Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F01606gna 1ON60460427660.0
Kwal_33.13215na 1ON59860522540.0
KLTH0F01584g1.50ON59660217100.0
SAKL0C01650g1.50ON61361317000.0
SAKL0C01232gsingletonON61358916820.0
Kwal_33.132041.50ON60759916490.0
CAGL0B01012g1.50ON62359616200.0
CAGL0K05753g1.50ON66060316160.0
Skud_3.381.50ON63362816120.0
Suva_3.1891.50ON63362616040.0
YCL025C (AGP1)1.50ON63362615930.0
Smik_3.531.50ON63363515860.0
Kpol_2000.921.50ON63763015840.0
KAFR0D04120na 1ON64862815760.0
Suva_2.6881.50ON66163515720.0
Skud_4.7841.50ON66363515660.0
TPHA0E036601.50ON64759515550.0
YDR508C (GNP1)1.50ON66363315540.0
Smik_4.7901.50ON66363315460.0
SAKL0D02948gna 2ON59458615240.0
Ecym_10561.50ON60660815190.0
NCAS0B085801.50ON62756915180.0
TDEL0C065101.50ON64258515030.0
KAFR0D005001.50ON61761015000.0
TPHA0B047501.50ON63963915000.0
KNAG0F002701.50ON63457714920.0
KLLA0C01606g1.50ON62059814810.0
NDAI0A006401.50ON64161114770.0
Kpol_2002.441.50ON62757814740.0
Ecym_26643.285ON57558814690.0
KAFR0D041401.50ON63762814720.0
YBR068C (BAP2)3.284ON60958814680.0
KAFR0D00510na 3ON61759414680.0
NCAS0A004201.50ON67964214680.0
KAFR0D04130na 3ON64457514640.0
KNAG0C005901.50ON63461214590.0
TBLA0A051801.50ON67653314560.0
NDAI0F043901.50ON66763314520.0
AFR698C1.50ON60960814430.0
KAFR0D00520na 1ON59859514380.0
Smik_2.2013.284ON60958214170.0
Smik_4.2843.284ON60457914140.0
SAKL0D02926g3.285ON58360314120.0
TBLA0A05190na 1ON66760014200.0
AGR039Cna 2ON58657214100.0
NCAS0I015303.284ON59560414000.0
Suva_4.3073.284ON60960414000.0
SAKL0D02970g3.284ON60160513930.0
YDR046C (BAP3)3.284ON60458413930.0
Skud_4.3003.284ON60460413920.0
Skud_2.1913.284ON60960413920.0
ZYRO0F17446g1.50ON63361813930.0
CAGL0H08393g3.284ON61256313910.0
Suva_2.2033.284ON60457813760.0
NDAI0A074903.284ON59660313750.0
CAGL0L07546g3.284ON63459613690.0
Ecym_2663na 2ON58956813590.0
AGR040C3.285ON57358313500.0
NDAI0A056203.284ON57158313471e-180
KNAG0J022003.284ON60759813441e-179
KNAG0H011503.284ON61758813371e-178
NCAS0A106803.284ON59360613311e-177
Kwal_27.105383.284ON60260713191e-175
KAFR0A011203.284ON59256513091e-174
Ecym_26623.284ON58960813071e-174
KLTH0C05170g3.284ON59858913051e-173
Kpol_1065.133.284ON59660012761e-169
KAFR0C004003.284ON58257112741e-169
TPHA0M012003.284ON60761912741e-169
AGR038C3.284ON58059012611e-167
Kpol_1052.163.284ON61359412611e-167
Suva_4.3083.285ON61855712541e-165
TPHA0A039603.284ON61560112531e-165
Smik_2.2023.285ON61754012511e-165
TBLA0I020103.285ON62853712491e-164
Skud_2.1923.285ON61961612351e-163
Kpol_1052.143.285ON60252112251e-161
YBR069C (TAT1)3.285ON61960812261e-161
TBLA0G031203.284ON67351912241e-160
KNAG0J022103.285ON58159312091e-159
NDAI0A075003.285ON61955011961e-157
ZYRO0G12342g3.284ON62057911821e-154
NCAS0I015203.285ON61457711561e-151
SAKL0H08184gna 4ON59849911541e-151
TBLA0I020003.284ON66457211251e-145
ADL272Wna 4ON56453210981e-143
TPHA0A002405.158ON60356110571e-136
Ecym_8297na 4ON56949910521e-136
SAKL0G14014g5.158ON60555410281e-132
KLLA0F01012gna 4ON55650210191e-131
KLTH0E15642g1.244ON59658010181e-130
CAGL0B03773g5.158ON60559510181e-130
Suva_11.2731.244ON60152410131e-129
Kwal_27.126811.244ON59361110091e-129
AGR319W5.158ON62657510091e-129
Smik_16.1155.158ON60358510011e-128
KLTH0B02046g5.158ON5895829851e-125
NCAS0D018705.158ON5955839841e-125
TPHA0B010901.244ON6066219841e-125
SAKL0D04664g1.244ON5936039801e-125
NDAI0D021605.158ON5875829801e-125
Kwal_33.154075.158ON5876009791e-124
NDAI0B052201.244ON6115639751e-124
ZYRO0D03762g1.244ON6006149731e-123
Skud_11.2751.244ON6025249731e-123
Suva_7.4855.158ON6035549731e-123
Kpol_1010.325.158ON5995239701e-123
Skud_7.5255.158ON6035479711e-123
KNAG0G009005.158ON6136019681e-123
TBLA0B077605.158ON6585589711e-122
YGR191W (HIP1)5.158ON6035499621e-122
TDEL0C00930singletonON5955969611e-122
KAFR0E018505.158ON5605249551e-121
Kpol_543.791.244ON6055959541e-121
YKR039W (GAP1)1.244ON6025249531e-120
Ecym_60211.244ON6005999521e-120
NDAI0C029505.158ON6095779531e-120
Ecym_47895.158ON5885799501e-120
KLLA0A11770g5.158ON5815259471e-120
KLLA0A06886gsingletonON5875789471e-120
KNAG0C02140singletonON5985819441e-119
NCAS0B079001.244ON6195649421e-119
CAGL0L03267g1.244ON5975649371e-118
Kpol_543.78singletonON6056009231e-116
TPHA0A047005.158ON5695459191e-116
Kwal_33.14276na 5ON5965659211e-116
NCAS0A071105.158ON5925439091e-114
SAKL0D00836gna 5ON6015208881e-111
Suva_2.716singletonON6036048841e-110
KLLA0A06930g1.244ON5875938791e-110
NCAS0A089201.368ON5996068801e-110
AFR230C1.244ON6045668801e-110
Smik_11.3021.244ON5535158661e-108
Kpol_534.221.368ON5926038511e-105
NDAI0G060301.368ON5996138481e-105
AEL030W1.368ON5825798441e-104
YOL020W (TAT2)1.368ON5925788411e-104
KLLA0A10813g1.368ON5846118381e-104
Skud_15.1381.368ON5925728381e-104
Smik_15.1461.368ON5935788381e-103
Ecym_27161.368ON5925798351e-103
CAGL0D02178g1.368ON5775828261e-102
TBLA0C012101.368ON6005888241e-101
KLTH0C08052gna 6ON5995818231e-101
TPHA0A025001.368ON5905918141e-100
Suva_15.1481.368ON5925768083e-99
KLTH0H13398g1.368ON5875897995e-98
SAKL0D04048gna 6ON5865677848e-96
KAFR0F04410singletonON5805887831e-95
TDEL0E05700singletonON5845897795e-95
KLLA0B06776gna 6ON5885777779e-95
YPL274W (SAM3)na 6ON5875997733e-94
KAFR0B00220singletonON5855917701e-93
TPHA0G03770singletonON6046087658e-93
YLL061W (MMP1)na 7ON5835817631e-92
TDEL0B00130singletonON5845927533e-91
Suva_16.31singletonON5865827482e-90
TDEL0H04510singletonON5846107472e-90
Smik_6.483na 6ON5906037447e-90
AER405Cna 6ON4975127315e-89
Sklu_YGOB_Anc_1.3681.368ON5414967312e-88
Smik_12.2na 7ON5835847263e-87
Kwal_56.22951na 6ON5966077142e-85
Kwal_34.16254singletonOFF4814916922e-83
Kwal_YGOB_34.162541.368ON4914916923e-83
TDEL0E00250singletonON5875876872e-81
Suva_16.18na 6ON5835706801e-80
Ecym_4758na 6ON5875896532e-76
KLLA0E16281gna 8ON6055616444e-75
SAKL0C02662g1.83ON5485426319e-74
TBLA0A07060na 8ON6255986272e-72
TDEL0C061701.84ON5735076102e-70
Skud_16.12na 8ON6075926122e-70
SAKL0C02640gsingletonON5485566048e-70
CAGL0J08162g1.84ON5975226042e-69
Ecym_10881.84ON5675606022e-69
Kpol_2000.641.84ON6105346034e-69
YPL265W (DIP5)na 8ON6086076016e-69
Ecym_10871.83ON5705885981e-68
Smik_5.241.83ON5905575911e-67
TPHA0B044701.84ON5995085921e-67
KAFR0D039401.83ON5975925912e-67
KLTH0F02398g1.83ON5555105882e-67
Smik_14.681.84ON6115045912e-67
TBLA0A054601.84ON6085275903e-67
Kwal_33.134111.84ON5605615855e-67
NDAI0F041901.84ON5995095868e-67
Smik_6.473na 8ON6065325869e-67
Kpol_358.3na 8ON5755365831e-66
Suva_16.40na 8ON6065305851e-66
ZYRO0F16632g1.84ON6075395823e-66
KNAG0F004801.84ON5975105797e-66
Kwal_33.134011.83ON5595065761e-65
CAGL0A01199gna 8ON6135615791e-65
SAKL0C02728g1.84ON5624915742e-65
KLLA0C02365g1.84ON5795725743e-65
YNL268W (LYP1)1.84ON6115865754e-65
KNAG0L02470singletonON6385245764e-65
Suva_5.41.83ON5905375719e-65
NCAS0A006001.83ON5445165671e-64
NDAI0A006101.83ON5655195682e-64
NCAS0A006101.84ON6075825693e-64
TDEL0C061801.83ON5835015631e-63
YEL063C (CAN1)1.83ON5905385631e-63
Skud_5.261.83ON5905375631e-63
KLTH0F02420g1.84ON6215185624e-63
KNAG0C05920singletonON5995375595e-63
KLLA0C02343g1.83ON5815445587e-63
TPHA0M00130singletonON6115305598e-63
CAGL0J08184g1.83ON5725465561e-62
SAKL0C02684gsingletonON5884925571e-62
Skud_14.711.84ON6125065562e-62
YNL270C (ALP1)1.83ON5735745515e-62
AFR668W1.83ON5564835471e-61
Suva_14.751.84ON6115065501e-61
TBLA0A054501.83ON6064805483e-61
NDAI0I02660na 8ON5945615464e-61
NCAS0D02260na 8ON5975875465e-61
NCAS0B085701.83ON5325065391e-60
KNAG0L02460singletonON5885645402e-60
Smik_14.671.83ON5735535392e-60
SAKL0G14916gna 8ON5815535393e-60
Kpol_2000.651.83ON5955005378e-60
Kwal_33.15545na 8ON5765075351e-59
Skud_14.701.83ON5735625332e-59
ZYRO0F16654g1.83ON5805665323e-59
AFR667C1.84ON5635245313e-59
Ecym_80357.44ON5635295295e-59
KAFR0B06430singletonON5935375316e-59
KAFR0D007001.83ON5745785297e-59
ZYRO0D17952gna 6ON5853505262e-58
NDAI0F042001.83ON5665125243e-58
Skud_47.1singletonON3283275056e-58
Ecym_2480na 8ON5865335211e-57
Suva_14.731.83ON4974875161e-57
KNAG0C007901.83ON5795065174e-57
ACL135Wna 8ON5885755174e-57
TPHA0B044801.83ON6035035151e-56
KLTH0B01166gna 8ON5775325131e-56
SAKL0B10956g7.44ON5725395103e-56
KAFR0C051607.44ON5845625052e-55
Skud_51.1singletonON3483174874e-55
Skud_7.4singletonON3493174875e-55
ZYRO0D17908gna 8ON5184944916e-54
YOR348C (PUT4)7.44ON6275894914e-53
Skud_15.5157.44ON6265904871e-52
AFR156W7.44ON5585304822e-52
KNAG0E003907.44ON5995294815e-52
Kwal_26.69407.44ON5705294771e-51
Smik_15.5327.44ON6315244792e-51
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F01606g
         (604 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...  1070   0.0  
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   872   0.0  
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   663   0.0  
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   659   0.0  
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   652   0.0  
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   639   0.0  
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   628   0.0  
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   627   0.0  
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   625   0.0  
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   622   0.0  
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   618   0.0  
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   615   0.0  
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   614   0.0  
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   611   0.0  
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   610   0.0  
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   607   0.0  
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   603   0.0  
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   603   0.0  
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   600   0.0  
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   591   0.0  
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   589   0.0  
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   589   0.0  
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   583   0.0  
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      582   0.0  
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   582   0.0  
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   579   0.0  
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   575   0.0  
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   573   0.0  
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   572   0.0  
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   570   0.0  
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              571   0.0  
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   570   0.0  
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      570   0.0  
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   570   0.0  
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              568   0.0  
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   566   0.0  
