 103 GSRLRLKNCGLLGGLVLTMLLTVIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAV 162

Query: 143 LLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRD 202
           L +NG+FA            D+IPHVLRAFF  +   F+RN++I +VT  +S+PLSLNR+
Sbjct: 163 LFANGMFAFGGCVGFCIIIGDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRN 222

Query: 203 ISKLSKASMLALASMXXXXXXXXXKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALV 262
           ISKLSKASMLAL S+         +GP   + Y+GSF+   L + PR+FQG+SVISFALV
Sbjct: 223 ISKLSKASMLALVSLLLIVVIIVVRGPTVGNDYRGSFDLEELFVKPRLFQGISVISFALV 282

Query: 263 CHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPG 322
           C HNTSFIYFSL+ PSL+RF+ LTH SC I+M+ C + G++GFL FK KTKGNILNNFP 
Sbjct: 283 CLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPS 342

Query: 323 NDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFNSEPKSQPRVLSLKLHVIISTAL 382
           +DN +N ARFCFGFNMLTTFPLEIFVLRDVI+DL+     PK +P  LS K H II+TAL
Sbjct: 343 SDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI-STETPKGEPLRLSTKRHFIITTAL 401

Query: 383 VFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGF 442
           V  TM ISLTTCNLGAL EL+G+TTASL AYILPP  NL L G     ++++PHY CI F
Sbjct: 402 VLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILF 461

Query: 443 GFAIMLISSTQTIISYINGGDQKHCE 468
           GF+IM+ISSTQ II+ I+      C+
Sbjct: 462 GFSIMVISSTQAIITAIHSDKSSQCD 487

>NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1.80
           YEL064C
          Length = 445

 Score =  442 bits (1137), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 231/431 (53%), Positives = 287/431 (66%), Gaps = 10/431 (2%)

Query: 46  DSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXX 105
           D+ +      + E   KSN+ MAFMNMANSILGAGII QP AVKN               
Sbjct: 16  DTSEELAKELIEENEKKSNVYMAFMNMANSILGAGIITQPLAVKNAGILGSIICYILLGF 75

Query: 106 XXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTI 165
             DWT+RL+V+N+ +S K TYQD+VE  MG+KGK LIL  NGLFA            DTI
Sbjct: 76  IVDWTLRLLVINITLSSKQTYQDTVEHVMGKKGKFLILGCNGLFALGGCIGFSIIIGDTI 135

Query: 166 PHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXX 225
           PHVLR FF+       RN+VI + T  IS+PLSL R+I+ LSKAS LAL SM        
Sbjct: 136 PHVLRIFFNSEK--ITRNMVIFLTTLFISYPLSLLRNIAALSKASFLALVSMVVIVFTVV 193

Query: 226 XKGPGTDSAYKGS-FNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDR 284
            +GP   S  KG   + S+L  +P +F+ LS+ISFALVCHHNTSFI+ S++  SL +F +
Sbjct: 194 IRGPALPSELKGEPLSHSSLFFSPSLFKSLSIISFALVCHHNTSFIFHSIRNKSLTKFTK 253

Query: 285 LTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPL 344
           LTH S FI++ FC LMG++GF +F DKTKGNILNNFP  DN +N+AR CFGFNMLTTFPL
Sbjct: 254 LTHISVFISVAFCMLMGYSGFFIFTDKTKGNILNNFPAKDNIINIARICFGFNMLTTFPL 313

Query: 345 EIFVLRDVIKDLMF---FNSEPKSQPRV--LSLKLHVIISTALVFGTMAISLTTCNLGAL 399
           EIFVLRDV+  ++         ++ P +  LS K H  I+T LVF +M ISL TCNLGAL
Sbjct: 314 EIFVLRDVVAVILLECHLVPSEENNPLLPYLSRKWHFCITTGLVFLSMGISLMTCNLGAL 373

Query: 400 FELIGATTASLMAYILPPWVNLKLVG--GNLKWRDRIPHYVCIGFGFAIMLISSTQTIIS 457
           FELIG+TTAS+MAYILPP+VNL L      L +  ++PHY CI FGF +M+ISST+TI+ 
Sbjct: 374 FELIGSTTASVMAYILPPYVNLLLRQQRNELSFTTKLPHYFCIFFGFTVMIISSTETILD 433

Query: 458 YINGGDQKHCE 468
            + G +QKHCE
Sbjct: 434 AVFGTEQKHCE 444

>NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80
           YEL064C
          Length = 444

 Score =  422 bits (1085), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 226/436 (51%), Positives = 279/436 (63%), Gaps = 10/436 (2%)

Query: 41  ERLSVDSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXX 100
           E   +   +      + E   KSNI MAF+NMANSILGAGII QP AVKN          
Sbjct: 10  EEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIY 69

Query: 101 XXXXXXXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXX 160
                  DWT+RL++ N+ +S K TY D+VE  MGRKGK LIL  NGLFA          
Sbjct: 70  IMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALGGCIGFCII 129

Query: 161 XXDTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXX 220
             DTIPHVLR F   H +   RN VI   T  IS+PLSL RDIS LS  S LAL SM   
Sbjct: 130 IGDTIPHVLRIFI--HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALISMTVI 187

Query: 221 XXXXXXKGPGTDSAYKGS-FNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSL 279
                  GP   +  KGS   SS+ + +P +F+ LS++SFALVCHHNTSFI+ S++  SL
Sbjct: 188 VMTVVVFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSL 247

Query: 280 KRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNML 339
            +F +LTH S FI++IFC +MG+ GF +F  KTKGNILNNFP N  A+N+AR CFGFNML
Sbjct: 248 TKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNML 307

Query: 340 TTFPLEIFVLRDVIKDLMFFNS-----EPKSQPRVLSLKLHVIISTALVFGTMAISLTTC 394
           TT PLE+FVLRDVI  ++  N      E K    +L+ K H I++T +VF TM++SL TC
Sbjct: 308 TTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTC 367

Query: 395 NLGALFELIGATTASLMAYILPPWVNLKLVGGN--LKWRDRIPHYVCIGFGFAIMLISST 452
           NLGALFEL+GATTAS+MAYILPP+VNL L      L  + +IPHY CI FGF +M++SS 
Sbjct: 368 NLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSF 427

Query: 453 QTIISYINGGDQKHCE 468
           QTI+  +   +QKHCE
Sbjct: 428 QTIVEALADNEQKHCE 443

>Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  422 bits (1085), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 237/436 (54%), Positives = 296/436 (67%), Gaps = 13/436 (2%)

Query: 43  LSVDSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXX 102
           ++ D++D   +  L E   KS++ MAFMN+ANSILGAGII QPFA+KN            
Sbjct: 50  IASDTDDTLVNKVLLENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLISYIA 109

Query: 103 XXXXXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXX 162
                DWT+RLIV+NL ++GK TYQ +VE  MG+KGKLLIL +NGLFA            
Sbjct: 110 LGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIG 169

Query: 163 DTIPHVLRAFFSGHDNLFH----RNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMX 218
           DTIPHVLRA FS  D   H    RN++I++VT  ISFPLSL R+I  LSKAS LA+ SM 
Sbjct: 170 DTIPHVLRAIFSQKDGDIHFWLRRNVIIIIVTIFISFPLSLKRNIEALSKASFLAVISMI 229

Query: 219 XXXXXXXXKGPGTDSAYKG-SFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTP 277
                   +GP     +KG S    +  +   IF+ LSVISFALVCHHNTSFI+FS++  
Sbjct: 230 IIVVTVVIRGPMLPYDWKGHSLQLRDFFVKTTIFRSLSVISFALVCHHNTSFIFFSMRNR 289

Query: 278 SLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFN 337
           S+ +F RLTH S  I++I C LMG++GF  FK+KTKGNILN+FPG D A+N+AR CFGFN
Sbjct: 290 SVAKFTRLTHISIIISVICCGLMGYSGFAAFKEKTKGNILNSFPGTDTAINIARLCFGFN 349

Query: 338 MLTTFPLEIFVLRDVIKDLM-----FFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLT 392
           MLTTFP+EIFVLRDV+ +L+       N +  +Q   LS K H++I++ LVF TM ISLT
Sbjct: 350 MLTTFPMEIFVLRDVVGNLLHECKIIKNYDEHTQ---LSGKQHIVITSLLVFITMGISLT 406

Query: 393 TCNLGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISST 452
           TCNLGALFELIGATTAS MAYILPP+ NL L      W  ++P Y+CI FGF IM+ISST
Sbjct: 407 TCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKSWSAKLPFYLCICFGFMIMIISST 466

Query: 453 QTIISYINGGDQKHCE 468
           QTI+  +NG D +HC+
Sbjct: 467 QTILDAVNGSDGQHCQ 482

>KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {ON}
           Anc_1.80 YEL064C
          Length = 513

 Score =  335 bits (858), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/458 (43%), Positives = 261/458 (56%), Gaps = 47/458 (10%)

Query: 46  DSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXX 105
           + E+   +  +     KS + MAFMNMANSILGAGII QPFAV+                
Sbjct: 21  ELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGF 80

Query: 106 XXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTI 165
             DWT+RLIV NL I+G  TYQ+SV +A+G  G+L ILL+NGLFA            DTI
Sbjct: 81  LVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTI 140

Query: 166 PHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXX 225
           PHVLR           RN VI+VVT LIS PLSL++ I +L +AS LAL SM        
Sbjct: 141 PHVLRTVCP--PQYIERNWVIIVVTLLISLPLSLSKKIKQLERASFLALVSMAVIVVTVA 198

Query: 226 XKGPGTDSAYKG--SFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFD 283
            +GP   S  K   S  +        IF+ +S++SFALVCHHNTSFI+ SL+  S+ +F+
Sbjct: 199 VRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFN 258

Query: 284 RLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFP 343
           RLTH+SC +++  C LMG+TGF  FK+KTKGN+LNNF G+D  +NVAR  FGFNMLTTFP
Sbjct: 259 RLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFP 318

Query: 344 LEIFVLRDVIKDLM------FFNSEPKSQPR----------------------------- 368
           LEIFVLR+V+ D+       ++       PR                             
Sbjct: 319 LEIFVLRNVVLDIWAGPTHRWYQHRRHHPPRGGHTATQQPPPPEPHGSSPARGPAGPHPG 378

Query: 369 -----VLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKL 423
                  S + H  ++  LV  TM ++L TCNLGAL E+IG+TT +L AYILPP  ++ L
Sbjct: 379 LPPDPEPSEQPHTAVTVVLVLATMGVALVTCNLGALLEVIGSTTGALTAYILPPLTHVLL 438

Query: 424 VGGNLK---WRDRIPHYVCIGFGFAIMLISSTQTIISY 458
                +    R+R+ H  C+ FG  +ML+S+TQT++ +
Sbjct: 439 TRRRPQPHTARERLGHCCCVVFGCTVMLVSTTQTLLDW 476

>Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119C -
           Hypothetical ORF [contig 33] FULL
          Length = 467

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 126/309 (40%), Gaps = 55/309 (17%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P +  A F+ H  L +RN  I +V  LI  PL   R +  L  ASM+A++S+     
Sbjct: 127 DLMPRIF-ATFTSHSLLLNRNFHITLVMALIVSPLCFMRRLDSLRYASMIAVSSVAYLCV 185

Query: 223 XXXX------------KGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFI 270
                           KG  +     GSF++        +     +  FA  CHHN   I
Sbjct: 186 LVVVHFLFPSEELRELKGYVSIQKPAGSFSA--------LLSCFPIFVFAYTCHHNMFSI 237

Query: 271 YFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVA 330
              L+  SLK   ++   S  ++M    L+G +G+  F D   GNI+  +P       + 
Sbjct: 238 INELRDNSLKGIYKVCAISVALSMTLYLLIGGSGYATFGDNVPGNIITLYP-QSTTTTIG 296

Query: 331 RFCFGFNMLTTFPLEIFVLRDVI------------------------------KDLMFFN 360
           R      ++  FPL+    R  I                              +D+M   
Sbjct: 297 RVAIALLVMLAFPLQCHPARASIDHIIQYFSKASDNPLQNSEASHLISSPRVSEDVMAEE 356

Query: 361 SEPKSQPRVLSL--KLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPW 418
             P+ QP+V+ L  K  + I+  ++  +  ++++  +L  +  ++GAT ++ +++ILP  
Sbjct: 357 DSPQ-QPQVVPLEGKRFIAITAGILIFSFLLAISVTSLARVLAVVGATGSTSISFILPGI 415

Query: 419 VNLKLVGGN 427
              +L+G  
Sbjct: 416 FGYQLIGSE 424

>ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 436

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/331 (23%), Positives = 141/331 (42%), Gaps = 40/331 (12%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D IP +   F S +  L  RN  I +V   +  PL   + ++ L KAS++AL+S+     
Sbjct: 104 DLIPQIFTTFTS-NKILLERNFHITMVMLFLVSPLCFMKRLTSLRKASLVALSSVAYLCC 162

Query: 223 XXXXK--GPGTD-SAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSL 279
                   P  +    KG  +       P     L +  FA  CHHN   +Y   K  S 
Sbjct: 163 LVVVHFIWPSNEIDQRKGKVSIGFPRNEPTPLTTLPIFVFAYTCHHNAFSVYNEQKDTST 222

Query: 280 KRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNML 339
           ++ +++  +   IA +   ++G  G+L F D   GNI+  +P + +   + R      ++
Sbjct: 223 RQLNKIGRYGMSIAFVLYTIIGGAGYLTFGDHIAGNIITLYPPSLST-TIGRVAIVLLVM 281

Query: 340 TTFPLEIFVLRDVIKDLMF-FNSEPK-------------------SQ---PRVLSL--KL 374
             FPL+    R  I ++++ F S  K                   SQ   P V  L  K 
Sbjct: 282 LAFPLQCHPARSSINNILYSFQSVEKNLQGQTENSNLISEEESVESQAHGPPVPPLQGKR 341

Query: 375 HVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGG-------- 426
             +I+  ++  +  ++++  +L  L  ++G+T ++ +++ILP      L+G         
Sbjct: 342 FTVITLVILIASYLLAISVTSLARLLAIVGSTGSTSISFILPGIFGYWLIGSEYTPEELP 401

Query: 427 -NLKWRDRIPHYVCIGFGFAIMLISSTQTII 456
            NLK+       + I +GF +M+ S   +I+
Sbjct: 402 RNLKFAKFAGLLLAI-WGFIVMIASLAASIL 431

>KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 445

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 126/308 (40%), Gaps = 55/308 (17%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P +  A F+ H  L  RN+ I +V   +  PL   + +  L  ASM+A++S+     
Sbjct: 104 DLMPRIF-ATFTSHGLLLSRNLHITLVMLFVVSPLCFMKRLDSLRYASMVAISSVAYLCV 162

Query: 223 XXXX------------KGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFI 270
                           +G  +     GSF +        +     +  FA  CHHN   I
Sbjct: 163 LVLVHYVWPSDEIRELRGHVSLGKPVGSFAA--------LLSCFPIFVFAYTCHHNMFSI 214

Query: 271 YFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVA 330
              L+  SLK   +++  S  +AM    L+G +G+  F D   GNI+  +P    A  V 
Sbjct: 215 VNELRDNSLKGIYKVSIISVALAMSLYLLIGGSGYATFGDNVAGNIIMLYP-QSAATTVG 273

Query: 331 RFCFGFNMLTTFPLEIFVLRDVIKDLMFFNSEPKSQ------------------------ 366
           R      ++  FPL+    R  +  ++ +    KS                         
Sbjct: 274 RVAIALLVMLAFPLQCHPARASVDHILHYFGAGKSHEAAPSPSSESSQLIPSSDTEDIVV 333

Query: 367 ----PRVLSL-----KLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPP 417
               PR L++     K  + I+T+++  +  ++++  +L  +  ++GAT ++ +++ILP 
Sbjct: 334 EEGGPRQLAVMPLEGKRFIAITTSILLLSYLLAISVTSLARVLAVVGATGSTSISFILPG 393

Query: 418 WVNLKLVG 425
               +L+G
Sbjct: 394 IFGFQLIG 401

>YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative
           transporter, member of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 459

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/326 (22%), Positives = 131/326 (40%), Gaps = 60/326 (18%)

Query: 163 DTIPHVLRAFFSGHDN----------LFHRNIVIVVVTCLISFPLSLNRDISKLSKASML 212
           D +P ++++ F  +D+             R + I ++   +  PL   R ++ L  ASM+
Sbjct: 105 DLVPQIVQSIFYRNDDNMSGSQEHHMFLDRRLYITLIIVFVISPLCFKRSLNSLRYASMI 164

Query: 213 ALASMXXXXXXXXX---------KGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVC 263
           A+ S+                  +G        G   S + L T  IF       FA  C
Sbjct: 165 AIVSVAYLSGLIIYHFVNRHQLERGQVYFMVPHGDSQSHSPLTTLPIF------VFAYTC 218

Query: 264 HHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGN 323
           HHN   +       S K   R+  F+  +A     ++G TG++ F +   GNIL  +P N
Sbjct: 219 HHNMFSVINEQVDKSFKVIRRIPIFAIVLAYFLYIIIGGTGYMTFGENIVGNILTLYP-N 277

Query: 324 DNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMF----------------------FNS 361
             +  + R      ++  FPL+    R  +K+++                       FNS
Sbjct: 278 SISTTIGRLAMLLLVMLAFPLQCHPCRSSVKNIIIFIENFRKGKLYDNRASFIPLDNFNS 337

Query: 362 E-PKSQP----------RVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASL 410
           E P+  P          R  SL+   II+  ++  +  ++++  +L  +  ++GAT ++ 
Sbjct: 338 EDPQEAPTQQNNEEPNLRSESLRHINIITLCILLFSYLLAISITSLAKVLAIVGATGSTS 397

Query: 411 MAYILPPWVNLKLVGGNLK-WRDRIP 435
           +++ILP     KL+G       +R+P
Sbjct: 398 ISFILPGLFGYKLIGSEFTGTNERVP 423

>TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {ON}
           Anc_7.420 YER119C
          Length = 454

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 80/353 (22%), Positives = 141/353 (39%), Gaps = 68/353 (19%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D  P +   F S H  L  RN+ I ++   I  PL   + +S L  AS++AL S+     
Sbjct: 104 DLTPQIASVFTSNHL-LLDRNVHITLIMLFIVSPLCFLKRLSSLRYASLIALLSVAYLCV 162

Query: 223 XXXXK--GPGTD-SAYKGSF------NSSNLLITPRIFQGLSVISFALVCHHNTSFIYFS 273
                   P  +    KG        + +N L T  IF       FA  CHHN   +   
Sbjct: 163 LIFIHFVWPSEEIHDLKGHVSLWIPHDETNPLTTLPIF------VFAYTCHHNMFSVINE 216

Query: 274 LKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFC 333
            K  S +   ++  ++ F+A+    L+G  G+L F D   GNI+  +P    +  V R  
Sbjct: 217 QKDTSFRHIKKVAIYAMFLALSLYLLIGGMGYLTFGDHIIGNIIKLYP-QFASTTVGRIA 275

Query: 334 FGFNMLTTFPLEIFVLRDVIKDLMFFNSEPKS---------------------------- 365
               ++  FPL+    R  I  ++F+  E  S                            
Sbjct: 276 IVLLVMLAFPLQCHPARASINHILFYLQEHLSQSKQNTRTDNTANAVDEASTLIVNGDQE 335

Query: 366 -------------QPRVLSL--KLHVIISTALVFGTMAISLTTCNLGALFELIGATTASL 410
                        QP V+ L  +  VII+  L+  +  ++++  +L  +  ++G+T ++ 
Sbjct: 336 YMIDELIEEDSANQPPVVPLHGRKFVIITIFLLLASYLLAISVSSLARVLAVVGSTGSTS 395

Query: 411 MAYILPPWVNLKLVG-----GNLKWRDRIPHYVCIG---FGFAIMLISSTQTI 455
           +++ILP     +L+G     G+L ++ ++  Y  +    +G  +M    T T+
Sbjct: 396 ISFILPGIFGYQLIGSEVDSGSLPFKTKLFKYAGLALAVWGVVVMATCLTATL 448

>SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]
           {ON} similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 510

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 82/370 (22%), Positives = 146/370 (39%), Gaps = 84/370 (22%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P +   F S H+ L  RN  I VV   I  PL   + +  L  ASM+A++++     
Sbjct: 146 DLLPQIFSNFTS-HEILLERNFHITVVMIFIVAPLCFMKRLDSLRYASMIAISAVGYLCV 204

Query: 223 XXXXK----------GPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYF 272
                            GT S ++     +++L +  IF       FA  CHHNT  I  
Sbjct: 205 LVVAHFLFPSQEIKDLKGTVSLFRPKGLHTSMLSSFPIF------VFAYTCHHNTFSIVN 258

Query: 273 SLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARF 332
            LK  S++   ++   +  +A+     +G +G+  F D   GNI+  +P +  +  V R 
Sbjct: 259 ELKDNSVENVRKVVIGAMGLAVCLYIAIGGSGYGTFGDNIGGNIIMLYP-HSTSTTVGRI 317

Query: 333 CFGFNMLTTFPLEIFVLRDVIKDLMFF--------------------------------N 360
                ++  FPL+    R  I  ++                                  N
Sbjct: 318 AIVLLVMLAFPLQCHPARASINHIIHHLFEERRGGAQNGEERESNAASKNRTDESACNGN 377

Query: 361 SEPK---------------------SQPRVLSL---KLHVIISTALVFGTMAISLTTCNL 396
           SE                        QP+V+ L   K  VI S  L+F + A++++  +L
Sbjct: 378 SESSRLVQSTETSIPVDELIEECSARQPKVVPLEGRKFVVITSCILIF-SYALAVSVTSL 436

Query: 397 GALFELIGATTASLMAYILPPWVNLKLVG------GNLKWRDRIPHYVCIG---FGFAIM 447
             +  ++GAT ++ +++ILP     +L+G        + W+ R   Y+ +    +G  +M
Sbjct: 437 ARVLAVVGATGSTSISFILPGIFGYQLIGSEYENTSEMPWKTRWTKYIALALTCWGLVVM 496

Query: 448 LISSTQTIIS 457
           +   + T++S
Sbjct: 497 VTCLSATLLS 506

>Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/327 (22%), Positives = 129/327 (39%), Gaps = 62/327 (18%)

Query: 163 DTIPHVLRAFF----------SGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASML 212
           D +P ++++ F            H  L  R + I +V   +  PL   R ++ L  ASM+
Sbjct: 105 DLVPQIVQSIFYHNDDSTGGLQEHHRLLDRRLYITLVMMFVIAPLCFKRSLNSLRYASMI 164

Query: 213 ALASMXXXXXXXXXKGPGTDSAYKGSF--------NSSNLLITPRIFQGLSVISFALVCH 264
           A+ S+                  +G          +SS+  +T      L +  FA  CH
Sbjct: 165 AIISVAYLSGLIIYHFLNRHQLERGQVYFMVPHRDSSSHSPLTT-----LPIFVFAYTCH 219

Query: 265 HNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGND 324
           HN   +       + +   R+  F+   A I   ++G  G++ F +   GNIL  +P N 
Sbjct: 220 HNMFSVINEQTDKTFRILRRIPIFAISFAYILYLIIGGAGYMTFGENIVGNILTLYP-NS 278

Query: 325 NAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFF-----------------------NS 361
            +  + R      ++  FPL+    R  IK++  F                       + 
Sbjct: 279 ISTTIGRLAMLLLVMLAFPLQCHPCRSSIKNIFIFIEDFRKGRLHDNRTGFIPLDDFNSE 338

Query: 362 EPKSQ--------PRVLS---LKLHVIISTALVFG-TMAISLTTCNLGALFELIGATTAS 409
           EP  +        P + S      +VI    LVF   +AIS+T+  L  +  ++GAT ++
Sbjct: 339 EPHDELSQQSSEGPTLRSESQRHTNVITLCVLVFSYILAISITS--LAKVLAIVGATGST 396

Query: 410 LMAYILPPWVNLKLVGGNLKWR-DRIP 435
            +++ILP     KL+G     R +R+P
Sbjct: 397 SISFILPGLFGYKLIGSEFTNRNERVP 423

>Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON}
           (42445..43845) [1401 nt, 467 aa]
          Length = 466

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/336 (22%), Positives = 131/336 (38%), Gaps = 71/336 (21%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P VL  F + H+ L +RN+ I +V   I  PL   ++++ L  ASMLA++S+     
Sbjct: 104 DVLPQVLSTF-TNHEWLLNRNVNITLVMLFIVTPLCFLKNLNSLRYASMLAISSVAYLCA 162

Query: 223 XXXXK--GPGTDSA-YKGSF------NSSNLLITPRIFQGLSVISFALVCHHNTSFIYFS 273
                   P  ++  +KG        N  N L T      L +  FA  CHHN   +   
Sbjct: 163 LVLIHFIMPNDETHNFKGDVSWGLPKNGLNPLTT------LPIYVFAYTCHHNMFSVINE 216

Query: 274 LKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFC 333
              P+     ++   S  +A     L+G  G+L F D   GNI+  +P N  +  + R  
Sbjct: 217 QMDPTYNSVKKIAIISMILAGFLYILIGGAGYLTFGDHITGNIITLYPQNI-STTIGRIA 275

Query: 334 FGFNMLTTFPLEIFVLRDVIKDLMFF--------NSEPKS--------------QPRVL- 370
             F +   FPL+    R  I  ++ +        NS P                 P +L 
Sbjct: 276 IIFLVTLAFPLQCHPARASINHIIHYFKPAQDNKNSNPAGFSETTTLMDNQSPPPPAILQ 335

Query: 371 ---------------------------SLKLH----VIISTALVFGTMAISLTTCNLGAL 399
                                      ++ L      II+  ++     ++++  +L  +
Sbjct: 336 QITQDPLTIPTEELIEEEYPEQDHPFETIPLEQSQFTIITIGILVSAYFLAISVTSLARV 395

Query: 400 FELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIP 435
             ++GAT ++ +++ILP     +L+G   K  + +P
Sbjct: 396 LAIVGATGSTSISFILPGLFGYQLIGSEYKNFNEMP 431

>KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.420
           YER119C
          Length = 461

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 74/362 (20%), Positives = 148/362 (40%), Gaps = 67/362 (18%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P +  + ++ +  L +R+  I +V   I  PL   + ++ L  ASM+A++++     
Sbjct: 104 DLLPQI-WSVWTSNKLLLNRDFHITMVMIFIVAPLCFMKKLNSLRYASMIAISAVAYLCV 162

Query: 223 XXXX----KGPGTDSAY---KGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLK 275
                   + P  D+ +   KG  +       P I   L +  FA  CHHN   +     
Sbjct: 163 LVIYHFIFQDP-NDTHFQDLKGRISIGLPRDEPPILTTLPIFVFAYTCHHNMFSVINEQV 221

Query: 276 TPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFG 335
                   ++  +S  +A +   ++G++G+L F DK  GNI+  +P N ++  + R    
Sbjct: 222 DQKFNVITKIAKYSMSLAFLLYIVIGYSGYLTFGDKIVGNIVTLYPNNASS-TIGRIAIA 280

Query: 336 FNMLTTFPLEIFVLRDVIKDLMFF----------------------NSEPKSQP------ 367
             +  TFPL+    R  I  ++ F                      + E ++ P      
Sbjct: 281 ILVTLTFPLQCHPARASIHHIIHFFQARSAENGNGSAMVLNQMEGVSPELETTPLTDAAN 340

Query: 368 ----------------RVLSL--KLHVIISTALVFGTMAISLTTCNLGALFELIGATTAS 409
                           +V+ L  K  + I+  ++F +  ++++  +L  +  ++GAT ++
Sbjct: 341 CAEVDTAIEEGSPEELQVMPLEGKRFIFITCTILFCSYLLAVSVTSLAKVLAIVGATGST 400

Query: 410 LMAYILPPWVNLKLVGGNLKWRDRIPHY--------VCIG-FGFAIMLISSTQTIISYIN 460
            +++ILP     KL+G   +    +P          +C+  +G  +M+ S T T   + N
Sbjct: 401 SISFILPGIFGYKLIGSECETGAELPFQTKMFKYLGLCLAVWGLVVMVASLTATF--FFN 458

Query: 461 GG 462
            G
Sbjct: 459 AG 460

>Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 117/306 (38%), Gaps = 50/306 (16%)

Query: 176 HDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPGTDSAY 235
           H     R + I +V   +  PL   + ++ L  ASM+A+ S+                  
Sbjct: 128 HHMFLDRRLCISLVMMFVIAPLCFKKSLNSLRHASMIAIVSVAYLCGLIIFHFLYRSELE 187

Query: 236 KGSFNSSNLLITPRI-------FQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHF 288
           +G        +TP            L +  FA  CHHN   +       S K   R+   
Sbjct: 188 RGQV----YFMTPHQDAQSHSPLTTLPIFVFAYTCHHNMFSVINEQADKSFKILRRIPIL 243

Query: 289 SCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFV 348
           +  +A +   ++G TG++ F D   GNI+  +P N     + R      +   FPL+   
Sbjct: 244 AISLAYVLYVVIGGTGYMTFGDNIVGNIITLYP-NSIYTTIGRLAMLLLVTLAFPLQCHP 302

Query: 349 LRDVIKDLMFF----------------------------------NSEPKSQPRVLSLKL 374
            R  IK+++ F                                  N+E  + P   S + 
Sbjct: 303 CRSSIKNMIVFIKNLRKDKTDDSTAGFIPLDDLSSEDPQEEVAQQNNEQSNLPIESSRQT 362

Query: 375 HVIISTALVFG-TMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGNL-KWRD 432
           +VI    L+F   +AIS+T+  L  +  ++GAT ++ +++ILP     KL+G       D
Sbjct: 363 NVITLCILIFSYLLAISITS--LAKVLAIVGATGSTSISFILPGLFGYKLIGSEFTNSND 420

Query: 433 RIPHYV 438
           R+P  V
Sbjct: 421 RVPTRV 426

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/281 (20%), Positives = 111/281 (39%), Gaps = 35/281 (12%)

Query: 179 LFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPGTDSAY--- 235
           L  RN+ I +V   I  PL   R ++ L  ASM+A+ S+               +     
Sbjct: 118 LLSRNVNITLVMLFIVGPLCFMRRLNSLRYASMIAIGSVAYLCILVIVHFAHQTTELREL 177

Query: 236 KGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMI 295
           KG  +       P     L +  FA  CHHN   +    K         +   S  +A +
Sbjct: 178 KGEVSVGLPHGEPTPLTTLPIFVFAYTCHHNMFSVINEQKNTGFTYVRYIAIVSILVAFV 237

Query: 296 FCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKD 355
              ++G TG+L F D   GNI+  +P +  +  + R      ++  FPL+    R+ I +
Sbjct: 238 LYVVIGSTGYLTFGDNITGNIIALYP-DTLSTTIGRIAIVLLVMLAFPLQCHPARESINN 296

Query: 356 LMFFNSEPKS-------------------------------QPRVLSLKLHVIISTALVF 384
           ++ +  +  S                               +   +  K  +II+  ++F
Sbjct: 297 MIKYVQDRYSPQTSYELTAVDADNLEINNDVTSINSRANDKEEECMDTKRFMIITACILF 356

Query: 385 GTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVG 425
            +  ++++  +L  +  ++GAT ++ +++ILP +    L+G
Sbjct: 357 CSYLLAISVTSLARVLAIVGATGSTTISFILPGYFGWSLIG 397

>KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {ON}
           Anc_7.420 YER119C
          Length = 445

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 123/302 (40%), Gaps = 41/302 (13%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P +   F + H  L +R+  I ++   I  PL   R ++ L  ASM+A++++     
Sbjct: 104 DLMPQIFAVFTTSHI-LLNRDFHISLIMLFIVSPLCFLRKLNSLRYASMIAISAVAYLCV 162

Query: 223 XXXXKGP-GTDSAY--KGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSL 279
                    T+  +  KG  +       P     L +  FA  CHHN   +       + 
Sbjct: 163 LVVAHFIFQTEDVHDLKGVVSIGLPKHEPSPLTTLPIFVFAYTCHHNFFSVINEQSNIAF 222

Query: 280 KRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNML 339
               ++   +  +A +   L+GF+G+L F D   GNI+  +P   ++  + R    F ++
Sbjct: 223 THIKKIPIIAMILAYLLYILIGFSGYLTFGDNIVGNIITLYPRTASS-TIGRLAIVFLVM 281

Query: 340 TTFPLEIFVLRDVIKDLMFFNSEPKS------------------------------QPRV 369
             FPL+    R  I  +  +  E  S                              QP  
Sbjct: 282 LAFPLQCHPCRASIHHIWHYIQEKNSNEIATQPINVPPDEEDTLLAVELIEEDSPKQPEE 341

Query: 370 LSL---KLHVIISTALVFG-TMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVG 425
           + L   + ++I    L+F  T+AIS+ +  L  +  ++GAT ++ +++ILP     KL+G
Sbjct: 342 IPLRGKRFNIITVCILLFSYTLAISVNS--LAKVLAIVGATGSTSISFILPGIFGFKLIG 399

Query: 426 GN 427
             
Sbjct: 400 SE 401

>SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 616

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 101/424 (23%), Positives = 173/424 (40%), Gaps = 49/424 (11%)

Query: 57  HEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVV 116
              + K+ +    + +  S +G G++  P    N                  W   L++ 
Sbjct: 218 ERPQHKATVFKTIILLIKSFVGTGVLFLPKGFHNGGWGFSSVALLFCSVVSYWCFMLLIN 277

Query: 117 ---NLRISGKTTYQDSVELAMGRKGKLLIL----LSNGLFAXXXXXXXXXXXXDTIPHVL 169
               +R++G   Y D      GRK K  IL    LS   FA                  L
Sbjct: 278 TKNKIRVNG---YGDLGGQLYGRKMKFAILSSIVLSQIGFAAAYTVFTATN--------L 326

Query: 170 RAFFSGHDNLFHRNI---VIVVVTCLISFPLSLNRDISKLSKASMLA--------LASMX 218
           +AFF+   N+FH +    + +++  ++  PLSL R I+KLS   ++A        L    
Sbjct: 327 QAFFA---NIFHWDYPLAIYILLQMVVYIPLSLTRSIAKLSGTVLIADFFILVGLLYLYY 383

Query: 219 XXXXXXXXKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPS 278
                    G  +DS     FNSSN      +F G ++ ++  +       I  S+K P 
Sbjct: 384 YCAYYVSVHGIASDSMVL--FNSSNW----TLFIGTAIFTYEGIGLLIP--IQESMKQP- 434

Query: 279 LKRFDRLTHFSCFIAMIFCFL-MGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFN 337
            ++F R   F   + +   F+  G   +  F    K  IL NFP +       +F +   
Sbjct: 435 -EKFPRCL-FGVMLGITVIFISCGCLCYSAFGADVKTVILLNFPQDSIFTGGVQFSYALA 492

Query: 338 MLTTFPLEIFVLRDVIKDLMF-FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCN- 395
           +L + PL++F    ++++ +F  ++  K  P+V  LK +      +V  ++AI+    N 
Sbjct: 493 ILLSTPLQLFPAIRILENAVFPSHASGKHNPKVKWLKNY--FRCFVVIASVAIAWVGAND 550

Query: 396 LGALFELIGATTASLMAYILPPWVNLK-LVGGNLKWRDRIPHYVCIGFGFAIMLISSTQT 454
           L     L+G+     + YI PP ++ K   G N+   D +   V + FG AIM+  S QT
Sbjct: 551 LDKFVSLVGSLACIPLIYIYPPMLHYKAFRGTNISRHDLVLDQVVLWFGIAIMVYISLQT 610

Query: 455 IISY 458
           ++ +
Sbjct: 611 VLMW 614

>Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 67/321 (20%), Positives = 127/321 (39%), Gaps = 54/321 (16%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P ++ ++ +G+  L  RN+ I ++      PLS  + ++ L  ASM+A++S+     
Sbjct: 104 DLMPQIMSSW-TGNAWLLSRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCV 162

Query: 223 XXXXKG--PGTD-------SAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFS 273
                   P  +        +Y     S +L         L +  FA  CHHN   I   
Sbjct: 163 LVLVHYVVPSDEILRLKGRVSYLFPQQSHDL----NFLNTLPIFVFAYTCHHNMFSIINE 218

Query: 274 LKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFC 333
            K+   +   ++   S  +A+     +G  G+L F D   GNI+  +P   ++  V R  
Sbjct: 219 QKSVRFEHVMKIPLISISLALALYIAIGCAGYLTFGDNIIGNIIMLYPQTVSS-TVGRIA 277

Query: 334 FGFNMLTTFPLEIFVLRDVIKDLMFF---------------------------------- 359
               ++  FPL+    R  I  ++ +                                  
Sbjct: 278 IVLLVMLAFPLQCHPARASIHQILQYFTEENATTSTTSVAGRTVTNESSPLIRNNSIDIN 337

Query: 360 ---NSEPKSQPRVLSL--KLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYI 414
                EP  QP+   L  K  +II+  ++  +  ++++  +L  +  ++GAT ++ +++I
Sbjct: 338 EVIEEEPIYQPKDTPLRGKSFIIITCGILVASYCVAISVSSLAHVLAIVGATGSTSISFI 397

Query: 415 LPPWVNLKLVGGNLKWRDRIP 435
           LP     KL+G   K    +P
Sbjct: 398 LPGLFGYKLIGTEHKADIPLP 418

>TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 115/279 (41%), Gaps = 45/279 (16%)

Query: 177 DNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALAS---MXXXXXXXXXKGPGTDS 233
           DN +  N  I  V   I  PLS  R I+ L   S+LA+ S   +         K     S
Sbjct: 110 DNEYRMN-TITFVWLFIILPLSYLRKINALRYTSLLAVTSVFYLCILVTYHYCKPSEEIS 168

Query: 234 AYKGS---FNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSC 290
             +G+   F   +  I+P  F+ L +  FA  CHHN   +    K    KR   +   + 
Sbjct: 169 ELRGTVSLFLPKSSGISP--FKTLPIFVFAYTCHHNMFAVINEQKHTDFKRLKFIPLIAI 226

Query: 291 FIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLR 350
            IA I   ++G  G+  F      NI+  +P N     + +      +   +PL+    R
Sbjct: 227 SIACILYLIVGCLGYATFGANITSNIVAKYPTNSVLTVLGQTAMLTVVTLAYPLQCQPAR 286

Query: 351 DVIKDLMFF------------------------------NSEPK---SQPRVLSLKLHVI 377
             I ++++                                SEP+   S+P ++   LH I
Sbjct: 287 ASILNILYALFPKLKNNKSDVEEASMNDGYQVDLEENKQQSEPERIISEPSII---LHSI 343

Query: 378 ISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILP 416
           +++ ++FG+  I+++  +L  +  ++GAT ++ +++ILP
Sbjct: 344 VTSLILFGSWCIAVSVNSLAQVLAIVGATGSTFISFILP 382

>Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/311 (20%), Positives = 123/311 (39%), Gaps = 54/311 (17%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P ++ + ++ +  L  RN+ I ++      PL   + ++ L  ASM+A++S+     
Sbjct: 104 DLMPQIM-SVWTNNAWLLSRNVQISLIMLFFVTPLCFLKKLNSLRYASMIAISSVAYLCA 162

Query: 223 XXXXK--GPGTD-------SAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFS 273
                   P  D        +Y     S +L     +   L +  FA  CHHN   I   
Sbjct: 163 LVLVHYIAPSEDILRLRGQISYFFPPQSHDL----NVLNTLPIFVFAYTCHHNMFSIINE 218

Query: 274 LKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFC 333
            ++   +   ++   +  +A+I    +G TG+L F D   GNI+  +P   ++  V R  
Sbjct: 219 QRSSRFEHIMKIPLIAVSLALILYIAIGCTGYLTFGDNIIGNIIMLYPQTVSS-TVGRIA 277

