Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F01628gsingletonON20520510701e-150
ACR030W5.220ON59981663.9
KLTH0D04466g2.431ON31957647.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F01628g
         (205 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F01628g Chr6 (125692..126309) [618 bp, 205 aa] {ON} no simi...   416   e-150
ACR030W Chr3 (413856..415655) [1800 bp, 599 aa] {ON} Syntenic ho...    30   3.9  
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    29   7.8  

>KLTH0F01628g Chr6 (125692..126309) [618 bp, 205 aa] {ON} no
           similarity
          Length = 205

 Score =  416 bits (1070), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MRGPEESRLEVITRKGVYPVLLRALIFELCGRLLFYVFCITADRQGTQPLNPLQTMVRTQ 60
           MRGPEESRLEVITRKGVYPVLLRALIFELCGRLLFYVFCITADRQGTQPLNPLQTMVRTQ
Sbjct: 1   MRGPEESRLEVITRKGVYPVLLRALIFELCGRLLFYVFCITADRQGTQPLNPLQTMVRTQ 60

Query: 61  TLGTTMISAVTSREWCSDVRVFGNSTRRASTRLGAVLTQTIGYESPRSRARVTASITISA 120
           TLGTTMISAVTSREWCSDVRVFGNSTRRASTRLGAVLTQTIGYESPRSRARVTASITISA
Sbjct: 61  TLGTTMISAVTSREWCSDVRVFGNSTRRASTRLGAVLTQTIGYESPRSRARVTASITISA 120

Query: 121 QVLCSGLSYVVMCGCSTTLAFGRHCRAGRRLLSLHTRVPLAFKLALWPSHSSLSVSVTPG 180
           QVLCSGLSYVVMCGCSTTLAFGRHCRAGRRLLSLHTRVPLAFKLALWPSHSSLSVSVTPG
Sbjct: 121 QVLCSGLSYVVMCGCSTTLAFGRHCRAGRRLLSLHTRVPLAFKLALWPSHSSLSVSVTPG 180

Query: 181 PENFAVHAHITLQDIIYSFFPLVAK 205
           PENFAVHAHITLQDIIYSFFPLVAK
Sbjct: 181 PENFAVHAHITLQDIIYSFFPLVAK 205

>ACR030W Chr3 (413856..415655) [1800 bp, 599 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJR001W
          Length = 599

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 101 IGYESPRSRARVTASITISAQVLCSGLSYVVMCGCSTTLAFGRHCRAGRRLLSLHTRVPL 160
           +GY +  S+ R   S+  +  +L  G+S +++ G S    F ++     ++LS     P 
Sbjct: 272 LGYAAFGSKGRALISVLFTLDLLGCGVSLIILFGDSLNALFPQYSVTQFKILSFFAVTPQ 331

Query: 161 AF-KLALWPSHSSLSVSVTPG 180
            F  L++  + S L ++ T G
Sbjct: 332 VFLPLSVLSNFSLLGITATLG 352

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 37  VFCITADRQGTQPLNP--LQTMVRTQTLGTTMISAVTSREWCSDVRVFGNSTRRAST 91
           V  +T DR+ +Q ++    +T+    TLG  M++ +   +W S VRV  N T    T
Sbjct: 110 VLSVTIDRRASQIVSASRDKTVKVWNTLGECMVTLLGHNDWVSQVRVAPNETPEDET 166

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,243,009
Number of extensions: 555974
Number of successful extensions: 1455
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1483
Number of HSP's successfully gapped: 9
Length of query: 205
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 101
Effective length of database: 41,556,135
Effective search space: 4197169635
Effective search space used: 4197169635
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 63 (28.9 bits)