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   565   0.0  
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   563   0.0  
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   560   0.0  
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   558   0.0  
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   550   0.0  
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   549   0.0  
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   548   0.0  
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   551   0.0  
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   547   0.0  
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              543   0.0  
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   543   0.0  
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   541   0.0  
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   541   0.0  
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   540   0.0  
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   540   0.0  
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   541   0.0  
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   540   0.0  
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   534   0.0  
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   534   0.0  
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   531   0.0  
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   528   0.0  
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   524   0.0  
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            523   e-180
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   522   e-179
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              519   e-178
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   517   e-177
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   512   e-175
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   508   e-174
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   508   e-174
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   507   e-173
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   496   e-169
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                495   e-169
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   495   e-169
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   490   e-167
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   490   e-167
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   487   e-165
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              487   e-165
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   486   e-165
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   485   e-164
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   480   e-163
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   476   e-161
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   476   e-161
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              476   e-160
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   470   e-159
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   465   e-157
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   459   e-154
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              449   e-151
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   449   e-151
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   437   e-145
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   427   e-143
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   411   e-136
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   409   e-136
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   400   e-132
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   397   e-131
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   396   e-130
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   396   e-130
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   394   e-129
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   393   e-129
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   393   e-129
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   390   e-128
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   384   e-125
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   383   e-125
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   383   e-125
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   382   e-125
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    382   e-125
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   381   e-124
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   380   e-124
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   379   e-123
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   379   e-123
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   379   e-123
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   378   e-123
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   378   e-123
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   377   e-123
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   378   e-122
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   375   e-122
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   374   e-122
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   372   e-121
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   372   e-121
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   371   e-120
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   371   e-120
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    371   e-120
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   370   e-120
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   369   e-120
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   369   e-120
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   368   e-119
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   367   e-119
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   365   e-118
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   360   e-116
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   358   e-116
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   359   e-116
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   354   e-114
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   346   e-111
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   345   e-110
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   343   e-110
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   343   e-110
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   343   e-110
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   338   e-108
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   332   e-105
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   331   e-105
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   329   e-104
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   328   e-104
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   327   e-104
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   327   e-104
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   327   e-103
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   326   e-103
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   322   e-102
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   322   e-101
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   321   e-101
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   318   e-100
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   315   3e-99
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   312   5e-98
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   306   8e-96
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              306   1e-95
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   304   5e-95
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   303   9e-95
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   302   3e-94
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      301   1e-93
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   299   8e-93
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   298   1e-92
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                294   3e-91
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   292   2e-90
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   292   2e-90
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   291   7e-90
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   286   5e-89
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   286   2e-88
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    284   3e-87
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   279   2e-85
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   271   2e-83
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   271   3e-83
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                269   2e-81
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   266   1e-80
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   256   2e-76
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   252   4e-75
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   247   9e-74
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   246   2e-72
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   239   2e-70
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   240   2e-70
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   237   8e-70
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   237   2e-69
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   236   2e-69
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   236   4e-69
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   236   6e-69
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   234   1e-68
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   232   1e-67
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   232   1e-67
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   232   2e-67
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   231   2e-67
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   232   2e-67
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   231   3e-67
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   229   5e-67
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   230   8e-67
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   230   9e-67
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   229   1e-66
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   229   1e-66
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   228   3e-66
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                227   7e-66
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   226   1e-65
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   227   1e-65
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   225   2e-65