Query: 334 FGFNMLTTFPLEIFVLRDVIKDLM------------------------------------ 357
               ++  FPL+    R  I  ++                                    
Sbjct: 278 IVLLVMLAFPLQCHPARASIHQILQHLERENITTSTTSVSGPTFANENSPLMGDRGLDIN 337

Query: 358 -FFNSEPKSQPRVLSL--KLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYI 414
                E   QP+  SL  K  V I+  ++  +  ++++  +L  +  ++GAT ++ +++I
Sbjct: 338 EVIEEESIYQPKETSLKGKSFVFITCGILLASYLVAISVSSLARVLAIVGATGSTSISFI 397

Query: 415 LPPWVNLKLVG 425
           LP     KL+G
Sbjct: 398 LPGLFGYKLIG 408

>Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C
           (REAL)
          Length = 448

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/321 (20%), Positives = 131/321 (40%), Gaps = 56/321 (17%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P ++ + ++ +  L  RN+ I ++   +  PLS  + ++ L  ASM+A++S+     
Sbjct: 104 DLMPQIM-SVWTRNAWLLSRNVQISLIMVFLVAPLSFLKKLNSLRYASMIAISSVAYLCV 162

Query: 223 XXXXK--GPGTDSAY-KGSFN------SSNLLITPRIFQGLSVISFALVCHHNTSFIYFS 273
                   P  +  + KG  +      S +L     I     +  FA  CHHN   I   
Sbjct: 163 LVLVHYIAPSEEILHMKGRISYFFPKQSHDL----NILNTFPIFVFAYTCHHNMFSIINE 218

Query: 274 LKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFC 333
            ++   +   ++   +  +A+I    +G  G+L F D   GNI+  +P   ++  V R  
Sbjct: 219 QRSSRFEHVMKIPLIAISLALILYVAIGCAGYLTFGDNIIGNIIMLYPQTTSS-TVGRVA 277

Query: 334 FGFNMLTTFPLEIFVLRDVIKDLM------------------------------------ 357
               ++  FPL+    R  I  ++                                    
Sbjct: 278 IVLLVMLAFPLQCHPARASIHQILQHFTEENATISTTSTSSPAPTNESSPLIRDNSLDIN 337

Query: 358 -FFNSEPKSQPRVLSL--KLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYI 414
                E   QP+   L  K  ++I+ A++  +  ++++  +L  +  ++GAT ++ +++I
Sbjct: 338 EVIEEESIYQPKETPLKGKSFIVITCAILIASYFVAISVSSLARVLAIVGATGSTSISFI 397

Query: 415 LPPWVNLKLVGGNLKWRDRIP 435
           LP     KL+G   + ++ IP
Sbjct: 398 LPGLFGYKLIGT--EHKEGIP 416

>Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 67/309 (21%), Positives = 120/309 (38%), Gaps = 52/309 (16%)

Query: 176 HDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPGTDSAY 235
           H  +  R + I ++   +  PL   + ++ L  ASM+A+ S+                  
Sbjct: 128 HHGILDRRLYISLIMLFVIAPLCFKKSLNSLRHASMIAIISVAYLSGLIIYHFLNRHQLE 187

Query: 236 KGSFNSSNLLITPRIFQG------LSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFS 289
           +G       ++  R  +       L +  FA  CHHN   +         +   R+   +
Sbjct: 188 RGQVY---FMVPHRDTESHAPLTTLPIFVFAYTCHHNMFSVINEQADKGFRILKRIPIIA 244

Query: 290 CFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVL 349
             +A +   ++G  G++ F     GNIL  +P N  +  + R      ++  FPL+    
Sbjct: 245 ISLAFVLYVIIGGAGYMTFGKNIVGNILTLYP-NSVSTTIGRLAMLLLVMLAFPLQCHPC 303

Query: 350 RDVIKDLMFF----------------------------------NSEPKSQPRVLSLKLH 375
           R  IK+++ F                                  N+E ++ P   S   H
Sbjct: 304 RSSIKNIIIFIENFRKGKLQENRDDCIPLDVLSSVNSQEESRQQNNEQQNFPSESS--RH 361

Query: 376 VIISTALVFGT---MAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRD 432
             I T  + G+   +AIS+T+  L  +  ++GAT ++ +++ILP     KL+G     RD
Sbjct: 362 TNIITLCILGSSYLLAISITS--LAKVLAIVGATGSTSISFILPGLFGYKLIGSEYISRD 419

Query: 433 -RIPHYVCI 440
            R+P  V I
Sbjct: 420 ERVPASVKI 428

>TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {ON}
           Anc_2.295 YIL088C
          Length = 473

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 85/190 (44%), Gaps = 14/190 (7%)

Query: 187 VVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPG----TDS--AYKGSFN 240
           ++ + ++  PL L R ++ L  +S+L L ++                 TD    ++G  N
Sbjct: 121 IIASLVVILPLCLLRSMNSLKYSSILGLFALTYLTLLVISNFLDDVILTDKFMQHRGDVN 180

Query: 241 SSNLLITPRIFQGL----SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIF 296
                I  R ++G     ++I FA     N   I   L+  S+K    + ++S  I+ I 
Sbjct: 181 ----WIKIRDYKGFVTTFNIIIFAFTGAMNLFSIINELEENSMKNISHVINYSIGISTIL 236

Query: 297 CFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDL 356
              +G TG+L F   T GNI+ N+  N    NV  FC G  ++ +FPL    LRD + ++
Sbjct: 237 FLSVGITGYLTFGSNTVGNIMLNYDPNSVWTNVGNFCLGAMVILSFPLLFHPLRDAVNNI 296

Query: 357 MFFNSEPKSQ 366
           + +    KS 
Sbjct: 297 IVYYQYYKSN 306

>Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar to
           Ashbya gossypii AGL285C
          Length = 457

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 126/321 (39%), Gaps = 55/321 (17%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P ++  F + +  L  R + I +    I  PL   R +  L  ASM+A++S+     
Sbjct: 104 DLMPQIVSTF-TSNQWLLERTLQITLCMLFIVTPLCFMRKLDSLRYASMVAISSVAYLCV 162

Query: 223 XXXXKG--PGTD-SAYKG----SFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLK 275
                   P +D    KG     F  +N      +     +  FA  CHHN   I   L+
Sbjct: 163 LVVYHFLFPSSDIRQAKGIVSIGFPENNS--AASMLSSFPIFVFAYTCHHNMFSIVNELR 220

Query: 276 TPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFG 335
             SL    R+   +  +A+    ++G +G+L F D   GNI+  +P + ++  +AR    
Sbjct: 221 DNSLTNCVRVVLIAMGLAVSLYTVIGGSGYLTFGDNITGNIVTIYPRSVSS-TLARIAIV 279

Query: 336 FNMLTTFPLEIFVLRDVIKDLMFFNSEPK------------------------------- 364
             ++  FPL+    R  I ++  + SE K                               
Sbjct: 280 LLVMLAFPLQCHPARASINNIWCYFSESKIFSPLANEESGLMRHEGSPRTPPSNNEFSIS 339

Query: 365 ---------SQP----RVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLM 411
                    SQP      +  K   +I+T+++  +  ++++  +   +  ++GAT ++ +
Sbjct: 340 PDWSPLQTSSQPIPTTTTIEGKRFFVITTSILIASYTLAVSVSSFARVLAIVGATGSTSI 399

Query: 412 AYILPPWVNLKLVGGNLKWRD 432
           ++ILP       VG     +D
Sbjct: 400 SFILPGIFGYHFVGSEYSAKD 420

>NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420
          Length = 471

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/308 (20%), Positives = 122/308 (39%), Gaps = 61/308 (19%)

Query: 182 RNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXX---------XKGPGTD 232
           RN  I ++   I  PL   +++S L  ASM+A++S+                  K    +
Sbjct: 136 RNFHITIMMLCIVSPLCFMKNLSSLRYASMVAISSVVYLCVLVVFHFLSPSQEIKDLKGE 195

Query: 233 SAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFI 292
            +Y    N  + L+T  IF       FA  CHHN   +       S     +L   +  +
Sbjct: 196 LSYWLPNNEPSPLVTLPIF------VFAYTCHHNMFSVINEQIDNSFHNIKKLAIIAMSL 249

Query: 293 AMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDV 352
           A     ++G +G+  F D   GNI+  +P + ++  + R    F +   FPL+    R  
Sbjct: 250 AFSLYIIIGGSGYYTFGDNIVGNIITLYPQSVSS-TIGRMAIVFLVTLAFPLQCHPARAS 308

Query: 353 IKDLMFF------------NSEPKSQPRVLSL---------------------------- 372
           I  ++ +             S P+ +P  LS                             
Sbjct: 309 IHHIILYITMKINDAKEIKPSNPQQEPLALSANNQERAMLIRSERSDTLIEEESPLQPVT 368

Query: 373 -----KLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGN 427
                K  ++I+T+++  +  ++++  +L  +  ++GAT ++ +++ILP     KL+G  
Sbjct: 369 VPLEGKQFILITTSILICSYLLAISVSSLAHVLAIVGATGSTSISFILPGVFGYKLIGSE 428

Query: 428 LKWRDRIP 435
           +   +++P
Sbjct: 429 MLTTEQLP 436

>YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}
           AVT6Vacuolar aspartate and glutamate exporter; member of
           a family of seven genes (AVT1-7) related to vesicular
           GABA-glycine transporters; involved in
           compartmentalizing acidic amino acids in response to
           nitrogen starvation
          Length = 448

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 59/311 (18%), Positives = 124/311 (39%), Gaps = 46/311 (14%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P ++ + ++ +  L +RN+ I ++      PLS  + ++ L  ASM+A++S+     
Sbjct: 104 DLMPQIM-SVWTRNAWLLNRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCV 162

Query: 223 XXXXKGPGTDSAYKGSFNSSNLLITPR-----IFQGLSVISFALVCHHNTSFIYFSLKTP 277
                               + L+ P+     +   L +  FA  CHHN   I    ++ 
Sbjct: 163 LVLLHYVAPSDEILRLKGRISYLLPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQRSS 222

Query: 278 SLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFN 337
             +   ++   +  +A+I    +G  G+L F D   GNI+  +P   ++  + R      
Sbjct: 223 RFEHVMKIPLIAISLALILYIAIGCAGYLTFGDNIIGNIIMLYPQAVSS-TIGRIAIVLL 281

Query: 338 MLTTFPLEIFVLRDVIKDLM-------------------------------------FFN 360
           ++  FPL+    R  I  ++                                        
Sbjct: 282 VMLAFPLQCHPARASIHQILQHFAEENVSISATSADEPTVATESSPLIRDSSLDLNEVIE 341

Query: 361 SEPKSQPRVLSL--KLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPW 418
            E   QP+   L  K  ++I+ +++  +  ++++  +L  +  ++GAT ++ +++ILP  
Sbjct: 342 EESIYQPKETPLRGKSFIVITCSILVASYLVAISVSSLARVLAIVGATGSTSISFILPGL 401

Query: 419 VNLKLVGGNLK 429
              KL+G   K
Sbjct: 402 FGYKLIGTEHK 412

>Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W
           (REAL)
          Length = 712

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 87/356 (24%), Positives = 144/356 (40%), Gaps = 36/356 (10%)

Query: 122 GKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFH 181
           G   Y D   +  G K K  ILLS  L                    L+ FF   +N FH
Sbjct: 376 GVDGYGDMGRILYGPKMKFAILLSIALSQIGFSAAYTVFTATN----LQVFF---ENFFH 428

Query: 182 RN------IVIVVVTCLISFPLSLNRDISKLSKASMLA--------LASMXXXXXXXXXK 227
                      +    LI  PLSL R+I+KLS  +++A        +             
Sbjct: 429 LKPGSINLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYVYVYSIYYISVN 488

Query: 228 GPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTH 287
           G  +D+     FN ++      +F G ++ +F  +       I  S++ P+  R   L+ 
Sbjct: 489 GIASDTMLM--FNKADW----SLFIGTAIFTFEGIGL--LIPIQESMRHPNHFR-PSLSA 539

Query: 288 FSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIF 347
             C +A++F    G   +  F    K  +L NFP N +     +  +   +L + PL++F
Sbjct: 540 VMCIVAVVF-ISCGLLCYAAFGADVKTVVLLNFPQNSSYTLTVQLLYALAILLSTPLQLF 598

Query: 348 VLRDVIKDLMF-FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCN-LGALFELIGA 405
               ++++  F  N+  K  P+V  LK +     A+V  T  ++    N L     L+G+
Sbjct: 599 PAIRILENWTFPSNASGKHNPKVKWLKNY--FRCAIVLLTSILAWVGANDLDKFVSLVGS 656

Query: 406 TTASLMAYILPPWVNLKLVGGNLKWRDR-IPHYVCIGFGFAIMLISSTQTIISYIN 460
                + YI PP ++ K    +   R R +   + I FG A+M+ +S QTI  + N
Sbjct: 657 FACVPLIYIYPPLLHFKASSISGTSRGRLLLDLIVISFGVAVMVYTSWQTIKMWSN 712

>CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119c or uniprot|P38176 Saccharomyces cerevisiae
           YBL089w or uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 460

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/312 (20%), Positives = 118/312 (37%), Gaps = 57/312 (18%)

Query: 179 LFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPGTD---SAY 235
           L +R+  I +V   +  PL L + ++ L   S LA+ S+             +D      
Sbjct: 120 LLNRDFHITLVMIFVVTPLCLKKRLNSLRHTSSLAIMSVAYLCVLVIIHLVSSDGDIEQM 179

Query: 236 KGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMI 295
           KG  +       P     L +  FA  CHHN   +    K    K    +   S  +A I
Sbjct: 180 KGHVSIGLPHHGPSPLTTLPIFVFAYTCHHNMFSVINEQKDNRFKTTKYIPLISTSLACI 239

Query: 296 FCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKD 355
              L+G  G++ F DK  GNI+  +P + +++ + R      +   FPL+    R  I +
Sbjct: 240 LYILIGGCGYMTFGDKIVGNIITLYPHSVSSI-IGRIAIALLVTLAFPLQCHPARSSIHN 298

Query: 356 LMFF-----------NSEP---------------------------------------KS 365
           ++ F             EP                                       K 
Sbjct: 299 ILAFFYPSLNPDLKNTQEPTANADTMSSSQLLATERTPLVRSISSIEDNELAEEQGSIKD 358

Query: 366 QPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVG 425
            P  +  KL + I+ A++  +  ++++  +L  +  ++GAT ++ +++ILP     +L+G
Sbjct: 359 VPIEMERKLFLAITAAILIPSYLVAMSVHSLDKVLAIVGATGSTSISFILPGIFGYRLIG 418

Query: 426 GN---LKWRDRI 434
            +   L   DR+
Sbjct: 419 SDGATLTRGDRL 430

>KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 456

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/355 (20%), Positives = 137/355 (38%), Gaps = 70/355 (19%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P ++  F + H  L  R   I  VT +I  PL   + +  L   S +A+ ++     
Sbjct: 104 DLLPQIMSTF-TTHGWLLSRQFHITAVTLIIVTPLCFIKKLDSLRYTSSIAITAVGYLCV 162

Query: 223 XXXXKGP----------GTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYF 272
                            G  S +K S   S++L +  IF       FA  CHHN   I  
Sbjct: 163 LVVFHFAVPNSEIDHLRGHVSIWKPSDVDSSMLSSFPIFV------FAYTCHHNMFSIIN 216

Query: 273 SLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARF 332
                SL    +L   +  +AM     +G  G+  F D   GNI+  +P N  +  + R 
Sbjct: 217 EQSDKSLDSITKLIRIAITLAMSLYISIGALGYCTFGDHITGNIITLYP-NSISSTIGRI 275

Query: 333 CFGFNMLTTFPLEIFVLRDVIKDLMFF----NSEP------------------------- 363
                ++  FPL+    R  +  ++ +    N+ P                         
Sbjct: 276 AIALLVILAFPLQCHPARASVNHILHYFSKGNTHPPMTTTSAEQNSLLRDSELESSEQLT 335

Query: 364 ------------KSQPRVLSLK--LHVIISTALVFGTMAISLTTCNLGALFELIGATTAS 409
                        +QP V++L+    + I++ ++  +  ++++  +L  +  ++GAT ++
Sbjct: 336 YECEDELIEENSANQPPVVTLEGPRFIFITSGILLFSYILAMSVTSLANVLSIVGATGST 395

Query: 410 LMAYILPPWVNLKLVGGNLK------WRDRIPHYVCI---GFGFAIMLISSTQTI 455
            +++ILP     KL+            ++RI   + +    +GF +M+ S + TI
Sbjct: 396 SISFILPGIFGYKLIASEYAKSVVPPAKERILRIISLLLAIWGFIVMITSLSATI 450

>NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {ON}
           Anc_5.252 YKL146W
          Length = 668

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 64/286 (22%), Positives = 122/286 (42%), Gaps = 26/286 (9%)

Query: 187 VVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPGTDSAYKGSFNSSNLLI 246
           +++  L+  PLSL R+I+KLS  ++  +A +             T    K   +S  +L 
Sbjct: 397 ILLQQLVFVPLSLTRNIAKLSGTAL--IADLFILLGLVYVYFYSTSYIIKNGISSKTMLW 454

Query: 247 TPR----IFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLM-- 300
             +    +F G ++ +F  +           L  P  +      HFS  ++M+ C +   
Sbjct: 455 LNKSDWSLFIGTAIFTFEGI----------GLLIPIQESMSHPQHFSKCLSMVMCIVTVI 504

Query: 301 ----GFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDL 356
               G   +  F  K +  +L NFP +     + +  +   +L + PL++F    ++++ 
Sbjct: 505 FISCGLLCYSAFGSKVETVVLLNFPHDSPYTLMVQLLYALAILLSTPLQLFPAIKILENW 564

Query: 357 MF-FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCN-LGALFELIGATTASLMAYI 414
            F  ++  K+ P+V  LK +      +V  T  I+    N L     L+G+     + YI
Sbjct: 565 CFPISASGKNNPKVKWLKNY--FRCIIVLLTAFIAYVGANDLDKFVSLVGSFACIPLIYI 622

Query: 415 LPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYIN 460
            PP ++LK   G       +   + + FG A+M  +S QTI  +++
Sbjct: 623 YPPLLHLKAYWGEQTILRMVLDSLVLIFGVAVMGYTSWQTIAMWLH 668

>TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7.420
           YER119C
          Length = 464

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/337 (18%), Positives = 123/337 (36%), Gaps = 75/337 (22%)

Query: 163 DTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX 222
           D +P +L  F +  +   +RN+ I +V   I  PL   ++++ L  AS+ A++++     
Sbjct: 104 DVMPQILGTF-TDTEFFLNRNVNITIVMLFIVTPLCFLKNLNSLRYASIAAISAVIYLCF 162

Query: 223 XXX------------XKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFI 270
                           +GP +    K   N  N          L +  FA  CHHN   +
Sbjct: 163 LVMFHFFIPNEEIRDTRGPVSWGFPKDGLNPLN---------TLPIFVFAYTCHHNMFSV 213

Query: 271 YFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVA 330
               +     +  ++  F+  +A     ++G +G+L F +   GNI+  +  N  A  V 
Sbjct: 214 INEQQDIHFNKLKQICIFAMLLACTLYIIIGGSGYLTFGNAITGNIITLY-SNSAATTVG 272

Query: 331 RFCFGFNMLTTFPLEIFVLRDVIKDLMFF-----------------------------NS 361
           R      ++  FPL+    R  I  ++ +                               
Sbjct: 273 RIAIVILVMLAFPLQCHPARASINHILHYFQLINCDNNQVQESESGHRESSGLIDNEITP 332

Query: 362 EPKSQ-----------------------PRVLSLKLHVIISTALVFGTMAISLTTCNLGA 398
           +P+ Q                       P  L  K   +++  ++  +  ++++  +L  
Sbjct: 333 QPQLQEAFEQPPDEVVEEEFPEQQKSFEPVTLDPKTFTVVTICILICSYILAVSVTSLAK 392