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   225   3e-65
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   226   4e-65
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             226   4e-65
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   224   9e-65
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   223   1e-64
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   223   2e-64
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              223   3e-64
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   221   1e-63
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   221   1e-63
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   221   1e-63
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   221   4e-63
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            219   5e-63
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   219   7e-63
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     219   8e-63
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   218   1e-62
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   219   1e-62
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   218   2e-62
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   216   5e-62
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   215   1e-61
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   216   1e-61
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   215   3e-61
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   214   4e-61
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              214   5e-61
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            212   1e-60
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             212   2e-60
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   212   2e-60
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   212   3e-60
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   211   8e-60
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   210   1e-59
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   209   2e-59
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   209   3e-59
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   209   3e-59
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   208   5e-59
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   209   6e-59
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   208   7e-59
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   207   2e-58
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            206   3e-58
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         199   6e-58
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   205   1e-57
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   203   1e-57
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              203   4e-57
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   203   4e-57
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   202   1e-56
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   202   1e-56
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   201   3e-56
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   199   2e-55
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     192   4e-55
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     192   5e-55
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   193   6e-54
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   193   4e-53
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   192   1e-52
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   190   2e-52
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   189   5e-52
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   188   1e-51
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   189   2e-51
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   189   2e-51
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   186   2e-50
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   184   3e-50
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   183   6e-50
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   182   2e-49
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   182   2e-49
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   181   3e-49
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      181   4e-49
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   180   7e-49
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   179   1e-48
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   179   2e-48
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   179   2e-48
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   179   3e-48
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      178   4e-48
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    177   5e-48
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   176   2e-47
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   176   3e-47
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   175   4e-47
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            174   5e-47
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   175   1e-46
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     174   2e-46
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   172   6e-46
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   172   7e-46
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   172   7e-46
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            171   1e-45
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   171   1e-45
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              171   2e-45
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   171   2e-45
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   170   4e-45
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   169   7e-45
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   167   8e-44
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   166   2e-43
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   163   8e-43
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   163   8e-43
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     164   1e-42
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   161   4e-42
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   160   1e-41
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   159   4e-41
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   158   7e-41
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              157   7e-41
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   157   1e-40
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   157   1e-40
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   157   1e-40
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   157   1e-40
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   157   2e-40
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   157   2e-40
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   156   3e-40
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   153   1e-39
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}             143   3e-39
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   153   3e-39
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   145   3e-39
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   153   4e-39
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   150   5e-38
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   148   2e-37
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   146   9e-37
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   146   1e-36
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   145   3e-36
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   144   4e-36
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...   135   7e-36
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                143   8e-36
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   142   1e-35
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   141   4e-35
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   141   5e-35
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   141   6e-35
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   139   3e-34
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   137   8e-34
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...   128   9e-34
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    130   2e-32
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)     124   2e-32
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   132   5e-32
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   132   2e-31
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     122   1e-30
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   123   3e-29
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   123   3e-29
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)         108   2e-26
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   115   5e-26
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   110   2e-24
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   106   1e-23
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   106   3e-23
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   105   5e-23
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   104   6e-23
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   102   6e-22
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   102   6e-22
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   101   1e-21
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   101   2e-21
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...    97   3e-20
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...    95   1e-19
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...    93   5e-19
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...    89   9e-18
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...    89   1e-17
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...    78   2e-14
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          71   1e-13
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      65   2e-12
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...    71   4e-12
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...    70   6e-12
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...    68   3e-11
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...    68   4e-11
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...    62   2e-09
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              46   2e-05
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    41   0.006
NDAI0H02500 Chr8 complement(608642..612001) [3360 bp, 1119 aa] {...    32   4.1  
Ecym_2298 Chr2 (577836..580802) [2967 bp, 988 aa] {ON} similar t...    32   4.2  

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score = 1070 bits (2766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/604 (87%), Positives = 529/604 (87%)

Query: 1   MKGFEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDG 60
           MKGFEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDG
Sbjct: 1   MKGFEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDG 60

Query: 61  IHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNG 120
           IHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNG
Sbjct: 61  IHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNG 120

Query: 121 GPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQ 180
           GPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQ
Sbjct: 121 GPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQ 180

Query: 181 WLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVL 240
           WLCILPLELVTASMTIKYWNDSINPDA                           NTCKVL
Sbjct: 181 WLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVL 240

Query: 241 MXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGA 300
           M          VNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGA
Sbjct: 241 MLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGA 300

Query: 301 EFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHA 360
           EFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHA
Sbjct: 301 EFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHA 360

Query: 361 SPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDR 420
           SPFVIAIASHGVKVVPH                             EQGFAPKLFNYVDR
Sbjct: 361 SPFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDR 420

Query: 421 RGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMI 480
           RGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMI
Sbjct: 421 RGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMI 480

Query: 481 VQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMP 540
           VQGRSLDELGYQSWTGVWGAYYA         GQFWVAISPVGSNKLDANNFFENYLAMP
Sbjct: 481 VQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMP 540

Query: 541 ILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAA 600
           ILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAA
Sbjct: 541 ILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAA 600

Query: 601 EFWC 604
           EFWC
Sbjct: 601 EFWC 604

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/605 (72%), Positives = 475/605 (78%), Gaps = 8/605 (1%)

Query: 1   MKGFEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDG 60
           MK FE+ N+KSP++GVVESFDSVEV+KE SPRS+   DGLF RF DSF+R E        
Sbjct: 1   MKDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAH------ 54

Query: 61  IHSTHERVSGEDFERLAPDDS-SKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHN 119
            +        ED E L P +S SKHKTLKQNI+PRHVLMISLATGIGTGMLVGNGKSLHN
Sbjct: 55  -NGGGGDGDDEDHEGLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHN 113

Query: 120 GGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCL 179
           GGPASL+IGYAIVS+MLYCVIQSASELAIIYTSL+GGFNAYP+LLVDKAF FSVSWVYCL
Sbjct: 114 GGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCL 173

Query: 180 QWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKV 239
           QWLC+LPLELVTASMTIKYWN +INPDA                           N CKV
Sbjct: 174 QWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKV 233

Query: 240 LMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGG 299
           LM          +NCGGAGNDGYLG+ YWHDPGAFRG++ INRFKG+VAVLVNAAFAYGG
Sbjct: 234 LMIIGFFILGIIINCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGG 293

Query: 300 AEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATH 359
           AEFSVLTAAEQQNPQKSIRSASKKLVYRI+GIY+MTA LLGFLVP+NS ELLGSG +ATH
Sbjct: 294 AEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH 353

Query: 360 ASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVD 419
           ASPFVIA+ASHGV+VVPH                             EQGFAP+  NYVD
Sbjct: 354 ASPFVIAVASHGVRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVD 413

Query: 420 RRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSM 479
           R GRPV CLLVSCVFGLL FVAASPKEETVFTWLLAISGLSELFTWFSISLSHVR RR+M
Sbjct: 414 RCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAM 473

Query: 480 IVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAM 539
            VQGRS DELGY +WTGVWGAYYA         GQFWVAISPVGSNKLDANNFFENYLAM
Sbjct: 474 TVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAM 533

Query: 540 PILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRA 599
           PILI LYLGYK+W RDWR++IP++EVDLV+HRKIFDAE+++ EQLEEKEQLRHA WT R 
Sbjct: 534 PILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRL 593

Query: 600 AEFWC 604
           A FWC
Sbjct: 594 ANFWC 598

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/602 (53%), Positives = 405/602 (67%), Gaps = 15/602 (2%)

Query: 3   GFEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIH 62
           G  ++++KS      ES + V +        +G     F R  +SFKR  E   GGD   
Sbjct: 10  GIGLQDLKSNTGS--ESIEKVSLPASDYQYHDGQVLSRFQRLTNSFKRAGEHGRGGD--- 64

Query: 63  STHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGP 122
                V  E  + +AP ++     LKQ I  RH+ MISL TGIGTGMLVGNGK+LHNGGP
Sbjct: 65  -----VDAEG-QPVAPRETK----LKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGP 114

Query: 123 ASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWL 182
           A L IGYAI+ + +YC+IQ+A E+A+ Y+SLSG FNAYP++L+D A  FSV+WVYCLQWL
Sbjct: 115 AGLAIGYAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWL 174

Query: 183 CILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMX 242
           C+LPLELVTA++TIKYW  ++NPD                            NTCKVLM 
Sbjct: 175 CVLPLELVTATITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMI 234

Query: 243 XXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEF 302
                    VNCGGAGNDGYLG  YWHDPGA  G   I+ FKG++A +V AAFA+G  EF
Sbjct: 235 TGFFILGIIVNCGGAGNDGYLGGKYWHDPGALYGTKPIHHFKGIIATMVTAAFAFGATEF 294

Query: 303 SVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASP 362
             LTAAEQ NP+++I SA+KK+VYR++ I+L    LLGFLVPYNS EL+GSG +ATHASP
Sbjct: 295 IALTAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASP 354

Query: 363 FVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRG 422
           +VIAIASHGVKVVPH                             EQ +AP   NY+DR G
Sbjct: 355 YVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREG 414

Query: 423 RPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQ 482
           RP+R +LVSC+FGL+ FVAASPKEETVFTWLLAISGLS+LFTW  I +SH+RFR++++VQ
Sbjct: 415 RPIRAMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQ 474

Query: 483 GRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPIL 542
           G+SL ELGY+S TGV G+YYA         GQFWVAI+PVG++KLDANNFFENYLAMPIL
Sbjct: 475 GKSLGELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPIL 534

Query: 543 IGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEF 602
           I LY GY++W RDW++ IP  ++DLVSHRK+FD ++++ E  E +E +R++ W  R A F
Sbjct: 535 IALYFGYRVWKRDWKLYIPLEQIDLVSHRKVFDEDLLKQEDAEYEESIRNSGWLSRVAHF 594