Query: 399 LFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIP 435
           +  ++GAT ++ +A+ILP     +L+G        +P
Sbjct: 393 VLAIVGATGSTSIAFILPGVFGYQLIGSEYSTSQIVP 429

>NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON}
           Anc_2.295
          Length = 481

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 60/117 (51%), Gaps = 6/117 (5%)

Query: 249 RIFQG------LSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGF 302
           RI+ G       S+I FA V   N   I   L+  S++   ++ + S  I+ IF  L+G 
Sbjct: 182 RIYDGKGLLSTFSIIIFAYVGAMNLFSICRELENDSMENILKVINGSIGISSIFFLLVGI 241

Query: 303 TGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFF 359
           +G+L F    +GNI+ N+  N   + + +FC  F +L +FPL    LR  + +L+ +
Sbjct: 242 SGYLTFGSNVQGNIILNYDPNSIWIYLGKFCLAFMLLLSFPLLFHPLRIAVNNLVVW 298

>TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.252
           YKL146W
          Length = 523

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/280 (19%), Positives = 114/280 (40%), Gaps = 20/280 (7%)

Query: 187 VVVTCLISFPLSLNRDISKLSKASMLA--------LASMXXXXXXXXXKGPGTDSAYKGS 238
           +++   +  PLS  R+I+KLS  +++A        +            KGP  D      
Sbjct: 250 ILLQTFLFIPLSFTRNITKLSSTALIADLFIFIGLIYLYYYPIKIIATKGP--DWQTMTP 307

Query: 239 FNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCF 298
           FN+ +      +F G ++ ++  +       I  S+K+P    F +       I  +   
Sbjct: 308 FNTKDW----SLFIGTAIFTYEGIGLLIP--IQESMKSP--HHFKKSLILVLVIITLVFI 359

Query: 299 LMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMF 358
            +G  G+  F       +L NFP ++   ++ +  +   +L + PL++F    ++++ +F
Sbjct: 360 TIGLLGYSAFGSNVDTVLLQNFPQDNPCTSLVQLLYSLAILLSTPLQLFPAIKILENWIF 419

Query: 359 FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPW 418
                      +    +   ST ++  ++   L   +L     L+G+     + Y+ PP 
Sbjct: 420 SKDASGKYNHSIKWAKNYFRSTIVILTSLISYLGANDLNKFVALVGSFACIPLIYVYPPL 479

Query: 419 VNLKL--VGGNLKWRDRIPHYVCIGFGFAIMLISSTQTII 456
           ++ K   +     W+  +  +  + FG   M+ +S QTII
Sbjct: 480 LHYKATQLDNTFTWKTLLADFSLLTFGIITMIYTSLQTII 519

>Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W
           (REAL)
          Length = 680

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 127/300 (42%), Gaps = 37/300 (12%)

Query: 177 DNLFHRN------IVIVVVTCLISFPLSLNRDISKLSKASMLA--------LASMXXXXX 222
           +N FH           +    LI  PLSL R+I+KLS  +++A        +        
Sbjct: 392 ENFFHLKPGSISLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYVYVYSIY 451

Query: 223 XXXXKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFA----LVCHHNTSFIYFSLKTPS 278
                G  +D+     FN ++      +F G ++ +F     L+       I  S+K P+
Sbjct: 452 YIAVNGIASDTMLM--FNKADW----SLFIGTAIFTFEGIGLLIP------IQESMKHPN 499

Query: 279 LKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNM 338
             R   L+   C +A++F    G   +  F    K  +L NFP + +     +  +   +
Sbjct: 500 HFR-PSLSAVMCIVAVVF-ISCGLLCYAAFGSDVKTVVLLNFPQDTSYTLTVQLLYALAI 557

Query: 339 LTTFPLEIFVLRDVIKDLMF-FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCN-L 396
           L + PL++F    ++++  F  N+  K  P+V  LK +     A+V  T  ++    N L
Sbjct: 558 LLSTPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNY--FRCAIVVLTSVLAWVGANDL 615

Query: 397 GALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDR-IPHYVCIGFGFAIMLISSTQTI 455
                L+G+     + YI PP ++ K    +   R R +   + I FG A+M+ +S QTI
Sbjct: 616 DKFVSLVGSFACIPLIYIYPPLLHYKASSISGTSRARLLLDLIVIVFGVAVMVYTSWQTI 675

>CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa]
           {ON} similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 485

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 50/103 (48%)

Query: 255 SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKG 314
           S+I FA V   N   I   L+  S+    ++   S  I+ I    +G  G+L F   T G
Sbjct: 197 SIIIFAYVGAMNIFTIVNELQDNSMTNVRKVVDSSILISTILFLFVGLFGYLTFGSLTMG 256

Query: 315 NILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLM 357
           NIL N+  +  A+ + +FC    ++ TFPL    LR  I +++
Sbjct: 257 NILLNYDSDSLAIGIGKFCLAMMLILTFPLLFHPLRTAINNIV 299

>Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON}
           YIL088C (REAL)
          Length = 491

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 89/201 (44%), Gaps = 15/201 (7%)

Query: 182 RNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXX-------XXXXXKGPGTDSA 234
           RN  I+  T +I  PL L + + +L  +S+L L ++                KG  TD  
Sbjct: 117 RNYWIIASTVVI-IPLCLVKKLDQLKYSSILGLFALAYISIFIFSHFAFELGKGKLTD-V 174

Query: 235 YKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAM 294
            +       +     +    S+I FA     N   +   LK  S++    + + S  ++ 
Sbjct: 175 LENDICWWKIHDVKGLLSTFSIIIFAYTGSMNLFPMINELKDNSMENITLVINNSITLST 234

Query: 295 IFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIK 354
           I   ++G +G+L F +KT GN++ N+  N   + + +FC G  ++ +FPL    LR  + 
Sbjct: 235 ILFLIVGLSGYLTFGNKTSGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFQPLRVAVN 294

Query: 355 DLM------FFNSEPKSQPRV 369
           +++      F N++P    +V
Sbjct: 295 NVIIWLEITFGNADPNEDTQV 315

>YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 692

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 126/297 (42%), Gaps = 31/297 (10%)

Query: 177 DNLFHRN------IVIVVVTCLISFPLSLNRDISKLSKASMLA--------LASMXXXXX 222
           +N FH           +    LI  PLSL R+I+KLS  +++A        +        
Sbjct: 404 ENFFHLKPGSISLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYVYVYSIY 463

Query: 223 XXXXKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRF 282
                G  +D+     FN ++      +F G ++ +F  +       I  S+K P   R 
Sbjct: 464 YIAVNGVASDTMLM--FNKADW----SLFIGTAIFTFEGIGLLIP--IQESMKHPKHFR- 514

Query: 283 DRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTF 342
             L+   C +A+IF    G   +  F    K  +L NFP + +     +  +   +L + 
Sbjct: 515 PSLSAVMCIVAVIF-ISCGLLCYAAFGSDVKTVVLLNFPQDTSYTLTVQLLYALAILLST 573

Query: 343 PLEIFVLRDVIKDLMF-FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCN-LGALF 400
           PL++F    ++++  F  N+  K  P+V  LK +     A+V  T  ++    N L    
Sbjct: 574 PLQLFPAIRILENWTFPSNASGKYNPKVKWLKNY--FRCAIVVLTSILAWVGANDLDKFV 631

Query: 401 ELIGATTASLMAYILPPWVNLK--LVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTI 455
            L+G+     + YI PP ++ K  ++ G  + R  +   + I FG A+M  +S QTI
Sbjct: 632 SLVGSFACIPLIYIYPPLLHYKASILSGTSRARLLL-DLIVIVFGVAVMAYTSWQTI 687

>ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 608

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 91/427 (21%), Positives = 159/427 (37%), Gaps = 51/427 (11%)

Query: 58  EQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVN 117
           +Q+ K+    A + +  S +G G++  P A  N                      L++  
Sbjct: 209 KQQRKATTFKAILLLLKSFVGTGVLFLPRAFHNGGWAFSTGCLLFCAIASSLAFVLLIKT 268

Query: 118 LRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHD 177
               G + Y D  +   G K +  IL S  L                    L+ FF    
Sbjct: 269 KDKVGVSGYGDLGKALYGPKVEFSILFSIALSQLGFSAAYTVFTATN----LKVFFENAF 324

Query: 178 NLFHRNIVI---VVVTCLISFPLSLNRDISKLSKASMLA--------LASMXXXXXXXXX 226
           N    ++ +   +++  LI  PLSL R+I+KLS  +++A        L            
Sbjct: 325 NFPADSVPLSAYIILQALIFIPLSLTRNITKLSGTALIADLFILLGLLYVYYYPALYIAK 384

Query: 227 KGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLT 286
            G  TDS     FN S+      +F G ++ +F  +           L  P  +   +  
Sbjct: 385 HGIATDSVL--FFNRSDW----SLFIGTAIFTFEGI----------GLLIPIQESMKKPE 428

Query: 287 HFS---CFIAMIFCFLM---GFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLT 340
           HF     F+  I  F+    G   +L F  K +  +L NFP +  A    +  +   +L 
Sbjct: 429 HFYPSLGFVMSIVTFIFVSSGLLCYLAFGAKVETVVLLNFPQDSIATISVQLIYSLAILL 488

Query: 341 TFPLEIFVLRDVIKDLMF-FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGAL 399
           + PL++F    + +   F  N+  K   RV  LK +   +  ++F  +   +   +L   
Sbjct: 489 STPLQLFPAIRIFETWTFPSNASGKHNHRVKWLK-NYFRTGVVIFTALLAWVGANDLDKF 547

Query: 400 FELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIG------FGFAIMLISSTQ 453
             L+G+     + YI PP ++LK          +   ++ +G      FG  +M  +S Q
Sbjct: 548 VSLVGSFACIPLIYIYPPLLHLK------SSDTQTSKFIILGDLLIFFFGVGVMAYTSYQ 601

Query: 454 TIISYIN 460
            I+ + N
Sbjct: 602 NIVLWGN 608

>KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.252
           YKL146W
          Length = 646

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 90/414 (21%), Positives = 166/414 (40%), Gaps = 41/414 (9%)

Query: 62  KSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLRIS 121
           K++   A + +  S +G G++  P A  N                  +   L+++     
Sbjct: 252 KTSTFKAVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLMCAVLSYYCFILLIITKDKV 311

Query: 122 GKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFH 181
           G   Y D  E+  G K KL IL S  L                    L+ F  G  NL  
Sbjct: 312 GVAGYGDMGEVLYGSKMKLAILASIALSQIGFSAAYTVFTATN----LQVFCQGALNLPD 367

Query: 182 RNI---VIVVVTCLISFPLSLNRDISKLSKASMLA-------LASMXXXXXXXXXKGPGT 231
            ++   + +V+  LI  PLSL R+I+KLS  ++LA       L  +         K    
Sbjct: 368 GSLGLGIFIVLQALIFIPLSLTRNIAKLSVTALLADLFILLGLIYVYYYAIYYVAKN-SI 426

Query: 232 DSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCF 291
            +A    FN+S+      +F G ++ +F  +       I  S++ P  K    L    C 
Sbjct: 427 ATATMVWFNNSDW----SLFIGTAIFTFEGIGLLIP--IQESMRHPE-KFQSSLFGVMCI 479

Query: 292 IAMIF--CFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVL 349
           ++++F  C L+ ++    F    +  +L NFP +     + +  +   +L + PL++F  
Sbjct: 480 VSVVFISCGLLCYSA---FGSNVQTVVLLNFPQDSPYTLLVQLFYSMAILLSTPLQLFPA 536

Query: 350 RDVIKDLMF-FNSEPKSQPRVLSLKLH-----VIISTALVFGTMAISLTTCNLGALFELI 403
             +++   F  N+  K  P++   K +     V++++ L +      +   NL     L+
Sbjct: 537 IRILEHWTFPSNASGKYNPKIKWRKNYFRCIIVVLTSVLAW------VGASNLDKFVSLV 590

Query: 404 GATTASLMAYILPPWVNLKLVGG--NLKWRDRIPHYVCIGFGFAIMLISSTQTI 455
           G+     + YI PP ++ K      + ++   I   + + FG  +M  +S QT+
Sbjct: 591 GSLACIPLIYIHPPLLHFKAFKDDQDTRYWSLICDILLLAFGVGVMTYTSVQTL 644

>Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W
           (REAL)
          Length = 719

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 81/354 (22%), Positives = 134/354 (37%), Gaps = 42/354 (11%)

Query: 122 GKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFF---SGHDN 178
           G   Y D   +  G K KL ILLS  L                +      FF    G  N
Sbjct: 383 GVDGYGDMGRVLYGPKMKLAILLSIALSQIGFSAAYTVFTATNLQVFCEHFFHLKPGSIN 442

Query: 179 LFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLA--------LASMXXXXXXXXXKGPG 230
           L       +    LI  PLSL R+I+KLS  +++A        +             G  
Sbjct: 443 L----ATYIFAQVLIFVPLSLTRNIAKLSGTALIADVFILLGLVYVYYYSIYHIAVNGIA 498

Query: 231 TDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSC 290
           +D+     FN ++      +F G ++ +F  +           L  P  +      HF  
Sbjct: 499 SDTMLM--FNKADW----SLFIGTAIFTFEGI----------GLLIPIQESMKHPNHFQP 542

Query: 291 FIAMIFCFLM------GFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPL 344
            ++ + C +       G   +  F    K  +L NFP + +     +  +   +L + PL
Sbjct: 543 SLSAVMCIVAVVFISCGLLCYAAFGADVKTVVLLNFPQDSSYTLTVQLLYALAILLSTPL 602

Query: 345 EIFVLRDVIKDLMF-FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCN-LGALFEL 402
           ++F    ++++  F  N+  K  P+V  LK +     A+V  T  ++    N L     L
Sbjct: 603 QLFPAIRILENWTFPSNASGKHNPKVKWLKNY--FRCAIVLLTSVLAWVGANDLDKFVSL 660

Query: 403 IGATTASLMAYILPPWVNLKLVGGNLKWRDR-IPHYVCIGFGFAIMLISSTQTI 455
           +G+     + YI PP ++ K    +   R R +   V + FG  +M  +S QTI
Sbjct: 661 VGSFACIPLIYIYPPMLHYKAFSLSGISRARLLLDLVVLSFGVVVMAYTSWQTI 714

>KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.252
           YKL146W
          Length = 643

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 94/433 (21%), Positives = 170/433 (39%), Gaps = 30/433 (6%)

Query: 45  VDSEDRFT---STFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXX 101
           ++SE+  T   +T    +R K+  + A + +  S +G G++  P A  N           
Sbjct: 225 IESENEGTPLVATRSTSERHKTTTVKAVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLL 284

Query: 102 XXXXXXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXX 161
                  +   L+++     G   Y +      G K KL ILLS  L             
Sbjct: 285 FCAILSYYCFVLLIITKDKVGVKGYGEIGMKLYGGKMKLAILLSVALSQIGFAAAYTVFT 344

Query: 162 XDTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLA-------- 213
              +   +   F+  +++      I +    I  PLSL R+I+KLS  +++A        
Sbjct: 345 ATNLKLFMDNVFNLSEDVLGLGWFIWL-QAAIFIPLSLTRNIAKLSGTALVADLFILLGL 403

Query: 214 LASMXXXXXXXXXKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFS 273
           +             G  T +     FN S+      +F G ++ +F  +       I  S
Sbjct: 404 IYVYYYATYYVISNGVATSTMVW--FNKSDW----TLFIGTAIFTFEGIGLLIP--IQES 455

Query: 274 LKTPSLKRFDRLTHFSCFIAMIF--CFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVAR 331
           +K P + R   L+     + +IF  C L+ ++ F    D     +L NFP +     + +
Sbjct: 456 MKHPEVFR-KSLSGVMVIVTVIFISCGLLCYSAFGSHVDTV---VLVNFPQDSYTTAIVQ 511

Query: 332 FCFGFNMLTTFPLEIFVLRDVIKDLMF-FNSEPKSQPRVLSLKLHVIISTALVFGTMAIS 390
             +   +L + PL++F    +++   F  N+  K  PRV  LK +      ++F T+   
Sbjct: 512 LLYALAILLSTPLQLFPAIRILEQWTFNSNASGKHNPRVKWLK-NYFRCGVVIFTTVLAW 570

Query: 391 LTTCNLGALFELIGATTASLMAYILPPWVNLKL--VGGNLKWRDRIPHYVCIGFGFAIML 448
           +   +L     L+G+     + YI PP ++ +     G       I   +   FGF++M+
Sbjct: 571 VGASDLDKFVSLVGSLACIPLIYIHPPLLHHRASRSDGTSSRGILILDLLICIFGFSVMV 630

Query: 449 ISSTQTIISYING 461
            +S Q I  +I G
Sbjct: 631 YTSWQAITLWIFG 643

>Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 89/202 (44%), Gaps = 15/202 (7%)

Query: 181 HRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXX-------XXKGPGTDS 233
            RN  ++  T +I  PL L + + +L  +S+L L ++                KG  T+ 
Sbjct: 116 ERNYWVIASTAII-IPLCLVKKLDQLKYSSILGLFALAYISILVFSHFVFELAKGELTE- 173

Query: 234 AYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIA 293
             K   +   +     +    S+I FA     N   +   LK  S+     + + S  ++
Sbjct: 174 VLKNDVSWWKIHDFKGLLSTFSIIIFAYTGSMNLFPMINELKDNSMGNITLVINNSISLS 233

Query: 294 MIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVI 353
                ++G +G+L F + T GN++ N+  N   + + +FC G  ++ +FPL    LR  +
Sbjct: 234 TALFLIVGLSGYLTFGNSTLGNLILNYDPNSVWIIIGKFCLGSMLILSFPLLFQPLRVAV 293

Query: 354 KDLM------FFNSEPKSQPRV 369
            +++      F N++P+  P+V
Sbjct: 294 NNVIIWIEITFGNADPEEDPQV 315

>NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295
          Length = 496

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 85/203 (41%), Gaps = 14/203 (6%)

Query: 165 IPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXX-- 222
           I  +    F GH + +      ++ +  I  PLS  + +  L  +S++ L ++       
Sbjct: 105 IGDIFPGLFGGHRDYW------IISSAFIIVPLSCLKKLDSLKYSSIVGLFALAYLSMFI 158

Query: 223 ------XXXXKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKT 276
                     K P    + +G     ++     +    S+I FA     N   +   L+ 
Sbjct: 159 FVMFLHNTVFKLPNEGDSTRGEVYWFHVYDFRGLLSTFSIIIFAYTGAMNLFSMIRELED 218

Query: 277 PSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGF 336
            S++    + + S  I+     L+G +G+L F    +GNI+ N+  N N + + +FC G 
Sbjct: 219 ISMQNIKNVINGSIIISTGLFLLVGISGYLTFGSNVEGNIILNYNPNSNWIYIGKFCLGT 278

Query: 337 NMLTTFPLEIFVLRDVIKDLMFF 359
            ++ +FPL    LR  + +L+ +
Sbjct: 279 MLILSFPLLFHPLRIAVNNLVVW 301

>AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER119C
           (AVT6) and YBL089W (AVT5)
          Length = 440

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 116/289 (40%), Gaps = 34/289 (11%)

Query: 179 LFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKGPGTDSAYKGS 238
           L  RN+ I   T  +  PL   R +  L  ASM+A+A++         +        +  
Sbjct: 119 LLDRNVQITFWTAAVIAPLCCMRHLHSLKYASMVAVAAVAYLGALVAARAAWPSPELERL 178

Query: 239 FNSSNLLITP-----RIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIA 293
               +L + P      +     +  FA  CHHN   I   L+  SL    R+   +  +A
Sbjct: 179 RGPVSLGLPPGTSGGAMLSSFPIFVFAYTCHHNMFSIVNELRDNSLGACLRVVVAAIALA 238

Query: 294 MIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVI 353
           +     +G  G+L F D   GNI+  +P    A  + R      ++  FPL+    R  I
Sbjct: 239 VALYATIGGAGYLTFGDHITGNIIAQYP-PAPATTLGRAAIAVLVMLAFPLQCHPARASI 297

Query: 354 KDLMFF--------NSE-----------------PKSQPRVLSL--KLHVIISTALVFGT 386
             +  +         SE                 P ++P  + L       I+ AL+  +
Sbjct: 298 NHIWHYCIPSHTVAPSEASALIRGGSPPADAAEGPGNEPAAVPLGPPRFAAITAALLIAS 357

Query: 387 MAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIP 435
            A++++  +L  +  ++GAT ++ +++ILP     +L+G   +  D++P
Sbjct: 358 YAVAVSVTSLARVLAVVGATGSTAISFILPGLFGYQLIGSESR-ADQLP 405

>ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 467

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 78/197 (39%), Gaps = 11/197 (5%)

Query: 165 IPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASM-----LALASMXX 219
           I  V    F G  + +      +V + L+  PL L + +  L  +S+     LA  S+  
Sbjct: 105 IGDVFPGLFGGQRDWW------IVGSSLVVVPLCLLKKLDSLKYSSIIGLFALAYLSLLI 158

Query: 220 XXXXXXXKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSL 279
                     G     +G  +  ++     +    S+I FA     N   I   L+  ++
Sbjct: 159 LSTFVYEYSSGRYEEVRGDISWWSVYDYKGLMSTFSIIIFAYTGSMNLFSIVNELRNNTM 218

Query: 280 KRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNML 339
                + + S  IA +F   +   G+L F   T GNI+ N+      V++ +FC G  ++
Sbjct: 219 TNITAVVNRSIAIATVFFIAVALAGYLTFGSNTLGNIMLNYDDTSIYVHIGKFCLGSMVV 278

Query: 340 TTFPLEIFVLRDVIKDL 356
            TFPL     R  + +L
Sbjct: 279 LTFPLLFHPCRIAVNNL 295

>Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 60/121 (49%), Gaps = 6/121 (4%)

Query: 255 SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKG 314
           S+I FA     N   +   LK  S++    + + S  ++     ++G +G+L F +KT G
Sbjct: 195 SIIIFAYTGSMNLFPMINELKDNSMENITSVINNSISLSTALFLIVGLSGYLTFGNKTLG 254

Query: 315 NILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLM------FFNSEPKSQPR 368
           N++ N+      + + +FC G  ++ +FPL    LR  + +++      F ++ P+  P+
Sbjct: 255 NLILNYDPTSIWIVIGKFCLGLMLILSFPLLFQPLRIAVNNVIIWIEITFGDANPEEDPQ 314

Query: 369 V 369
           V
Sbjct: 315 V 315

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/324 (21%), Positives = 131/324 (40%), Gaps = 51/324 (15%)

Query: 170 RAFFSGHDNLFHRNIVIVVVTCLISF-PLSLNRDISKLSKASMLALA------SMXXXXX 222
           +AF     N+   NI+  ++   I F PLS  R +SKL+  S++A        S+     
Sbjct: 375 KAFIENVTNIKDFNIIYPILLQFIIFVPLSYIRRVSKLTLPSLIANGFILIGLSLVIYFS 434

Query: 223 XXXXKGPGTDSAYKGS---FNSSNLLITPRIFQGLSVISFA----LVCHHNTSFIYFSLK 275
                G        G    FN+ +      +F G ++ +F     ++   N      S++
Sbjct: 435 IDHLAGDLHGKPADGIISFFNTKHW----TLFIGTAIFAFEGIGLIIPLQN------SMR 484

Query: 276 TPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFG 335
            PS  +F  +         +   ++   G+L +   T+  IL NFP  +  VN+ +  + 
Sbjct: 485 DPS--KFPLVLGLVMICTTVMFIIIATIGYLSYGSSTETIILQNFPQKNIVVNLIQLFYA 542

Query: 336 FNMLTTFPLEIFVLRDVIKDLMFFN--SEPKSQPRVLSLKLHVIISTALVF------GTM 387
             +L + PL+IF   ++++D +F    S+P+ +  +    ++   S  L +        +
Sbjct: 543 LAILLSTPLQIFPAIEIVEDKIFPKPGSDPECKDEIPITTIYNANSGGLDWRIKWFKNMI 602

Query: 388 AISLTTC----------NLGALFELIGATTASLMAYILPPWVNLKLV------GGNLKWR 431
              + TC          NL  L  +IG+     + Y+ PP ++LK        G    W 
Sbjct: 603 RTMIVTCVILLAYFGSNNLDKLVAIIGSLACIPLVYMYPPMLHLKTYSIPMSKGKRFTWS 662

Query: 432 DRIPHYVCIGFGFAIMLISSTQTI 455
                Y+ I FG   M+ ++ Q+I
Sbjct: 663 KSF-DYILIVFGGVSMVYTTYQSI 685

>CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146w or
           uniprot|P50944 Saccharomyces cerevisiae YNL101w
          Length = 681

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 90/445 (20%), Positives = 160/445 (35%), Gaps = 42/445 (9%)

Query: 33  DRSTEVRPERLSVDSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCX 92
           + + E    RL      R     +H    KS+   A + +  S +G G++  P A  N  
Sbjct: 262 EEALETESTRLLSTHRSRKHRPAVHGH--KSSTTKAVLLLLKSFVGTGVLFLPRAFHNGG 319

Query: 93  XXXXXXXXXXXXXXXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXX 152
                           W   L++      G   Y D      G   KL IL S  L    
Sbjct: 320 WGFSSSVLLICALISYWCFVLLIDTKNHVGLDGYGDMGNHLYGSSMKLAILWSIALSQIG 379

Query: 153 XXXXXXXXXXDTIPHVLRAFFSGHDNLFHRN---IVIVVVTCLISFPLSLNRDISKLSKA 209
                           L+ F    +N+F +     + +++  L   PL+L R+I+KLS  
Sbjct: 380 FSSAYTVFTATN----LQVF---TNNVFKQEYGITIFIIIQVLFFLPLALTRNIAKLSGT 432

Query: 210 SMLA----LASMXXXX--XXXXXKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVC 263
           +++A    L  +              G  S     FN ++      +F G ++ +F  + 
Sbjct: 433 ALIADLFILLGLVYVYWFSISHVSTHGVASETMLMFNKADW----SLFIGTAIFTFEGI- 487

Query: 264 HHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLM------GFTGFLVFKDKTKGNIL 317
                     L  P  +   +  HF   ++ + C +       G   +  F    +  +L
Sbjct: 488 ---------GLLIPIQESMKKPEHFHASLSGVMCVVTVVFISCGLICYCAFGADVETVVL 538

Query: 318 NNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFF-NSEPKSQPRVLSLKLHV 376
            NFP         +  +   +L + PL++F    ++++  F  +S  K  P+V  LK + 
Sbjct: 539 LNFPQESIYTRAVQLLYALAILLSTPLQLFPAIKILENWTFSPHSSGKHNPKVKWLKNY- 597

Query: 377 IISTALVFGTMAISLTTCN-LGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIP 435
               A+V  +  I+    N L     L+G+     + YI PP ++ K    +        
Sbjct: 598 -FRAAIVCFSALIAWAGANDLDKFVSLVGSFACIPLIYIYPPMLHFKAFKKDKSKLFMAS 656

Query: 436 HYVCIGFGFAIMLISSTQTIISYIN 460
               + FG  +M+ +S QTI  ++N
Sbjct: 657 DIFLLFFGIIVMIYTSLQTIGMWLN 681

>Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -
           Hypothetical ORF [contig 246] FULL
          Length = 614

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 117/279 (41%), Gaps = 33/279 (11%)

Query: 193 ISFPLSLNRDISKLSKASMLA--------LASMXXXXXXXXXKGPGTDSAYKGSFNSSNL 244
           +  PLSL R+I+KLS  +++A        L             G  +DS    + N   L
Sbjct: 348 VYLPLSLTRNIAKLSGTALIADAFILFGLLYVYYYCSHYVVDHGVASDSMLLFNKNDWTL 407

Query: 245 LITPRIF--QGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRL---THFSCFIAMIFCFL 299
            I   IF  +G+ ++            I  S+K P  ++F +       S  +A I C L
Sbjct: 408 FIGTAIFTYEGIGLL----------IPIQESMKHP--EKFSKCLFGVMASVSVAFIVCGL 455

Query: 300 MGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMF- 358
           + ++    F D  K  IL NFP +       +  +   +L + PL++F +  +++  +F 
Sbjct: 456 LCYSA---FGDSVKIVILLNFPRDSAMTATVQLLYALAILLSTPLQLFPIIRILETSIFP 512

Query: 359 FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCN-LGALFELIGATTASLMAYILPP 417
            ++  K  PRV  +K +     A+V   M I+    N L     L+G+     + YI PP
Sbjct: 513 KDASGKYNPRVKWMKNY--FRVAIVLLNMLIAWLGANDLDKFVSLVGSFACIPLIYIYPP 570

Query: 418 WVNLK-LVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTI 455
            ++ K    G       +   +   FG A+M+ ++ Q +
Sbjct: 571 MLHYKTFAQGGASKLALLGDQLIAFFGVAVMIYTTYQAV 609

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 105/263 (39%), Gaps = 68/263 (25%)

Query: 255 SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKG 314
           S+I FA     N   I   L+  S++   ++ + S  I+     L+G +G+L F   T G
Sbjct: 198 SIIIFAFTGAMNLFSIINELENNSIRNITKVINRSIGISTFLFLLVGISGYLTFGSNTLG 257

Query: 315 NILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFF----------NSEP- 363
           NI+ N+  +     + +FC G  ++ +FPL    LR  + +++ F          N+ P 
Sbjct: 258 NIMLNYDPDSKWCYIGKFCLGSMIVLSFPLLFHPLRIAVNNMVIFYQINYGSNKENTSPN 317

Query: 364 --------------------KSQPR------VLSLKLHVI-------------------I 378
                               +S P       +LS ++  I                   I
Sbjct: 318 IRSNTSDLSPISLTINDDDIRSMPDDNVDDVLLSNEVTEIEELDNVLCETPFPNHRFYTI 377

Query: 379 STALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGNL---------- 428
           S  L+    ++SLT  +   +  ++GAT  + +++ILP     KL+G +           
Sbjct: 378 SLLLLLVMYSVSLTVTSFAYVLAIVGATGGTSISFILPGIFGYKLIGSDSLAIGQMISDS 437

Query: 429 -KWRDRIPHYVCIGFGFAIMLIS 450
            K+  +   Y+ + FGF++M  S
Sbjct: 438 DKFYKKCSLYLAL-FGFSVMFFS 459

>YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}
           AVT7Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 490

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 64/129 (49%), Gaps = 10/129 (7%)

Query: 251 FQGL----SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFL 306
           F+GL    S+I FA     N   +   LK  S++    + + S  ++     ++G +G+L
Sbjct: 187 FKGLLSTFSIIIFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIVGLSGYL 246

Query: 307 VFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFF------N 360
            F ++T GN++ N+  N   + + +FC G  ++ +FPL    LR  + +++ +       
Sbjct: 247 TFGNETLGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLRIAVNNVIIWIEITYGG 306

Query: 361 SEPKSQPRV 369
           + P+  P+V
Sbjct: 307 ANPEEDPQV 315

>TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.252
           YKL146W
          Length = 596

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 97/450 (21%), Positives = 173/450 (38%), Gaps = 34/450 (7%)

Query: 20  RGPLGDNFELSSFDRSTEVRPERLSVDSEDRFTSTFLHEQRSKSNILMAFMNMANSILGA 79
           R PL +N   S+   +T V P  +      R       +   K++   A + +  S +G 
Sbjct: 162 RRPLLNNVSPSNNPLATGVSPTEIPHRIAKR-----KGDNNKKASTFKAILLLLKSFVGT 216

Query: 80  GIIGQPFAVKNCXXXXXXXXXXXXXXXXDWT-IRLIVVNLRISGKTTYQDSVELAMGRKG 138
           GI+  P    N                  +  I LI    ++ G   Y D      G+  
Sbjct: 217 GILFLPKGFSNGGYTFSTISLLVCSLLSYYCFILLISTKDQMKGINGYGDLGNHLYGKNM 276

Query: 139 KLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFHRNIVIVVV-TCLISFPL 197
           KL ILLS  L                +  + +  FS +    H +IV+ ++   L+  PL
Sbjct: 277 KLAILLSIVLSQIGFSAAYTVFVATNLKTLCQNLFSNNQ---HFSIVLFIIFQTLLFIPL 333

Query: 198 SLNRDISKLSKASMLA--------LASMXXXXXXXXXKGPGTDSAYKGSFNSSNLLITPR 249
           S  R+I+KL+  +++A        +             G  T++     FN+ N      
Sbjct: 334 SFTRNITKLTATALVADLFIFIGVIYIYYYPITYIIKNGIATETIVP--FNNKNW----S 387

Query: 250 IFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFK 309
           +F G ++ +F  +       I  S+  P  + F  LT     + +IF   +G   +  F 
Sbjct: 388 LFIGTAIFTFEGIGLLIP--IQESMAKPH-QFFISLTLVMVIVTVIF-ISVGLLCYCAFG 443

Query: 310 DKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFNS-EPKSQPR 368
              +  +L NFP +       +  +   +L + PL++F    ++++ +F      K  P+
Sbjct: 444 SSVETVVLLNFPQDSPYTLTVQLLYCLAILLSTPLQLFPAIRILENWVFKKKGSGKYNPK 503

Query: 369 VLSLKLHVIISTALVFGTMAISLTTCN-LGALFELIGATTASLMAYILPPWVNLKL--VG 425
           +   K +    + +V GT  I+ +  N L     L+G+     + YI PP ++ K   + 
Sbjct: 504 IKWAKNY--FRSLIVIGTTCIAWSGANDLDKFVSLVGSFACIPLIYIYPPLLHYKACKIN 561

Query: 426 GNLKWRDRIPHYVCIGFGFAIMLISSTQTI 455
           G+          + I FG  +M  +S QTI
Sbjct: 562 GSANLVQNYLDIILILFGVILMSYTSFQTI 591

>TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.252
           YKL146W
          Length = 613

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 119/287 (41%), Gaps = 31/287 (10%)

Query: 187 VVVTCLISFPLSLNRDISKLSKASMLA------LASMXXXXXXXXXKGPGTDSAYKGSFN 240
           +++  LI  PLS  R+I+KLS  +++A                      G  ++    FN
Sbjct: 341 IILQTLIFIPLSFTRNITKLSGTTLVADLFILLGLLYVYYYPSYYIIKHGIATSSMKLFN 400

Query: 241 SSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFS-CFIAMI---- 295
            S+      +F G ++ +F  +           L  P  +  ++  HF+ C + ++    
Sbjct: 401 KSDW----SLFVGTAIFTFEGI----------GLLIPIQESMEKPQHFNKCLLGVMSGVA 446

Query: 296 FCFLM-GFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIK 354
           F F+  G   +  F  K +  +L NFP +      A+  +   +L + PL++F    +++
Sbjct: 447 FVFITSGLICYSAFGSKVETVVLLNFPQDSPFTKSAQLLYVLAILLSTPLQLFPAIRILE 506

Query: 355 DLMF-FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCN-LGALFELIGATTASLMA 412
           +  F  ++  K  P +  LK +    +A+V  T  I+    N L     L+G+     + 
Sbjct: 507 NWTFPVDASGKHNPHIKWLKNY--FRSAIVIATSLIAWGGANDLDKFVSLVGSFACVPLI 564

Query: 413 YILPPWVNLK-LVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISY 458
           YI PP ++ K     N      +   V    G  IML ++ Q+I+ +
Sbjct: 565 YIYPPALHFKAFKDKNASKISLVTDVVIASVGVIIMLYNTYQSILMW 611

>SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} similar
           to uniprot|P40501 Saccharomyces cerevisiae YIL088C AVT7
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 472

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 67/162 (41%), Gaps = 8/162 (4%)

Query: 190 TCLISFPLSLNRDISKLSKASML---ALASMXXXXXXXXXKGPGTDSAYKGSFNSSNLLI 246
           + L+  PL L R +  L  +S+L   ALA +          G      YK +       +
Sbjct: 125 SALLIIPLCLLRHLDSLKYSSILGLFALAYLVTLVIGTFVYGVVLHDDYKYT-RGDVFWV 183

Query: 247 TPRIFQGL----SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGF 302
               + GL    S+I FA  C  N   I   L   S+    ++ + S  IA      +G 
Sbjct: 184 KVYDYNGLISTFSIIIFAYTCTMNIFSIINELTDNSVSNVTKVANSSIGIATFLILSVGI 243

Query: 303 TGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPL 344
           TG+L F     GNI+ N+  +     V +FC G  ++ +FPL
Sbjct: 244 TGYLTFGSNVLGNIILNYDPDSIWTRVGKFCLGCMVVLSFPL 285

>SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 733

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 97/463 (20%), Positives = 176/463 (38%), Gaps = 54/463 (11%)

Query: 33  DRSTEVRPERLSVDSEDRFTSTFLHEQRSK---SNILMAFMNMANSILGAGIIGQPFAVK 89
           +++ + R   LS D E R     +H  RS    ++   AF+ M  S +G G++  P A  
Sbjct: 283 NKTIDERSPLLSGDIESRGGRAKVHAPRSAKGTTSTFKAFLLMIKSFIGTGVLFLPNAFA 342

Query: 90  NCXXXXXXXXXXXXXXXXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLF 149
           N                  W   +++ +   +  +++ D      G   K +IL S  L 
Sbjct: 343 NGGLTFSVCMLSFFGIYSYWCYYILIQSKVATKVSSFGDIGFRLYGTWMKFVILFSLVLT 402

Query: 150 AXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKA 209
                          +   L   F  HD        ++ +   I  PLS  R++SKLS  
Sbjct: 403 QLGFSGAYVVFTAKNLIAFLDNVFRWHDVPIE---YLLFLQLAIFIPLSFIRNVSKLSLT 459

Query: 210 SMLA---LASMXXXXXXXXXKGPGTDSAYKGS------FNSSNLLITPRIFQGLSVISF- 259
           S++A   + +          K    D  +  +      FNSS+      +F G ++ +F 
Sbjct: 460 SLIANFLVMAGLIIVVFFVLKHLILDLHFTPAEGVIMGFNSSSW----SLFIGTAIFAFE 515

Query: 260 --ALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNIL 317
              L+       +  S+K P  ++F  +       A +    +   G+L +   T+  IL
Sbjct: 516 GIGLIIP-----VQDSMKHP--EKFPLVLGLVIGAATVLFVTIATLGYLSYGQNTETVIL 568

Query: 318 NNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMF---------FNSEPKSQPR 368
            N P  +  VN+ +F +   +L + PL++F    +I++ +F          N+    + R
Sbjct: 569 LNLPQGNLCVNLIQFFYSLAILLSTPLQLFPAIAIIENKVFPRFTKIYVKKNNRTDVELR 628

Query: 369 VLSLKL--------HVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVN 420
             S KL        + + S  + F  +     + NL     ++G      + Y+ PP ++
Sbjct: 629 PNSGKLDWKVKWLKNSVRSVIVSFVILLAYYGSENLDKFVSIVGCFACIPLVYMYPPLLH 688

Query: 421 LKLVG-----GNLKWRDRIP---HYVCIGFGFAIMLISSTQTI 455
           L+        G  KW  + P    Y+ I FG   M+ +S Q +
Sbjct: 689 LRSCSKPQCHGVTKWWKKWPIGLDYLLITFGGVSMIYTSYQCV 731

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 79/192 (41%), Gaps = 20/192 (10%)

Query: 177 DNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXXXKG--PGTD-S 233
           D +FH    I ++   ++ PL L ++++ L  ASM+A++++             P  +  
Sbjct: 125 DRVFH----ITLIMAFVAGPLCLLKNLNSLRYASMVAISAVAYLCILVLVHFIFPSQEIK 180