Query: 603 WC 604
           WC
Sbjct: 595 WC 596

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/613 (54%), Positives = 414/613 (67%), Gaps = 25/613 (4%)

Query: 1   MKGFEMKNIKSPEDGVVESFD----SVEVVKETSPRSEG-----SRDGLFHRFVDSFKRP 51
           + G E+K++KS    VV S D      + +++TS ++       +   LF RF +SFKR 
Sbjct: 17  LVGNELKDVKS--GAVVGSSDFTNNETDYLEKTSVQNSDFEYLENEGNLFRRFANSFKRA 74

Query: 52  EEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLV 111
               N         ++  G D       D   +K LK+ IK RHV+MISL TGIGTGMLV
Sbjct: 75  PGSNN--------PDKEDGSD-----AGDKGDNK-LKKTIKSRHVVMISLGTGIGTGMLV 120

Query: 112 GNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAF 171
           GNGK+L NGGPA L+IGYAI+ + LYC+IQ+A ELA+ YTSLSGGFNAYP+LL+D A  F
Sbjct: 121 GNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGF 180

Query: 172 SVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXX 231
           SV+WVYCLQWLC++PLELVTAS+TIKYW  S+NPD                         
Sbjct: 181 SVAWVYCLQWLCVMPLELVTASITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAE 240

Query: 232 XXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLV 291
              NTCKVLM          VNCGGAGNDGY+G  YW+DPG+F G+  I+ FKG+V+ LV
Sbjct: 241 FFFNTCKVLMITGFFILGIIVNCGGAGNDGYIGGKYWNDPGSFSGDKPIDHFKGVVSTLV 300

Query: 292 NAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL 351
            AAFA+G  EF  LTAAEQ NP+KSI SA+KK++YRII I+L +  L+GFLVP+NS EL+
Sbjct: 301 TAAFAFGATEFIALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELM 360

Query: 352 GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFA 411
           GSG +ATHASP+VIAIASHGVKVVPH                             EQG+A
Sbjct: 361 GSGGSATHASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYA 420

Query: 412 PKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLS 471
           P    YVDR GRP   +++S VFGL+ FVAASPKEETVFTWLLAISGLS+LFTW +I LS
Sbjct: 421 PSFLKYVDREGRPTLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLS 480

Query: 472 HVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANN 531
           H+RFRR+M VQGRSL ELG++S  GVWG+YYA         GQFW AI+P+G  KLDA  
Sbjct: 481 HIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEA 540

Query: 532 FFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLR 591
           FFENYLAMPILI LY GYK+W RDW + IPA+++DL+S+R+IFD ++++ E  E +E+LR
Sbjct: 541 FFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAEFREKLR 600

Query: 592 HASWTKRAAEFWC 604
           ++ W +RAAEFWC
Sbjct: 601 NSGWLRRAAEFWC 613

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/589 (54%), Positives = 402/589 (68%), Gaps = 19/589 (3%)

Query: 21  DSVEVVKETSPRSEG-----SRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFER 75
           +  + +++TS ++ G     +   LF RF +SFKR     N         ++  G D   
Sbjct: 39  NETDYLEKTSVQNSGFEYLENEGNLFRRFANSFKRAPGSNN--------PDKEDGSD--- 87

Query: 76  LAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTM 135
               D   +K LK+ IK RHV+MISL TGIGTGMLVGNGK+L NGGPA L+IGYAI+ + 
Sbjct: 88  --AGDKGDNK-LKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSC 144

Query: 136 LYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMT 195
           LYC+IQ+A ELA+ YTSLSGGFNAYP+LL+D A  FSV+WVYCLQWLC++PLELVTAS+T
Sbjct: 145 LYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASIT 204

Query: 196 IKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCG 255
           IKYW  S+NPD                            NT KVLM          VNCG
Sbjct: 205 IKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCG 264

Query: 256 GAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 315
           GAGNDGY+G  YW+DPG+F G+  I+ FKG+V+ LV AAFA+G  EF  LTAAEQ NP+K
Sbjct: 265 GAGNDGYIGGKYWNDPGSFSGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRK 324

Query: 316 SIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVV 375
           SI SA+KK++YRI+ +Y+ +  L+GFLVP+NS EL+GSG +ATHASP+VIAIASHGVKVV
Sbjct: 325 SIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVV 384

Query: 376 PHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFG 435
           PH                             EQG+AP    YVDR GRP   +++S VFG
Sbjct: 385 PHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVFG 444

Query: 436 LLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWT 495
           L+ FVAASPKEETVFTWLLAISGLS+LFTW +I LSH+RFRR+M VQGRSL ELG++S  
Sbjct: 445 LISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQV 504

Query: 496 GVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRD 555
           GVWG+YYA         GQFW AI+P+G  KLDA  FFENYLAMPILI LY GYK+W RD
Sbjct: 505 GVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRD 564

Query: 556 WRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           W + IPA+++DL+S+R+IFD ++++ E  E +E+LR++ W +RAAEFWC
Sbjct: 565 WTLYIPASKIDLISNRRIFDEDVLKQEDAEYREKLRNSGWLRRAAEFWC 613

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/599 (52%), Positives = 399/599 (66%), Gaps = 12/599 (2%)

Query: 6   MKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTH 65
           M+ +KS      ES + + +  +     E      F RF  +F R +     GDG     
Sbjct: 21  MQELKSNTGS--ESVERISLPGDDYKFHEDDSKSRFRRFARTFHRAD---GLGDG----- 70

Query: 66  ERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASL 125
              SG D E  A         LKQ I  RHV M+SL TGIGTGMLVGNGK+LHNGGPA L
Sbjct: 71  --ASGNDVEFGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGL 128

Query: 126 LIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCIL 185
           +IGYAI+ + LYC+IQ+A ELA+ Y+SLSG FNAYP++L+++AF FSV+W+YCLQWLC+L
Sbjct: 129 VIGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVL 188

Query: 186 PLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXX 245
           PLELVTAS+TIKYW  S+NPD                            N CKVLM    
Sbjct: 189 PLELVTASITIKYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGF 248

Query: 246 XXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVL 305
                 VNCGGAGNDGY+G  YW++PGAF G   I+ FKG+++ +V AAFA+G  EF  L
Sbjct: 249 FILGIIVNCGGAGNDGYIGGRYWNNPGAFYGTKPIHHFKGIISTMVTAAFAFGATEFIAL 308

Query: 306 TAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVI 365
           TAAEQ NP+++I SA+KK+VYRI+ I+L    L+GFLVP+NSPEL+GSGS+ATHASP+VI
Sbjct: 309 TAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVI 368