Query: 234 AYKGSF------NSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTH 287
             KG F      N  + L T  IF       FA  CHHN   +    K         +  
Sbjct: 181 DLKGDFAVWFPHNEGSPLSTLPIF------VFAYTCHHNVFAVINEQKKTRFAHVKVIAI 234

Query: 288 FSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIF 347
            +  +A++   L+G  G+  F +   GNI+  +P +  +  + R    F +   FPL+  
Sbjct: 235 IAMLLALVLYVLIGGAGYFTFGNHIVGNIITLYPHSITS-TIGRVAIVFLVTLAFPLQCH 293

Query: 348 VLRDVIKDLMFF 359
             R  I  ++ +
Sbjct: 294 PARASIHHIICY 305

>KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.295
           YIL088C
          Length = 474

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 6/117 (5%)

Query: 255 SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKG 314
           S+I FA V   N   I   L   ++    ++ + S  I+ +    +G TG+L F   T G
Sbjct: 197 SIIIFAYVGAMNLFTIINELSDNNITNISKIINRSIAISTVAFLSVGITGYLTFGSNTLG 256

Query: 315 NILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLM------FFNSEPKS 365
           NI+ N+  N   VN+ +F     +L +FPL    LR    +L+      F  ++P S
Sbjct: 257 NIILNYDPNSIWVNIGKFSLASMLLLSFPLLFHPLRIACNNLVVWFEINFNEAQPSS 313

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 10/89 (11%)

Query: 378 ISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGN-------LKW 430
           I+  L+     I+L   +   +  L+GAT ++ +++ILP     KL+G +       +  
Sbjct: 383 ITVGLLVVMYLIALRITSFALVLALVGATGSTSISFILPGLFGYKLIGSDSLAVGQMISP 442

Query: 431 RDRIPH---YVCIGFGFAIMLISSTQTII 456
           RDR         + FGFA+M++S   T++
Sbjct: 443 RDRFYKKCSLALVWFGFAVMILSLYVTMV 471

>ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 93/425 (21%), Positives = 163/425 (38%), Gaps = 52/425 (12%)

Query: 68  AFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLRISGKTTYQ 127
           AF+ +  S +G G++  P A  N                  W   +++    + G T++ 
Sbjct: 307 AFLLLLKSFIGTGVLFLPHAFSNGGLFFSIVMLLFFGLYSFWCYYILIRAKEVVGVTSFG 366

Query: 128 DSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFH--RNIV 185
           D      G   K +IL S                 +     L+AF S   N+ H   NI 
Sbjct: 367 DIGLRLYGPWVKFIILFSLVFTQLGFSGAYVIFTAEN----LKAFCS---NVLHFSENIP 419

Query: 186 IV---VVTCLISFPLSLNRDISKLSKASMLA---LASMXXXXXXXXXKGPGTDSAYKGSF 239
           I+   +    I  PLS  R++SKLS  S+LA   +            K    +S  K + 
Sbjct: 420 ILYFMLAQFAIFIPLSFIRNVSKLSLPSLLANFFVMGGLVIVLFFSLKQLALESHMKPAE 479

Query: 240 NSSNLLITPR--IFQGLSVISF---ALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAM 294
               L  T R  +F G ++ +F    LV       +  S++ P  ++F  +       + 
Sbjct: 480 GVVLLFNTNRWTMFIGTAIFAFEGIGLVIP-----VQDSMRHP--EKFPLVLGMVIITST 532

Query: 295 IFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIK 354
           +    +G  G+L +  K K  IL N P  + +VN+ +F +   ++ + PL++F    +I+
Sbjct: 533 VLFITIGSIGYLAYGYKIKTVILLNLPQANISVNLIQFFYSLAIMLSTPLQLFPAIKIIE 592

Query: 355 DLMF----------------FNSEPKSQPRVLSLKLHVIISTALVFGTMAI--SLTTCNL 396
           + +F                    P S      +K       +L+ G++ +        L
Sbjct: 593 NKVFPKFIKIYVKKDDNTTGVEMRPNSGKLNWKVKWLKNFVRSLIVGSVILMAYFGADQL 652

Query: 397 GALFELIGATTASLMAYILPPWVNLKLV------GGNLKWRDRIPHYVCIGFGFAIMLIS 450
                LIG+     + Y+ PP ++L+        GG + W   +  YV I FG   M+ +
Sbjct: 653 DKFVALIGSFACIPLVYMYPPMLHLRSCSLPNHKGGRINWSAGL-DYVLIIFGAISMIYT 711

Query: 451 STQTI 455
           S Q++
Sbjct: 712 SYQSV 716

>TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {ON}
           Anc_2.295 YIL088C
          Length = 467

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 52/114 (45%), Gaps = 4/114 (3%)

Query: 251 FQGL----SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFL 306
           F+GL    S+I FA     N   I   LK  S+     + + S  I+      +G  G+L
Sbjct: 187 FKGLLSTFSIIVFAYTGSMNLFSIINELKENSMANITSVINTSITISTAVFLAVGICGYL 246

Query: 307 VFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFN 360
            F   T GNI+ N+  +   V V + C G  ++ +FPL     R  I +L+ ++
Sbjct: 247 TFGSNTLGNIMLNYDPDSTWVYVGKLCLGSMVMLSFPLLFHPCRIAINNLVVWS 300

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
           YIL088C
          Length = 479

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 58/122 (47%), Gaps = 4/122 (3%)

Query: 251 FQGL----SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFL 306
           F+GL    S+I FA     N   I   LK  S++    + + S  I+ I    +G  G+L
Sbjct: 187 FKGLLSTFSIIIFAYTGAMNLFSIINELKNNSMENVSSIINHSISISTILFLTVGIAGYL 246

Query: 307 VFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFNSEPKSQ 366
            F   T GNIL N+  +   V++A+FC    ++ +FPL    LR  + +L+ +       
Sbjct: 247 TFGCNTLGNILLNYDADSVWVSIAKFCLAIMLVLSFPLLFHPLRIAVNNLVVWLEINYGT 306

Query: 367 PR 368
           P+
Sbjct: 307 PQ 308

>TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {ON}
           Anc_2.177 YNL101W
          Length = 444

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 77/168 (45%), Gaps = 28/168 (16%)

Query: 280 KRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNF-PGNDNAVNVARFCFGFNM 338
           K F ++         I   L+G  G+L + +K K  IL +F PG    VN+   CF   +
Sbjct: 237 KDFPKILLLVMLTMSIIFILIGTCGYLSYGEKIKVIILQSFAPGI--FVNIIIVCFTIGI 294

Query: 339 LTTFPLEIFVLRDVIKDLMFF----------------------NSEPKSQ-PRVLSLKLH 375
           L + PL++F L  +++D +F                        S+ ++Q  + ++L+++
Sbjct: 295 LLSTPLQLFSLTSLLEDFLFTKKKIAVADEDLKVLEESDILCSESDTEAQGTKHINLRVY 354

Query: 376 VIISTALVFGTMAI--SLTTCNLGALFELIGATTASLMAYILPPWVNL 421
            II   L+  T+ +   +T+  L  L  ++G+     + YI PP +NL
Sbjct: 355 KIILRFLIVTTVCLIGYITSDKLNKLVAIVGSLACIPLVYIYPPLLNL 402

>KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 601

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 96/417 (23%), Positives = 159/417 (38%), Gaps = 41/417 (9%)

Query: 57  HEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVV 116
           H Q  KS+   A + +  S +G G++  P A  N                  +   L++ 
Sbjct: 203 HRQPHKSSTFKAVLLLLKSFVGTGVLFLPRAFHNGGWAFSTTCLLACGVISYYCFVLLIN 262

Query: 117 NLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGH 176
                    Y D      GR  +L IL S  L                    L+ FFS  
Sbjct: 263 TKLKKNVNGYGDLGAAVYGRNMELAILGSIVLSQIGFVAAYAVFTATN----LQVFFS-- 316

Query: 177 DNLFHRNIVIV---VVTCLISFPLSLNRDISKLSKASMLA--------LASMXXXXXXXX 225
            ++FH    +V    V  L+  PLSL R+I+KLS  ++LA        L           
Sbjct: 317 -SVFHWEASMVFWLAVQLLLYLPLSLTRNIAKLSGTALLADLFIMFGLLYVYYYCSRYVA 375

Query: 226 XKGPGTDSAYKGSFNSSNLLITPRIF--QGLSVISFALVCHHNTSFIYFSLKTPSLKRFD 283
             G  +DS    + N   L I   IF  +G+ ++            I  S+K P  ++F+
Sbjct: 376 HNGVASDSMLVFNKNDWTLFIGTAIFTYEGIGLL----------IPIQESMKHP--EKFN 423

Query: 284 RL---THFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLT 340
           +       S  IA I C L+ ++    F    +  IL NFP         +  +   ++ 
Sbjct: 424 KCLLGVMVSVSIAFILCGLLCYSA---FGSSVETVILLNFPRKSAMTASVQLLYALAIML 480

Query: 341 TFPLEIFVLRDVIKDLMF-FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGAL 399
           + PL++F +  +++  +F  N+  K  PRV  +K +  I   L   T+   L   +L   
Sbjct: 481 STPLQLFPIIRILETSIFPKNASGKYNPRVKWMKNYFRIGIVLA-NTLIAWLGANDLDKF 539

Query: 400 FELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIG-FGFAIMLISSTQTI 455
             ++G+     + YI PP ++ K        +  +   V I  FG A+M  ++ Q +
Sbjct: 540 VSIVGSFACIPLIYIYPPMLHYKAFSNGGGSKLSLGCDVAIASFGVAVMTYTTYQAV 596

>KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 460

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 71/163 (43%), Gaps = 11/163 (6%)

Query: 187 VVVTCLISFPLSLNRDISKLSKAS---MLALASMXXXXXXXXXKG--PGTDSAYKGSFNS 241
           ++++ +I  PLSL R    L   S   +LAL  +          G  P     +    + 
Sbjct: 121 ILLSAIIIVPLSLLRHFDSLKYTSVIGLLALGYIGLLIIGSYSFGNYPKPKVDWFSISDR 180

Query: 242 SNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMG 301
           S +L T       S+I FA     N   I   LK  S+    ++ + S  ++     ++G
Sbjct: 181 SGVLTT------FSIIVFAFTGSMNLFSIINELKENSMTNIKKIINNSIVVSSACFIILG 234

Query: 302 FTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPL 344
             G+L F  +T GN++ N+  +  +V  ARF  G  ++ +FPL
Sbjct: 235 LFGYLTFGKETLGNVILNYDADKLSVRFARFNLGLMVVLSFPL 277

>NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177
          Length = 705

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 86/209 (41%), Gaps = 27/209 (12%)

Query: 273 SLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARF 332
           S+K P  ++F  +       A I    +   G+L +       IL N P ++  VN+ + 
Sbjct: 499 SMKNP--EKFPLVLGLVLITATILFISIATIGYLSYGSSIDVVILLNLPQSNIFVNLIQL 556

Query: 333 CFGFNMLTTFPLEIFVLRDVIKDLMF-----FNSEPKSQPRVLSLKL------------- 374
            +   ++ + PL++F    +I+  +F       ++  + P    L L             
Sbjct: 557 FYSLAIMLSTPLQMFPAIKIIESKLFPKFIKVYAKDGNSPGSYELSLNSGKLNWKVKWLK 616

Query: 375 HVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLK------LVGGNL 428
           + + S  +    +   L   NL  +  +IG+     + YI PP ++L+       V   +
Sbjct: 617 NFVRSIIVTLVVLIAYLEVENLDKVVSIIGSLACIPLVYIYPPLLHLRSHSIPFSVNQKV 676

Query: 429 KWRDRIPHYVCIGFGFAIMLISSTQTIIS 457
           KWR  +  Y+ +GFG   M  +S Q+I S
Sbjct: 677 KWR-VLFDYLLVGFGTVSMFYTSYQSIFS 704

>KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]
           {ON} similar to uniprot|P36062 Saccharomyces cerevisiae
           YKL146W AVT3 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 573

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 84/409 (20%), Positives = 153/409 (37%), Gaps = 40/409 (9%)

Query: 68  AFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLRISGKTTYQ 127
           A + +  S +G G++  P A  N                  +   L++      G   Y 
Sbjct: 189 AVLLLLKSFVGTGVLFLPRAFHNGGWLFSTLCLLFCATVSFYCFILLIDTKTAVGVDGYG 248

Query: 128 DSVELAMGRKGKLLIL----LSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFHRN 183
           +      G K K  +L    LS   FA                  L+AFF    +L +  
Sbjct: 249 ELGSRLFGPKLKFTVLSSIVLSQIGFAAAYTVFTATN--------LQAFFKHVFSLEYSL 300

Query: 184 IVIVVVTCLISFPLSLNRDISKLSKASMLA--------LASMXXXXXXXXXKGPGTDSAY 235
           I  +++      PLSL R+I++LS  +++A        +             G  +DS  
Sbjct: 301 IFWIMIQLAFYLPLSLTRNIARLSATALVADLFILLGLVYVYYYSSFYIWNHGIASDSMV 360

Query: 236 KGSFNSSNLLITPRIFQGLSVISFA----LVCHHNTSFIYFSLKTPSLKRFDRLTHFSCF 291
             SFN S+      +F G ++ ++     L+  H       S++ P+   F     +   
Sbjct: 361 --SFNKSDW----TLFIGTAIFTYEGIGLLIPIHE------SMEKPA--HFKPALMYVIL 406

Query: 292 IAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRD 351
           +  I     G   +  F  K +  IL NFP N    N  +  +   +L + PL++F    
Sbjct: 407 VVTIIFISCGLICYSAFGAKVETVILLNFPSNSIFTNAVQLIYALAILLSTPLQLFPAIK 466

Query: 352 VIKDLMFFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLM 411
           ++++ +F  +        +  + +   +  ++   +   +   +L     LIG+     +
Sbjct: 467 ILENKIFHKNASGKFDAKVKWRKNYFRAFVVLIAVIIAWIGANDLDKFVSLIGSFACIPL 526

Query: 412 AYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYIN 460
            YI PP  + K+   N K +  I   + I FG  +M  +S QTI  +I+
Sbjct: 527 IYIYPPLFHYKVFENNKKLQ-AIDLAILI-FGALVMSYTSWQTIALWIH 573

>TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.177
           YNL101W
          Length = 749

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 89/408 (21%), Positives = 156/408 (38%), Gaps = 50/408 (12%)

Query: 45  VDSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXX 104
           V S  R +   +   + K+    AF+ +  S +G GI+  P A                 
Sbjct: 321 VTSGVRVSKPMIQTAKGKTPTTKAFLLLLKSFIGTGILFLPNAFSKGGLLFSIGMLLFFG 380

Query: 105 XXXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDT 164
               W   +++ + +I+  +++ D   +  GR  K +IL S  L                
Sbjct: 381 LYSYWCYFILIRSKQITKVSSFGDIGLILYGRWMKTIILCSLVLTQIGFSAAYVIFCAKN 440

Query: 165 IPHVLRAFFSGHDNLFHRNIVIVVVTCLISF-PLSLNRDISKLSKASMLA---------- 213
               LRAF     N    NI  +++  LI F PLS  R++SKLS  S++A          
Sbjct: 441 ----LRAFIINVFNFPDFNISYLMIFQLIVFIPLSFVRNVSKLSLTSLMANFMIMGGLLI 496

Query: 214 -LASMXXXXXXXXXKGPGTDSAYKGSFNSSNLLITPRIF--QGLSVISFALVCHHNTSFI 270
            L              P     Y  + +  ++ I   IF  +G+ +I            +
Sbjct: 497 VLFFCIKHLFIDLQMKPEAGVIYGFNPDLWSVFIGTAIFAFEGIGLIIP----------V 546

Query: 271 YFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVA 330
             S+K P  + F  +       A +   L+G  G+L +    +  IL N   ++  VN+ 
Sbjct: 547 QDSMKHP--EHFPFVLFLVILTATVLFILIGTIGYLAYGKYIETVILMNLSQSNVFVNLV 604

Query: 331 RFCFGFNMLTTFPLEIFVLRDVIKDLMF--FNSEPKSQPRVLSL--KLH----------- 375
           +  +   +L + PL++F    +I++ MF  F S      + LS   KL+           
Sbjct: 605 QLFYSVAILLSTPLQLFPAIKIIENRMFTSFRSTDNGSSQFLSNSGKLNWRIKWRKNCLR 664

Query: 376 -VIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLK 422
            +I+S  ++   +  +    NL     LIG+     + Y+ PP ++LK
Sbjct: 665 SIIVSCVILIAYLGYN----NLDKFVSLIGSFACIPLVYMYPPMLHLK 708

>Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii ACR051C
          Length = 627

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/311 (21%), Positives = 124/311 (39%), Gaps = 38/311 (12%)

Query: 169 LRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLA-------LASMXXXX 221
           L+ FF       HR  V + +  ++  PL+L R IS+LS  ++ A       L  +    
Sbjct: 336 LQVFFGEVFGWSHRLSVYIFLQLVVYLPLALTRRISRLSGTALAADVLILFGLVYVYGYS 395

Query: 222 XXXXXKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKR 281
                +  G  S     FN  +      +F G ++ ++  +           L  P  + 
Sbjct: 396 AVYVLR-YGVASQSMKMFNRQDW----TLFVGTAIFTYEGI----------GLLVPIQES 440

Query: 282 FDRLTHF-SCFIAMIFCFL-----MGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFG 335
             R   F SC + +I          G   +  F  + +  IL NFP +    +  +F + 
Sbjct: 441 MSRPGRFASCLVWVIAAVTSIFISCGLLCYSAFGSRVETVILLNFPKDSVLSSSVQFLYA 500

Query: 336 FNMLTTFPLEIF-VLRDVIKDLMFFNSEPKSQPRVLSLK--LHVIISTALVFGTMAISLT 392
             ++ + PL++F  +R +   ++  +   K  PRV   K    V++    VF T++I+  
Sbjct: 501 MAIMLSTPLQLFPAIRILEHGIISSSVSGKHDPRVKWAKNWFRVLV----VFVTVSIAWV 556

Query: 393 TC-NLGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDR--IPHYVCIGFGFAIMLI 449
              +L     LIG+     + YI PP ++  L  G  +  +       + + FG   M  
Sbjct: 557 GADDLDKFVSLIGSFACVPLIYIYPPLLHYMLFKGTGRVSNAALFLDQLVVWFGVIGMFY 616

Query: 450 SSTQTIISYIN 460
           +S+QT+  ++ 
Sbjct: 617 TSSQTVKQWLQ 627

>Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa]
           {ON} complement(188477..190204) [1728 nt, 576 aa]
          Length = 575

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 86/191 (45%), Gaps = 8/191 (4%)

Query: 273 SLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARF 332
           S+  P L R   L+     + +IF   +G   +  F    +  +L NFP +     + + 
Sbjct: 388 SMAKPHLFRLS-LSLVMVIVTLIFV-SVGLLCYSAFGSDVETVVLLNFPQDSPYTLIVQL 445

Query: 333 CFGFNMLTTFPLEIFVLRDVIKDLMFFNS-EPKSQPRVLSLKLHVIISTALVFGTMAISL 391
            +   +L + PL++F    ++++ +F +    K  P++   K +    T +V GT  I+ 
Sbjct: 446 LYSLAILLSTPLQLFPAIRILENWVFKSRYSGKYNPKIKWAKNY--FRTLVVIGTSFIAW 503

Query: 392 TTC-NLGALFELIGATTASLMAYILPPWVNLKLV--GGNLKWRDRIPHYVCIGFGFAIML 448
               +L     L+G+     + YI PP +++K +   G +     I     I FGF I++
Sbjct: 504 IGADDLDKFVSLVGSFACIPLIYIYPPLLHIKALKRNGTVTNLHLIVDSCMIIFGFTILI 563

Query: 449 ISSTQTIISYI 459
            +S QTI  +I
Sbjct: 564 YTSCQTIKLWI 574

>NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {ON}
           Anc_5.252
          Length = 721

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 127/292 (43%), Gaps = 35/292 (11%)

Query: 187 VVVTCLISFPLSLNRDISKLSKASMLA--------LASMXXXXXXXXXKGPGTDSAYKGS 238
           +++  LI  PLSL R I+KLS  +++A        +             G  ++S    +
Sbjct: 447 IILQQLIFIPLSLTRKIAKLSGTALIADLFILLGLIYVYYYSSYYILSNGIASESMLWLN 506

Query: 239 FNSSNLLITPRIF--QGLSVISFALVCHHNTSFIYFSLKTPSLKRFDR-LTHFSCFIAMI 295
               +L I   IF  +G+ ++            I  S++ P +  F + L+   C + +I
Sbjct: 507 KADWSLFIGTAIFTFEGIGLLIP----------IQESMQNPQV--FPKCLSLVMCIVTII 554

Query: 296 F--CFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVI 353
           F  C L+ ++ F    +K +  +L NFP +     + +  +   +L + PL++F    ++
Sbjct: 555 FISCGLICYSAF---GEKVETVVLLNFPQDSAFTLMVQLLYSLAILLSTPLQLFPAIKIL 611

Query: 354 KDLMF-FNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMA 412
           ++  F  ++  K   R+   K +      ++F  M   +   +L     L+G+     + 
Sbjct: 612 ENWTFPIHASGKHNSRI-KWKKNYFRCIMVIFTAMVAWVGANDLDKFVSLVGSFACIPLI 670

Query: 413 YILPPWVNLKL----VGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYIN 460
           YI PP ++ K         +++R  +   V + FG  IM+ +S +TI  +++
Sbjct: 671 YIYPPLLHFKAFLNDTSKTMRFRLGLDMLVFV-FGIIIMVYTSWETISMWVH 721

>ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL088C
          Length = 468

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 63/163 (38%), Gaps = 5/163 (3%)

Query: 187 VVVTCLISFPLSLNRDISKLSKASML---ALASMXXXXXXXXXKGPGTDSAY--KGSFNS 241
           +  +  +  PLS  R    L  +S+L   A+A +         +G  T  A+  +G    
Sbjct: 121 IAASAAVVVPLSHLRRFDSLKYSSVLGLVAIAYLALMIVAAWIEGLTTGYAHYERGEVRW 180

Query: 242 SNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMG 301
                   +    S+I FA     N   I   L   S++   R+ ++S   +     L+G
Sbjct: 181 LRPASLREMVSTFSIIVFAFTGSMNMFSIINELGDNSMRNIQRIVYYSIAASTALFILVG 240

Query: 302 FTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPL 344
             G+L F      N++ NF  +  +  V     G  +L +FPL
Sbjct: 241 MAGYLTFGSNVAQNVILNFDPDAVSTQVGSLALGLMVLLSFPL 283

>Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101W
           (REAL)
          Length = 715

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 75/330 (22%), Positives = 135/330 (40%), Gaps = 61/330 (18%)

Query: 169 LRAFFSGHDNLFHRNIV----IVVVTCLISFPLSLNRDISKLSKASMLA----LASMXXX 220
           L+AF    DN+FH  ++    +++   +I  PLS  R+ISKLS  S+LA    +A +   
Sbjct: 401 LQAFL---DNVFHAGVLPLSFLMIFQTIIFIPLSFIRNISKLSLPSLLANFFIMAGLVIV 457

Query: 221 XXXXXXK-------GPGTDSAYKGSFNSSNLLITPRIF--QGLSVISFALVCHHNTSFIY 271
                 +        P     Y  + +   L I   IF  +G+ +I            + 
Sbjct: 458 IIFTAKRLFFDLKASPAMGVVYGLNMDRWTLFIGTAIFAFEGIGLIIP----------VQ 507

Query: 272 FSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVAR 331
            S++ P  ++F  +       A I    +   G+L +    +  IL N P ++  VN+ +
Sbjct: 508 DSMRNP--EKFPLVLALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQ 565

Query: 332 FCFGFNMLTTFPLEIFVLRDVIKDLMF------------FNSEPKSQP-------RVLSL 372
             +   ++ + PL++F    +I++  F              +  + +P       RV  L
Sbjct: 566 LFYSIAIMLSTPLQLFPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLDWRVKWL 625

Query: 373 KLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGNLK--- 429
           K + I S  ++         + NL     +IG+     + YI P  ++L+  G +L    
Sbjct: 626 K-NFIRSIIVIIVVAIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLR--GNSLPETK 682

Query: 430 ---WRDR-IPHYVCIGFGFAIMLISSTQTI 455
              WR + +   + I FG A ML +S Q+I
Sbjct: 683 GKFWRFKPMLDIILIFFGIASMLYTSYQSI 712

>KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 87/208 (41%), Gaps = 27/208 (12%)

Query: 273 SLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARF 332
           S+K P  ++F  +       A +    +   G+L +  +T+  IL N P +   VN+ +F
Sbjct: 511 SMKHP--EKFPLVMALVIITATVLFVSVATLGYLSYGAETQTVILLNLPQDSILVNLIQF 568

Query: 333 CFGFNMLTTFPLEIFVLRDVIKDLMF---------------FNSEPKSQPRVLSLKLHVI 377
            +   +L + PL++F    +I++ +F                  +P S      +K    
Sbjct: 569 FYSSAILLSTPLQLFPAIAIIENKVFPKFTKIYVKRSDHTKIQYKPNSGKLDWRIKWLKN 628

Query: 378 ISTALVFGTMAIS--LTTCNLGALFELIGATTASLMAYILPPWVNL------KLVGGNLK 429
              +L+  ++ I+      +L A   ++G+     + YI PP ++L      +  G    
Sbjct: 629 FVRSLIVSSVVIAAYFGANHLDAFVAIVGSLACIPLVYIYPPMLHLRSCSKPRFAGEKSV 688

Query: 430 WRDR--IPHYVCIGFGFAIMLISSTQTI 455
           WR    +  YV + FG   M+ +S Q+I
Sbjct: 689 WRKWPILLDYVLVVFGAIGMVYTSYQSI 716

>Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088C -
           Hypothetical ORF [contig 27] FULL
          Length = 471

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 73/169 (43%), Gaps = 7/169 (4%)

Query: 182 RNIVIVVVTCLISFPLSLNRDISKLSKASML---ALASMXXXXXXXXXKGPG-TD--SAY 235
           RN+ I+  + LI  PLSL + +  L  +S+L   A+A +         +    TD  +A 
Sbjct: 120 RNMWIMA-SALIIVPLSLVKKLDSLKYSSILGLFAIAYLVCLIVGAFLRDVVFTDNYTAI 178

Query: 236 KGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMI 295
           +G  +   +     +    +++ FA     N   I   LK  S+   +++   +  I+  
Sbjct: 179 RGDVSWIRVYDFKGLISTFTIVIFAYTGSMNMFSIINELKDNSMTNINKVVSTTITISSF 238

Query: 296 FCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPL 344
               +G  G+L F   T GNI+ N+  N       + C G  ++ +FPL
Sbjct: 239 LFLAVGLCGYLTFGSNTLGNIMLNYDPNSAWTTTGKLCLGSMVILSFPL 287

>TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 84/193 (43%), Gaps = 37/193 (19%)

Query: 299 LMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMF 358
           L+G  G+L F       IL++F   +  V++A+ C+   +L + P+++F +  ++++ +F
Sbjct: 367 LIGTLGYLTFGKDITPVILSSFNQKNKFVSIAQLCYSIAILLSTPIQLFPVYKMVEEAIF 426

Query: 359 -----------FNSEPK---SQPRVLSLKLHVIIS----------------TALVFGTMA 388
                       +SEP+   ++     L   +I+S                T ++  T+ 
Sbjct: 427 KKNKNNTAISSTSSEPQDNDNEENKAMLTEKIILSGRDSNKIKWLKNLSRTTIVLLVTII 486

Query: 389 ISLTTCNLGALFELIGATTASLMAYILPPWVNLKL------VGGNLKWRDRIPHYVCIGF 442
               + +L     ++G+     + YI PP+ +LK       +    KWR  I   + I F
Sbjct: 487 SYFGSQDLSKFVAIVGSVACIPLIYIYPPFFHLKTHSLPNSLNLKFKWRVIIDITLLI-F 545

Query: 443 GFAIMLISSTQTI 455
           G   +L +S Q+I
Sbjct: 546 GLLAVLYTSYQSI 558

>TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {ON}
           Anc_7.420 YER119C
          Length = 453

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 74/186 (39%), Gaps = 35/186 (18%)

Query: 181 HRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMXXXXXXXX------------XKG 228
           +R ++I +V   I  PLS  + I+ L   S LA+ S+                     +G
Sbjct: 113 NRFLLITLVWGFIIAPLSFLKKITALRYTSFLAVVSVIYLSILVTFHYADPSQEIIDLRG 172

Query: 229 ------PGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRF 282
                 PG D       NS    ++P  F+ L +  FA  CHHN   ++  L   S   F
Sbjct: 173 NVSLFFPGEDQ-----HNS----VSP--FKTLPIFVFAYTCHHN---MFAVLNEQSTNEF 218

Query: 283 DRLTHF---SCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNML 339
            +L +    +  IA I   ++G  G++ F      NI+  +P N  A  + +      + 
Sbjct: 219 SKLKYIPLTAISIACIMYLIVGTFGYVTFGSNITSNIVAQYPTNSIATILGQTAMLTVVT 278

Query: 340 TTFPLE 345
             FPL+
Sbjct: 279 LAFPLQ 284

>KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7
          Length = 468

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 53/126 (42%), Gaps = 6/126 (4%)

Query: 232 DSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCF 291
           D ++ G ++   L+ T       ++I FA     N   I   LK  S++  +++   S  
Sbjct: 178 DVSWIGVYDKKGLVST------FTIIVFAFTASMNLFSIINELKDNSMQNINKVITSSIS 231

Query: 292 IAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRD 351
            +      +G  G+L F     GNI+ N+        + + C G  ++ +FPL +   R 
Sbjct: 232 TSAALFLSVGVCGYLTFGSNVVGNIMLNYDPESIWTTIGKLCLGTMVILSFPLLLHPCRI 291

Query: 352 VIKDLM 357
              ++M
Sbjct: 292 AANNMM 297

>AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL101W
           (AVT4)
          Length = 716

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 83/437 (18%), Positives = 163/437 (37%), Gaps = 63/437 (14%)

Query: 60  RSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLR 119
           R K++   AF+ M  S +G G++  P A  N                  W   ++V +  
Sbjct: 296 RVKTSTFKAFLLMIKSFIGTGVLFLPNAFSNGGLAFSISMLFFFSAYSYWCYYILVRSKD 355

Query: 120 ISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNL 179
            +G +++ D   +  G   K +IL S  L                +   L       DN+
Sbjct: 356 ATGVSSFGDIGGILFGSWMKFIILFSLVLTQMGFAGAYVVFTAKNLIAFL-------DNV 408

Query: 180 FHRNIV----IVVVTCLISFPLSLNRDISKLSKASMLA----LASMXXXXXXXXXKGPGT 231
           F+   +    +++    I  PLS  R++SKLS  S+ A    ++ +         +    
Sbjct: 409 FNWPDIPVKYLLLTQLFIFIPLSFVRNVSKLSITSLFANFFIISGLIIVVYYTACRW--- 465

Query: 232 DSAYKGSFNSSN---LLITPR---IFQGLSVISF---ALVCHHNTSFIYFSLKTPSLKRF 282
              Y  SF  +    ++  P    +F G ++ +F    L+       +  S++ P  + F
Sbjct: 466 --MYDLSFKPAEGVIMVFNPNRWSLFIGTAIFAFEGIGLIIP-----VQESMRHP--EEF 516

Query: 283 DRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTF 342
            ++         +    +G  G+L +  + +  IL N P +  +VN+ +  +   +L + 
Sbjct: 517 PKVLGLVIITTTVLFITIGTLGYLAYGSQIQSVILLNLPQDALSVNMIQLFYSMAILLST 576

Query: 343 PLEIFVLRDVIK------------------DLMFFNSEPKSQPRVLSLKLHVIISTALVF 384
           PL++F    +I+                  D     +  ++  RV   K +++ S  ++ 
Sbjct: 577 PLQLFPAIGIIENKFFPRFTKVDIKGQDSADFQLQQNSGRANWRVKWSK-NLVRSIIVLL 635

Query: 385 GTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVG-----GNLKWRDR---IPH 436
             +       NL     ++G      + YI P  ++L+         +  W+ R   +  
Sbjct: 636 VIILAYFGADNLDLFVSIVGCLACIPLVYIYPSMLHLRSCSTPDHEKSNTWKTRCSVLID 695

Query: 437 YVCIGFGFAIMLISSTQ 453
           Y+ I FGF  M  +S Q
Sbjct: 696 YILIIFGFVSMCYTSYQ 712

>Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101W
           (REAL)
          Length = 713

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 71/329 (21%), Positives = 132/329 (40%), Gaps = 59/329 (17%)

Query: 169 LRAFFSGHDNLFHRNIV----IVVVTCLISFPLSLNRDISKLSKASMLA----LASMXXX 220
           L+AF    DN+FH  ++    ++V   ++  PLS  R+ISKLS  S+LA    +A +   
Sbjct: 399 LQAFL---DNVFHVGVLPLSYLMVFQTIVFIPLSFIRNISKLSLPSLLANFFIMAGLVIV 455

Query: 221 XXXXXXK-------GPGTDSAYKGSFNSSNLLITPRIF--QGLSVISFALVCHHNTSFIY 271
                 +        P     Y  + +   L I   IF  +G+ +I            + 
Sbjct: 456 IIFTAKRLFFDLKATPAAGVIYGLNTDRWTLFIGTAIFAFEGIGLIIP----------VQ 505

Query: 272 FSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVAR 331
            S++ P  ++F  +       A +    +   G+L +    +  IL N P ++  VN+ +
Sbjct: 506 DSMRNP--EKFPLVLGLVILTATLLFISIATLGYLAYGSSVRTVILLNLPQSNIFVNLIQ 563

Query: 332 FCFGFNMLTTFPLEIFVLRDVIKDLMF------------FNSEPKSQPRVLSLKLHV--- 376
             +   ++ + PL++F    +I++  F              +  + +P    L   +   
Sbjct: 564 LFYSIAIMLSTPLQLFPAIKIIENKFFPKFTKIYVKHNDLTTRVELRPNSGKLNWKIKWL 623

Query: 377 ---IISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGNLK---- 429
              I S  ++         + NL     +IG+     + YI P  ++L+  G +L     
Sbjct: 624 KNFIRSIIVIIVVAIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLR--GNSLPETKG 681

Query: 430 --WRDR-IPHYVCIGFGFAIMLISSTQTI 455
             WR + +   + I FG A ML +S Q+I
Sbjct: 682 EFWRFKPVLDSILIFFGIASMLYTSYQSI 710

>KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.420
           YER119C
          Length = 545

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 77/198 (38%), Gaps = 14/198 (7%)

Query: 182 RNIVIVVVTCLISFPLSLNRDISKLSKASMLA--LASMXXXXXXXXXKGPGTDSAYKGSF 239
           R + I++V   ++ PLS    +S L  + +L+  L ++            G      G+ 
Sbjct: 120 RWLCILLVAACLALPLSCIHGLSVLGYSPILSSTLTAVLAVCMPLFYLFGGVSPFDAGTV 179

Query: 240 NSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDR--LTHFSCFIAMIFC 297
             +     PR+  GL ++ F   CH N        +   LK   R  LT+ + + A+  C
Sbjct: 180 TRATSNGAPRLL-GLPLLMFMFTCHQNIFPTLNCARERGLKHTLRVPLTYLAAYAAV--C 236

Query: 298 FLMGFTGFLVFKDKTK---GNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIK 354
            + G TG+L F   T+    N+L  +P       + R     ++  +FPL     R  + 
Sbjct: 237 LICGITGYLTFHKSTRTIPSNVLLLYPQGSILGTLCRVTTLLSVTLSFPLLCHPTRAALN 296

Query: 355 DLMFF----NSEPKSQPR 368
            +            SQPR
Sbjct: 297 HIWAHWGRGQDSQASQPR 314

>ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL146W
          Length = 678

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 58/285 (20%), Positives = 116/285 (40%), Gaps = 22/285 (7%)

Query: 185 VIVVVTCLISFPLSLNRDISKLSKASMLA--------LASMXXXXXXXXXKGPGTDSAYK 236
           V V     +  PL+L R I+KLS  ++LA        +             G  TDS   
Sbjct: 403 VYVAAQAAVYLPLALTRRITKLSATALLADLFILLGLVYVYYFSASQVVQHGAATDSML- 461

Query: 237 GSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIF 296
            +FN S+      +F G ++ ++  V       I  S+++P  ++F R   +   +A+  
Sbjct: 462 -AFNPSSWT----VFLGTAIFTYEGVGLLIP--IQESMRSP--EKFRRCLLW-VMVAVTA 511

Query: 297 CFL-MGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKD 355
            F+  G   +  F  K +  IL NFP +       +  +   ++ + PL++F    ++++
Sbjct: 512 VFISFGMLCYAAFGAKVETVILLNFPQDSALGTGVQLLYAAAIMLSTPLQLFPAIRILEN 571

Query: 356 LMFFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYIL 415
           ++   S        +    +   +  +V   +  SL + +L     LIG+     + Y+ 
Sbjct: 572 VVVTTSRSGKYSTKVKWIKNWFRALVVVLMLVLASLGSNDLDKFVSLIGSFACIPLIYVY 631

Query: 416 PPWVNLKLV--GGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISY 458
           PP ++  +    G +           + FG  IM  ++ QT++ +
Sbjct: 632 PPLLHYVVFRGTGTVSQVALALDLAVMAFGLGIMGYTTVQTVVQW 676

>YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 713

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 134/329 (40%), Gaps = 59/329 (17%)

Query: 169 LRAFFSGHDNLFHRNIV----IVVVTCLISFPLSLNRDISKLSKASMLA----LASMXXX 220
           L+AF    DN+FH  ++    ++V   +I  PLS  R+ISKLS  S+LA    +A +   
Sbjct: 399 LQAFL---DNVFHVGVLPLSYLMVFQTIIFIPLSFIRNISKLSLPSLLANFFIMAGLVIV 455

Query: 221 XXXXXXK-------GPGTDSAYKGSFNSSNLLITPRIF--QGLSVISFALVCHHNTSFIY 271
                 +        P     Y  + +   L I   IF  +G+ +I            + 
Sbjct: 456 IIFTAKRLFFDLMGTPAMGVVYGLNADRWTLFIGTAIFAFEGIGLIIP----------VQ 505

Query: 272 FSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVAR 331
            S++ P  ++F  +       A I    +   G+L +    +  IL N P ++  VN+ +
Sbjct: 506 DSMRNP--EKFPLVLALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQ 563

Query: 332 FCFGFNMLTTFPLEIFVLRDVIKDLMF----------FNSEPKSQPRVLSLKLHVIISTA 381
             +   ++ + PL++F    +I++  F           +   + + R  S KL+  I   
Sbjct: 564 LFYSIAIMLSTPLQLFPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLNWKIKWL 623

Query: 382 LVFGTMAISLT--------TCNLGALFELIGATTASLMAYILPPWVNLKLVGGNLK---- 429
             F    I +         + NL     +IG+     + YI P  ++L+  G +L     
Sbjct: 624 KNFIRSIIVIIVVSIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLR--GNSLPETKG 681

Query: 430 --WRDR-IPHYVCIGFGFAIMLISSTQTI 455
             WR + +   + I FG A ML +S Q+I
Sbjct: 682 EFWRFKPMLDTILIFFGIASMLYTSYQSI 710

>NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {ON}
           Anc_2.177
          Length = 710

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 99/478 (20%), Positives = 174/478 (36%), Gaps = 78/478 (16%)

Query: 25  DNFELSSFDRSTEVRPERLSVDSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQ 84
           DN  L S    T + P      S+ R +   +H  R  ++    F+ +  S +G GI+  
Sbjct: 261 DNEYLLSTTERTPLLP------SQSRLSKAAIHSARGTTSTAKTFLLLLKSFMGTGILFL 314