Query: 366 AIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPV 425
           A+ASHGV+VVPH                             +Q +AP    ++DR GRP+
Sbjct: 369 AVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPM 428

Query: 426 RCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRS 485
           R +LVSCVFGL+ FVAASPKEETVFTWLLAISGLS+LFTW SI +SH+RFR+++IVQG+ 
Sbjct: 429 RAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKP 488

Query: 486 LDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGL 545
           + ELGY+S TGV G+YYA         GQFWVAI+P+GS KLDAN+FFENYLA+P+ + L
Sbjct: 489 IGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVL 548

Query: 546 YLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           Y G+K+W RDWR+ IP  ++DL SHRK FD E+++ E  E +E +R+  W +R A +WC
Sbjct: 549 YFGFKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGWLRRIAHYWC 607

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/596 (51%), Positives = 390/596 (65%), Gaps = 14/596 (2%)

Query: 23  VEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNG-------GDGIHSTHERVSGE--DF 73
           V V  ETS          F RFVDSFKR E++ N         DG     ++   E  D 
Sbjct: 28  VSVTPETSATPNTPAPSQFRRFVDSFKRAEQQNNSEITSAASCDGSSENLDKDGKEVADL 87

Query: 74  ER-----LAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIG 128
           E      L    + K+K LKQ IKPRHV++ISL TGIGTG+LVGN K+LHN GPA LLIG
Sbjct: 88  EVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIG 147

Query: 129 YAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLE 188
           Y+I+ T LYC+IQ+A ELA+ Y+SLSGGFN YP+ LVD AF FSV+WVYC+QWLC+ PLE
Sbjct: 148 YSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLE 207

Query: 189 LVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXX 248
           LVTASMTIKYW  ++N D                            N CK+LM       
Sbjct: 208 LVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFIL 267

Query: 249 XXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAA 308
              +N GGAGNDGY+G  YWH PGAF G+  I+ FKG++A +V AAFA+G  EF  LTAA
Sbjct: 268 GIVINTGGAGNDGYIGDRYWHTPGAFAGDRPIDHFKGIMATMVTAAFAFGATEFIALTAA 327

Query: 309 EQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIA 368
           EQ NP+K+I SA+KK++YRI+ I+L +  L+GFLVPY+S +L+GSG +AT ASP+V+A++
Sbjct: 328 EQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVS 387

Query: 369 SHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCL 428
           +HGVKVVPH                             +QG APK F+YVDR GRP R +
Sbjct: 388 THGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAM 447

Query: 429 LVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDE 488
           + + VF ++ F AASPKEE VFTWLLAISGLS++FTWF+I LSH+RFR++M VQ RSL E
Sbjct: 448 VCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGE 507

Query: 489 LGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLG 548
           +G+++ TGVWG+YY           QFWVAI+P+G  KLDA  FFENYLAMPILI  Y+G
Sbjct: 508 IGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVG 567

Query: 549 YKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           YK+W +DW + I AN +DL  HR+IFD E+++ E  E +E+L++  + KR A FWC
Sbjct: 568 YKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDEEYREKLKNGGYLKRIAAFWC 623

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/603 (50%), Positives = 403/603 (66%), Gaps = 16/603 (2%)

Query: 18  ESFDSVEVVKETSPRSEGSRD----GLFHRFVDSFKRPEEEYNGGDGIHSTHER-----V 68
           E+ D V + ++    +E   D    G   RF+DSFKR E++ N    +    E      +
Sbjct: 58  ENVDGVNIDEKLQSTTEFGGDEMPRGNIRRFIDSFKRAEQQPNQQHNLAEDLENDLTTAI 117

Query: 69  SGEDFERL--APDDSSKHK----TLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGP 122
           S    +R+   P  + + K     LK++IKPRHV+MISL TGIGTG+LVGN K+LHN GP
Sbjct: 118 SMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGP 177

Query: 123 ASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWL 182
           A L+IGYAI+ + +YC+IQ+A E+A++Y++L GGFN YP++LVD  F F+V+WVYCLQWL
Sbjct: 178 AGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWL 237

Query: 183 CILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMX 242
           C+ PLELVT S+TIKYW  ++NPDA                           N CK+LM 
Sbjct: 238 CVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMI 297

Query: 243 XXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEF 302
                    +N GGAGNDGYLG+ YWHDPGAFRG NGI RFKG++A  V+AAFA+G  EF
Sbjct: 298 IGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRGTNGIQRFKGIMATFVSAAFAFGATEF 357

Query: 303 SVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASP 362
             LTAAEQ NP+K+I SA+KK++YR+I I++ T ALLGFLVP++S +L+G+G +AT ASP
Sbjct: 358 IALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASP 417

Query: 363 FVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRG 422
           +V+AI+ HGV+VVPH                             +QG+APK F+YVDR+G
Sbjct: 418 YVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQG 477

Query: 423 RPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQ 482
           RP R +  + +FG++ F AASPKE+ VFTWLLAISGLS+LFTW +I +SH+RFRR+M VQ
Sbjct: 478 RPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQ 537

Query: 483 GRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPI 541
           GRSL E+G+++  GV+G+YYA          QFWVAI+P+G+N  LDA  FFENYLAMPI
Sbjct: 538 GRSLGEIGFKAQLGVYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPI 597

Query: 542 LIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAE 601
           LI  Y GYKLW RDWR+ I A ++DL S+R++FD E+++ E  E KE+L++    KR  +
Sbjct: 598 LIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFDEELLKQEDEEYKEKLKNGPMWKRVVD 657

Query: 602 FWC 604
           FWC
Sbjct: 658 FWC 660

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/628 (49%), Positives = 407/628 (64%), Gaps = 29/628 (4%)

Query: 4   FEMKNIK--SPEDGVVESFDSVEVVKETS---PRSEGSRDGLFH------RFVDSFKRPE 52
           +E K++K  S E    E  + +E  +  S   P S+   D   H      RF DSFKR +
Sbjct: 8   YEQKDLKNSSTEIHATEQDNEIEYFETDSNDRPSSQPHLDYEQHNTSAVRRFFDSFKRAD 67

Query: 53  EEYNGGD------------GIHSTHERVSG----EDFERLAPDDSSKHKTLKQNIKPRHV 96
           +   G D             I  +     G    +  +++ P   +K  +LK+ I+PRHV
Sbjct: 68  Q--GGQDESEAVQMNDLTSAISPSSRNAQGLEKNDSTDKINPPAGNKSGSLKKTIQPRHV 125

Query: 97  LMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGG 156
           LMI+L TGIGTG+LVGNG +L + GPA LLIGYAI+ ++LYC+IQ+  ELA++Y++L+GG
Sbjct: 126 LMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGELALVYSNLTGG 185