Query: 85  PFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILL 144
           P A  N                  W   ++      +G++++ D      G   K +IL 
Sbjct: 315 PAAFHNGGLLFSIIMLFFFGIYSYWCYYILTKAKVATGQSSFGDIGLKLYGPSMKFIILF 374

Query: 145 SNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDIS 204
           S  L                +    + FF   D  F   I ++      S    L+R +S
Sbjct: 375 SLVLTQLGFSAAYMIFTAKNLNAFCQNFFLLEDINF---IYLMGFQLFFSSHYHLSRKVS 431

Query: 205 KLSKASMLA---------------LASMXXXXXXXXXKG--PGTDSAYKGSFNSSNLLIT 247
           KLS  S++A               +  +          G  PG +S     F  + +   
Sbjct: 432 KLSLPSLIANVFVMTGLAIVLFFLVRHLFLELHLHPAAGVIPGLNSDRWTMFIGTAIFA- 490

Query: 248 PRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFL-MGFTGFL 306
              F+G+ +I            I  S+K P  ++F  +  F   IA  F F+ +   G+L
Sbjct: 491 ---FEGIGLIIP----------IQDSMKNP--EKFPLVLGF-VLIAATFLFITIASIGYL 534

Query: 307 VFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIK------------ 354
            +   T+  IL N P +   V   +  +   ++ + PL++F    +I+            
Sbjct: 535 SYGSSTEVVILLNLPQDSIFVISIQLFYSLAIMLSTPLQMFPAIKIIENKVFPRFTKIYV 594

Query: 355 -------DLMFFNSEPKSQPRVLSLK---LHVIISTALVFGTMAISLTTCNLGALFELIG 404
                  D+ F  +  K+  +V  LK     +I+S  ++F    +     NL  +  LIG
Sbjct: 595 EGDGDRCDVEFRLNSGKANWKVKWLKNFVRSIIVSFVIIFAYYEVD----NLDKVVSLIG 650

Query: 405 ATTASLMAYILPPWVNL-------KLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTI 455
           +     + YI PP ++L          G   KW+  + H + + FG   M+ +S Q++
Sbjct: 651 SFACIPLVYIYPPLLHLRSRSRSQSPSGDPSKWKLVLDH-ILVVFGGISMIYTSYQSM 707

>Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {ON}
           YNL101W - Hypothetical ORF [contig 60] FULL
          Length = 720

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 88/210 (41%), Gaps = 31/210 (14%)

Query: 273 SLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARF 332
           S+K P  ++F  +       A +    +G  G+L +  KT+  IL N P  +  VN+ +F
Sbjct: 513 SMKHP--EKFPLVLALVIISATVLFVTVGTLGYLSYGAKTETVILLNLPQGNILVNLIQF 570

Query: 333 CFGFNMLTTFPLEIFVLRDVIKDLMF---------------FNSEPKSQP---RVLSLKL 374
            +   +L + PL++F    +I++ +F                + +P S     RV  LK 
Sbjct: 571 FYSSAILLSTPLQLFPAIAIIENKVFPKFTKIYVKRSDHTKVHYKPNSGKLDWRVKWLK- 629

Query: 375 HVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGNL------ 428
           + + S  +    +A      +L     ++G+     + YI PP ++L+            
Sbjct: 630 NFVRSLIVSLVVIAAYFGADHLDTFVSIVGSFACIPLVYIYPPMLHLESCSRPACQNETS 689

Query: 429 ---KWRDRIPHYVCIGFGFAIMLISSTQTI 455
              KW   +  YV I FG   M+ +S Q+I
Sbjct: 690 IWKKWPMAV-DYVLIIFGAIGMVYTSYQSI 718

>Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AER380C
          Length = 715

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 64/141 (45%), Gaps = 17/141 (12%)

Query: 299 LMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMF 358
           L+G  G+L +    +  IL N P    +VN+ +F +   +L + PL++F    +I++ +F
Sbjct: 532 LVGSLGYLAYGKYIQSVILLNLPQKSLSVNLIQFFYSMAILLSTPLQLFPAIAIIENKIF 591

Query: 359 -----FNSEPKSQPRV--------LSLKL----HVIISTALVFGTMAISLTTCNLGALFE 401
                 N +P+  P          L+ K+    +++ S  ++F      +   +L     
Sbjct: 592 PKFTKINVKPQGLPSYSLIPYSGRLNWKIKWTKNLVRSIIVIFIITLAYVGADDLDLFVS 651

Query: 402 LIGATTASLMAYILPPWVNLK 422
           +IG      + Y+ PP ++L+
Sbjct: 652 VIGCFACIPLVYMYPPLLHLR 672

>KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.177
           YNL101W
          Length = 714

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 69/332 (20%), Positives = 128/332 (38%), Gaps = 74/332 (22%)

Query: 177 DNLFHR---NIVIVVVTCLISF-PLSLNRDISKLSKASMLA-------------LASMXX 219
            N+FH    N+  +++  LI F PLS  R+ISKLS  S++A              AS   
Sbjct: 406 QNIFHLKDFNLGYIMIIQLIFFVPLSFIRNISKLSLPSLIANVFIMLGLLIILIFASKHL 465

Query: 220 XXXXXXXKGPGTDSAYKGSFNSSNLLITPR---IFQGLSVISFALVCHHNTSFIYFSLKT 276
                     G +             I PR   +F G ++ SF  +           L  
Sbjct: 466 FLDLGVHPAAGVEYG-----------IDPRRWTLFVGTAIFSFEGI----------GLII 504

Query: 277 PSLKRFDRLTHFSCFIAMIFCFLMGF------TGFLVFKDKTKGNILNNFPGNDNAVNVA 330
           P      R   FS  + ++              G+L +  + +  +L N P  +  VN+ 
Sbjct: 505 PVQDSMKRPEKFSLVLKLVMITTTIIFITIATVGYLAYGSEIQTVVLLNLPQGNLFVNLI 564

Query: 331 RFCFGFNMLTTFPLEIFVLRDVIKDLMFFNSEPKSQPRV------------------LSL 372
           +F +   ++ + PL++F    +++  +F+    K   ++                  + +
Sbjct: 565 QFLYSLAIMLSTPLQLFPAIKILEGKVFYRYNKKVSRQLSGEANESTKGGSYSGKSNMKI 624

Query: 373 K-LHVIISTALVFGTMAIS-LTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGNLKW 430
           K L  ++ + +V G + I+ L   +L  +  +IG+     + +ILPP +++K    +   
Sbjct: 625 KWLKNLLRSTIVVGAILIAYLGMDSLDKVVSIIGSFCCLPLVFILPPLLHMKSCMDS--S 682

Query: 431 RDRIPH-----YVCIGFGFAIMLISSTQTIIS 457
           RD   H      V I  G   M  +S Q++ +
Sbjct: 683 RDDNKHTILVDRVLIACGIVAMFYTSYQSLFT 714

>KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} similar
           to uniprot|P50944 Saccharomyces cerevisiae YNL101W AVT4
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 721

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 72/344 (20%), Positives = 128/344 (37%), Gaps = 41/344 (11%)

Query: 25  DNFELSSFDRSTEVRPERLSVDSEDRF---TSTFLHEQRSKSNILMAFMNMANSILGAGI 81
           D+F +   D   E     L+    +R            + K++   AF+ M  S +G G+
Sbjct: 264 DDFAVDEDDEFNESEVPLLNASDRERLGHNKRVIARPSQVKTSTFKAFLLMLKSFIGTGV 323

Query: 82  IGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLL 141
           +  P A  N                  W   +++ +   +G +++ D      G   +  
Sbjct: 324 LFLPSAFANGGLIFSVLMLSFFGMYSYWCYYILIRSKVATGVSSFGDIGIKLYGPWMRYA 383

Query: 142 ILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFSGHDNLFH----RNIVIVVVTCLISFPL 197
           IL S  L                    L AFF    N+FH    R   ++++  +I  PL
Sbjct: 384 ILASLILTQLGFSAAYVVFTCKN----LLAFF---QNVFHLHSLRIEHLLILQTIIFIPL 436

Query: 198 SLNRDISKLSKASMLA----LASMXXXXXXXXXK-------GPGTDSAYKGSFNSSNLLI 246
           +  R++SKLS  S+LA    +A +                  P     Y   FNSS    
Sbjct: 437 AFIRNVSKLSLTSLLANFFTMAGLIIIVFFVVKHLVIDLDLKPEAGIIY--GFNSSKW-- 492

Query: 247 TPRIFQGLSVISF---ALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFT 303
              +F G ++ +F    L+       +  S++ P  ++F  +       A +    +   
Sbjct: 493 --SLFIGTAIFAFEGIGLIIP-----VQDSMRKP--EKFPLVLGLVILTATVLFISIAAL 543

Query: 304 GFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIF 347
           G+L F    +  IL N P ++  VN+ +F +   +L + PL++F
Sbjct: 544 GYLAFGRYIETVILLNLPQDNIFVNLVQFFYSLAILLSTPLQLF 587

>CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101w
          Length = 733

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 74/177 (41%), Gaps = 27/177 (15%)

Query: 304 GFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFN--- 360
           G+L +  +    IL N P  +  V++ +  +   ++ + PL++F    +I+  +F     
Sbjct: 555 GYLAYGSEVDTVILLNLPQKNILVSLIQLLYSIAIMLSTPLQMFPAIRIIESGLFKQYDR 614

Query: 361 ----------------SEPKSQPRVLSLKLHVIISTALVFGTMAISLTTC-NLGALFELI 403
                           S  KS  +V  +K  V   +++V   +AI+     NL     +I
Sbjct: 615 WVNRSDREGHATEHNTSSGKSSWKVKWMKNAV--RSSIVILVVAIACVGADNLDKFLSII 672

Query: 404 GATTASLMAYILPPWVNLKLVG-----GNLKWRDRIPHYVCIGFGFAIMLISSTQTI 455
           G+     + Y+ PP ++LK        G +  R  I   V I FG   M+ +S Q+I
Sbjct: 673 GSFACIPLVYMYPPMLHLKSTSLPRSNGKIMSRRVIIDIVLIIFGGISMVYTSYQSI 729

>TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.177
           YNL101W
          Length = 715

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 93/446 (20%), Positives = 166/446 (37%), Gaps = 63/446 (14%)

Query: 54  TFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXXXDWTIRL 113
           T L   +  +  + AF  +  S +G G++  P A  N                  W   +
Sbjct: 290 TSLQSVKGNTPTMTAFFLLLKSFIGTGVLFLPNAFSNGGLSFSIVMLSFFGAYSYWCYFI 349

Query: 114 IVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFF 173
           ++   +I+G T++ D      G   K +IL S  L              +     L+AF 
Sbjct: 350 LIRAKKITGVTSFGDIGLRLFGPWMKFVILFSLVLTQIGFSGAYVIFTAEN----LKAF- 404

Query: 174 SGHDNLFHRNIVIV----VVTCLISFPLSLNRDISKLSKASMLA---LASMXXXXXXXXX 226
               N+F  + V +    ++  ++  PLS  R++SKLS  S+LA   + +          
Sbjct: 405 --TKNVFLVSDVPISYFMIIQLIVFIPLSFIRNVSKLSLPSLLANFFVMAGLAIVLFFST 462

Query: 227 KGPGTDSAYKGS------FNSSNLLITPRIFQGLSVISF---ALVCHHNTSFIYFSLKTP 277
           K    D   + +      FN S       +F G ++ +F    L+       +  S++ P
Sbjct: 463 KHLVIDLGMRAADGVIVGFNQSRW----SMFVGTAIFAFEGIGLIIP-----VQDSMRHP 513

Query: 278 SLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFN 337
             ++F  +       + +    +   G+L +    +  IL N P  +  VN+ +F +   
Sbjct: 514 --EKFPMVLALVIGSSTVLFITIASIGYLAYGSAIETVILLNLPQKNVFVNLIQFFYSLA 571

Query: 338 MLTTFPLEIFVLRDVIKDLMF----------------FNSEPKSQP---RVLSLKLHV-I 377
           ++ + PL++F    +I++ +F                    P S     +V  LK  V  
Sbjct: 572 IMLSTPLQLFPAIKIIENKVFPKFTKIYVKKDDDTTDIQLRPNSGKLNWKVKWLKNSVRA 631

Query: 378 ISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNL------KLVGGNLKWR 431
           I  ALV   +        L     +IG+     + Y+ PP ++L      +  G    WR
Sbjct: 632 IIVALVI--LMAYYGADKLDKFVSIIGSFACIPLVYMYPPMLHLQSYSRPRSAGQKFPWR 689

Query: 432 DRIPHYVCIGFGFAIMLISSTQTIIS 457
             I   V I FG   M  +S Q+I +
Sbjct: 690 S-IVDCVLIVFGGVSMCYTSYQSIFA 714

>Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ADL205C
          Length = 474

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 32/161 (19%), Positives = 65/161 (40%), Gaps = 6/161 (3%)

Query: 190 TCLISFPLSLNRDISKLSKASMLALASMXXXXXXXX---XKGPGTDSAY---KGSFNSSN 243
           + +I  PL+  R +  L  +S++ L S+            +G    + Y   +G  +  +
Sbjct: 124 STIIVVPLAHLRQLDSLKYSSLVGLLSITYLVLLVTGTFLQGVMFGNKYVEHRGDVSWLH 183

Query: 244 LLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFT 303
           +     +    S+I  A     N   +   LK  S     R+ ++S  I+ +    +G  
Sbjct: 184 IHSVGELVSTFSIIILAYTGSMNMFSVINELKDNSTANAKRVVYYSVGISTLIFLSVGLG 243

Query: 304 GFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPL 344
           G+L F +    N++ N+  +     +  F  G  ++ +FPL
Sbjct: 244 GYLTFGNNVLTNVILNYDESAITTRIGTFSLGTMVILSFPL 284

>Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON}
           (11352..13655) [2304 nt, 768 aa]
          Length = 767

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 94/449 (20%), Positives = 164/449 (36%), Gaps = 55/449 (12%)

Query: 47  SEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCXXXXXXXXXXXXXXX 106
           SE   T   +      +  + AF  +  S +G GI+  P A  N                
Sbjct: 335 SESVVTKPMIQSVVGNTPTIKAFFLLLKSFIGTGILFLPRAFDNGGLIFSICMLLFFGIY 394

Query: 107 XDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIP 166
             W   +++ +  I+  T++ D      GR  K +IL S  L                + 
Sbjct: 395 SYWCYYILIRSKNITQVTSFGDIGYKLYGRWMKFVILFSLVLTQLGFAGAYVIFTAKNLK 454

Query: 167 HVLRAFFSGHD-NLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLA---LASMXXXXX 222
             +   F   D +L +    +++    I  PLS  R++SKLS  S++A   + S      
Sbjct: 455 AFVENVFRVPDFDLKY----LMIFQLFIFTPLSYVRNVSKLSFPSLVANFFIMSGLAIVI 510

Query: 223 XXXXKG--------PGTDSAYKGSFNSSNLLITPRIF--QGLSVISFALVCHHNTSFIYF 272
               K         P     Y  + N   L I   IF  +G+ +I            I  
Sbjct: 511 VFTMKHLFYDLNMRPEEGVIYGFNSNGWTLFIGTAIFAFEGIGLIIP----------IQD 560

Query: 273 SLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARF 332
           S+K P  + F  +       A +    +   G+L +    +  IL N P ++  VN+ + 
Sbjct: 561 SMKHP--EHFPLVLGLVIMTATVLFVTIATIGYLAYGKLIETVILLNLPKSNIFVNLIQL 618

Query: 333 CFGFNMLTTFPLEIFVLRDVIKDLMF----------FNSEPKSQPRVLSLKLHVIISTAL 382
            +   ++ + PL++F    +I++ +F            +    + R  S KL   +    
Sbjct: 619 FYSMAIMLSTPLQLFPAIKIIENKVFPKFTKYYVKIDQTREGVRLRQNSGKLDWRVKWRK 678

Query: 383 VFGTMAISLTTC--------NLGALFELIGATTASLMAYILPPWVNLKLV------GGNL 428
            F    I L           +L     +IG+     + Y+ PP ++L+        G  +
Sbjct: 679 NFLRSVIVLIVILMAYYGYDDLDRFVSIIGSFACIPLVYMYPPMLHLRSYSIPSSEGLKI 738

Query: 429 KWRDRIPHYVCIGFGFAIMLISSTQTIIS 457
           K+R  I  Y+ I FG   ML +S Q+++S
Sbjct: 739 KYR-VILDYILIAFGGVSMLYTSYQSLMS 766

>Smik_5.322 Chr5 complement(481543..488025) [6483 bp, 2160 aa] {ON}
            YER155C (REAL)
          Length = 2160

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 2    SKDPFNEPFIQGRGSHDQRGPLGDNFELSSFDRSTEVRPERLSVDSEDRFTSTFLHEQRS 61
            +KD  N  + Q + SH  RGP  DN  L  +         RL++D+ D FT TF +  +S
Sbjct: 1100 TKDLENYYYHQKQRSHSNRGPSDDNIGLLDYAFI------RLTMDN-DIFTETFFNTYKS 1152

Query: 62   KSNILMAFMNMANSILGA 79
             +       NMA   +GA
Sbjct: 1153 FTTTTAVLENMAKRYVGA 1170

>Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101W
           (REAL)
          Length = 716

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 86/207 (41%), Gaps = 32/207 (15%)

Query: 169 LRAFFSGHDNLFHRNIV----IVVVTCLISFPLSLNRDISKLSKASMLA----LASMXXX 220
           L+AF    +N+FH   +    ++    +I  PLS  R+ISKLS  S+LA    +A +   
Sbjct: 402 LQAFL---ENVFHVGALPLSYLMAFQTVIFIPLSFIRNISKLSLPSLLANFFIMAGLIIV 458

Query: 221 XXXXXXK-------GPGTDSAYKGSFNSSNLLITPRIF--QGLSVISFALVCHHNTSFIY 271
                 +        P     Y  + +   L I   IF  +G+ +I            + 
Sbjct: 459 IIFTAKRLFFDLKAVPAMGVVYGLNSDRWTLFIGTAIFAFEGIGLIIP----------VQ 508

Query: 272 FSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVAR 331
            S+K P  ++F  +       A +    +   G+L +    K  IL N P ++  VN+ +
Sbjct: 509 DSMKHP--EKFPLVLGLVILTATVLFISIATLGYLAYGSDVKTAILLNLPQSNIFVNLIQ 566

Query: 332 FCFGFNMLTTFPLEIFVLRDVIKDLMF 358
             +   ++ + PL++F    +I++  F
Sbjct: 567 LFYSIAIMLSTPLQLFPAIKIIENKFF 593

>CAGL0B00770g Chr2 complement(68287..69912) [1626 bp, 541 aa] {ON}
           similar to uniprot|P25568 Saccharomyces cerevisiae
           YCL038c
          Length = 541

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 16/125 (12%)

Query: 327 VNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFNSEPKSQPRVLSLKLHVIISTALVFGT 386
           VN++   +G+ +L        +LRDV+  L+ +         +LS  L  I STA++F  
Sbjct: 307 VNLSSLKYGWKLLGEALKHATLLRDVVIFLIGW--------FILSDSLTTINSTAIIFAK 358

Query: 387 MAISLTTCNLGALFELIGATTASLMAYILPPWVNLKL-------VGGNLKWRDRIPHYVC 439
             + ++T NL +L  +I   +A + A+ +P  V+  L       +   + W   IP Y  
Sbjct: 359 TELHMSTINLISL-SIITMISAMVGAFAIPQIVSTSLHVPPQRTILLIICWASIIPLYGM 417

Query: 440 IGFGF 444
           +GF F
Sbjct: 418 LGFIF 422

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,197,352
Number of extensions: 1611712
Number of successful extensions: 4845
Number of sequences better than 10.0: 112
Number of HSP's gapped: 4827
Number of HSP's successfully gapped: 158
Length of query: 469
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 356
Effective length of database: 40,524,141
Effective search space: 14426594196
Effective search space used: 14426594196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)