Query: 157 FNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXX 216
           +NAYP+ LVD  F F+V+WVYCLQWLC+ PLELVTASMTIKYW  S+NPD          
Sbjct: 186 YNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLV 245

Query: 217 XXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRG 276
                             N CK+LM          ++ GGAGNDG++G  YWHDPGAF G
Sbjct: 246 ITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDPGAFNG 305

Query: 277 NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTA 336
            + I+RFKG+VA LV AAFA+GG+EF  +T AEQ NP+K+I  A+K+++YRI+ ++L T 
Sbjct: 306 KHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATI 365

Query: 337 ALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXX 396
            +LGFLVPYNS +LLGSG   T ASP+VIAIASHGV+VVPH                   
Sbjct: 366 IMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHFVNAVILLSVLSMANSSFY 425

Query: 397 XXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAI 456
                     EQG+APK F+Y+DR GRP+  + VS +F ++ F AASPKEE VFTWLLAI
Sbjct: 426 SSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAI 485

Query: 457 SGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFW 516
           SGLS+LFTW +I  SH+RFRR+M VQGRSL ELG++S TGVWG+ YA         GQFW
Sbjct: 486 SGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIMMLLILIGQFW 545

Query: 517 VAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDA 576
           VAI+P+G  KLDA  FFENYLAMPILI LY+GYK+W +DW++ I A+++DL SHR+IFD 
Sbjct: 546 VAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWKLFIRADKIDLESHRQIFDE 605

Query: 577 EIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           E+++ E  E +E+LR+  + KR A FWC
Sbjct: 606 ELIKQEDEEYRERLRNGPYWKRVAAFWC 633

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/626 (48%), Positives = 405/626 (64%), Gaps = 25/626 (3%)

Query: 4   FEMKNIK--SPEDGVVESFDSVEVVKETS---PRSEGSRDGLFH------RFVDSFKRPE 52
           +E+K++K  S E    E  + +E  +  S   P  +   D   H      RF+DSFKR +
Sbjct: 8   YELKDLKNSSTEVHAAEQENEIEYFETDSNDRPSQQPHLDYEQHNTSAVRRFLDSFKRAD 67

Query: 53  EEYNGGDGI--------------HSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLM 98
           ++      +                 HE    E  +++AP    K  +LK+ I+PRHVLM
Sbjct: 68  QDQEQEAEVAQMNDLTSAISPSSRQAHELEKDETTDKIAPHTGHKSDSLKKTIQPRHVLM 127

Query: 99  ISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFN 158
           I+L TGIGTG+LVGNG +L + GPA LLIGYAI+ ++LYC+IQ+  E+A++Y++L+GG+N
Sbjct: 128 IALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYN 187

Query: 159 AYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXX 218
           AYP+ LVD  F F+V+WVYCLQWLC+ PLELVTASMTIKYW  S+NPD            
Sbjct: 188 AYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVIT 247

Query: 219 XXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNN 278
                           N CK+LM          ++ GGAGNDGY+G  YWH+PGAF G +
Sbjct: 248 INIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFNGVH 307

Query: 279 GINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAAL 338
            I+RFKG+VA LV AAFA+GG+EF  +T AEQ NP+K+I  A+K+++YRI+ ++L T  +
Sbjct: 308 AIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIII 367

Query: 339 LGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXX 398
           +GFLVPYNS +LLGS    T ASP+VIAIASHGV+V PH                     
Sbjct: 368 VGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSS 427

Query: 399 XXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISG 458
                   EQG+APK+F+Y+DR GRP+  + VS +F ++ F AASPKE+ VFTWLLAISG
Sbjct: 428 ARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISG 487

Query: 459 LSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVA 518
           LS+LFTW +I LSH+RFRR+M VQGRSL ELG++S TGVWG+ Y+         GQFWVA
Sbjct: 488 LSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILILIGQFWVA 547

Query: 519 ISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEI 578
           I+P+G  KLDA  FFENYLAMPILI LY+GYK+W +DW++ I A+++DL SHR+IFD E+
Sbjct: 548 IAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWKLFIRADKIDLTSHRQIFDEEL 607

Query: 579 MQSEQLEEKEQLRHASWTKRAAEFWC 604
           ++ E  E +E+LR   + +R   FWC
Sbjct: 608 IKQEDDEYRERLRTGPYWRRVLAFWC 633

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/626 (48%), Positives = 402/626 (64%), Gaps = 25/626 (3%)

Query: 4   FEMKNIKSP--------EDGVVESFDSVEVVKETSPRS---EGSRDGLFHRFVDSFKR-- 50
           +E+K++K+         +D  +E F++    + +S      E        RF DSFKR  
Sbjct: 8   YELKDLKNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQHNTSAVRRFFDSFKRAD 67

Query: 51  --PEEEYNGGD----------GIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLM 98
             P++E                     E    E  + +  +   K  +LK+ I+PRHVLM
Sbjct: 68  QGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTIQPRHVLM 127

Query: 99  ISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFN 158
           I+L TGIGTG+LVGNG +L + GPA LLIGYAI+ ++LYC+IQ+  E+A++Y++L+GG+N
Sbjct: 128 IALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYN 187

Query: 159 AYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXX 218
           AYP+ LVD  F F+V+WVYCLQWLC+ PLELVTASMTIKYW  S+NPD            
Sbjct: 188 AYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVIT 247

Query: 219 XXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNN 278
                           N CK+LM          ++ GGAGNDG++G  YWHDPGAF G +
Sbjct: 248 INIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNGKH 307

Query: 279 GINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAAL 338
            I+RFKG+ A LV AAFA+GG+EF  +T AEQ NP+K+I  A+K+++YRI+ ++L T  L
Sbjct: 308 AIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIL 367

Query: 339 LGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXX 398
           LGFLVPYNS +LLGS    T ASP+VIA+ASHGV+VVPH                     
Sbjct: 368 LGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSS 427

Query: 399 XXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISG 458
                   EQG+APK+F+Y+DR GRP+  + VS +F ++ F AASPKEE VFTWLLAISG
Sbjct: 428 ARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISG 487

Query: 459 LSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVA 518
           LS+LFTW +I LSH+RFRR+M VQGRSL ELG++S TGVWG+ YA          QFWVA
Sbjct: 488 LSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQFWVA 547

Query: 519 ISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEI 578
           I+P+G  KLDA  FFENYLAMPILI LY+GYK+W++DW++ I A+++DL SHR+IFD E+
Sbjct: 548 IAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHRQIFDEEL 607

Query: 579 MQSEQLEEKEQLRHASWTKRAAEFWC 604
           ++ E  E +E+LR+  + KR   FWC
Sbjct: 608 IKQEDEEYRERLRNGPYWKRVVAFWC 633

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/635 (48%), Positives = 405/635 (63%), Gaps = 43/635 (6%)

Query: 4   FEMKNIK--SPEDGVVESFDSVEVVKETSPRSEGSRDGL---------FHRFVDSFKRPE 52
           +E+K++K  S E    E  + VE  +  S     S+  L           RF DSFK+ +
Sbjct: 8   YELKDLKNSSTEIHATEQDNEVEYFETDSNDPSSSQPPLGYEQHNTSALRRFFDSFKKAD 67

Query: 53  EEYNGGDGIHSTHERV--------------SGEDFERLAPDDSS---------KHKTLKQ 89
           +         S  ERV              S    + L  ++SS         K  +LK+
Sbjct: 68  Q---------SAEERVETAQMNDLASAISPSSRQRQELEKNESSDNIGARTGNKSDSLKK 118

Query: 90  NIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAII 149
            I+PRHVLMI+L TGIGTG+LVGNG +L + GPA LLIGY I+ ++LYC+IQ+  E+A++
Sbjct: 119 TIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMALV 178

Query: 150 YTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXX 209
           Y++L+GG+NAYP+ LVD  F F+V+WVYCLQWLC+ PLELVTASMTIKYW  S+NPD   
Sbjct: 179 YSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFV 238

Query: 210 XXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWH 269
                                    N CK+LM          ++ GGAGNDG++G  YWH
Sbjct: 239 IIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWH 298

Query: 270 DPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRII 329
           DPGAF G + I+RFKG+VA LV AAFA+GG+EF  +T AEQ NP+K++  A+K+++YRI+
Sbjct: 299 DPGAFNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRIL 358

Query: 330 GIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXX 389
            ++L T  LLGFLVPYNS +LLGS    T ASP+VIA+ASHGV+VVPH            
Sbjct: 359 FLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLS 418

Query: 390 XXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETV 449
                            EQG+AP++F Y+D+ GRP+  + VS +FG++ F AASPKE+ V
Sbjct: 419 MANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKEDQV 478

Query: 450 FTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXX 509
           FTWLLAISGLS+LFTW +I LSH+RFRR+M VQGRSL ELG++S TGVWG+ YA      
Sbjct: 479 FTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMIL 538

Query: 510 XXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVS 569
              GQFWVAI+P+G  KLDA  FFENYLAMPILI LY+GYK+W +DW++ I A+++DL+S
Sbjct: 539 ILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWKLFIRADKIDLIS 598

Query: 570 HRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           HR+IFD E+++ E  E +E+L++    KR   FWC
Sbjct: 599 HRQIFDEELIKQEDEEFRERLKNGPCWKRVVAFWC 633

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/630 (48%), Positives = 402/630 (63%), Gaps = 29/630 (4%)

Query: 4   FEMKNIKSPEDGVVESFD-SVEVVK--------ETSPRSEGSRDGLFHR-FVDSFKRPEE 53
           +E+K++KS    +  + D  VE +         E+S R+  +++G F R F+DSFKR + 
Sbjct: 8   YELKDLKSGSAVITSTTDREVEYLDDQINNSYDESSVRNRKTKEGTFVRSFIDSFKRADR 67

Query: 54  EYNG----GDGIHSTHERVSGED-FERLAPDDS--------------SKHKTLKQNIKPR 94
             N      + I ++  R S +    +   DD+               K + LK+ IKPR
Sbjct: 68  NSNPLHDLDNDITTSISRTSMDAALNKTKFDDAISSSISETNKGHQNEKSEDLKKTIKPR 127

Query: 95  HVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLS 154
           HV+MISL TGIGTG+LVGNG  L   GPA+L+IGYAI+ T LYC+IQ+A ELA++Y+ L+
Sbjct: 128 HVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGELAVVYSDLN 187

Query: 155 GGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXX 214
           GGFNAYP+ LVD A  FSV+WVYCLQWLC+ PLELVTASMTIKYW   ++PD        
Sbjct: 188 GGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYV 247

Query: 215 XXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF 274
                               N CKVLM          +  GGAGNDGYLG+ YWHDPGAF
Sbjct: 248 LIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGYLGAKYWHDPGAF 307

Query: 275 RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLM 334
            G+  I+RFKG++   V AAFA+G  EF  LTAAEQ NP+K+I SA+KK++YRI+ I+L 
Sbjct: 308 NGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCIFLA 367

Query: 335 TAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXX 394
           +  L+GFLVPYNS +LLGSG +   ASP+VIA++SHGV+VVPH                 
Sbjct: 368 SITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPHFINAVILLSVLSVGNSA 427

Query: 395 XXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLL 454
                       +QG+APK F+YVDR GRP R +L+S +FG++ F A SPKE  VF+WLL
Sbjct: 428 FYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCATSPKETEVFSWLL 487

Query: 455 AISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQ 514
           AISGLS+LFTW +I +SH+RFRR+M VQGRSL E+GY S +GV+G+ YA          Q
Sbjct: 488 AISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGVYGSAYAAIMLFLALIAQ 547

Query: 515 FWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIF 574
           FWVAI+P+G  KLDA NFF+NYLAMPILI  Y GY++W RDW++ I A ++DL +HR+IF
Sbjct: 548 FWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWKLFIRAKDIDLDTHRQIF 607

Query: 575 DAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           D  I++ E  E KE+LR+    +R   FWC
Sbjct: 608 DENILRQEDEEYKEKLRNGPMWRRFLAFWC 637

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/628 (47%), Positives = 403/628 (64%), Gaps = 27/628 (4%)

Query: 4   FEMKNI------KSPE-DGVVESFDSVEVVKETSPRSE------GSRDGL---------F 41
           +EMK I      KSPE D +VE F++   +      S+      G +  L          
Sbjct: 21  YEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHL 80

Query: 42  HRFVDSFKRPEE-----EYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHV 96
            + +DSF+R E+       +  + + +T   +S     + AP    K   L++ IKPRHV
Sbjct: 81  RKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHV 140

Query: 97  LMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGG 156
           L++SL TGIGTG+LVGNG +LH  GP  L+IGYAI+ + LYC+IQ+  E+A+ Y+ L G 
Sbjct: 141 LLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGN 200

Query: 157 FNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXX 216
           FNAYP+ LVD+AF FSV+WVYCLQWLC++PLELVTASMTI+YW  ++N D          
Sbjct: 201 FNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADVFVVIFYVLI 260

Query: 217 XXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRG 276
                             N+CKVLM          +N GGAGNDGY+G+ YWH+PGAFRG
Sbjct: 261 IFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG 320

Query: 277 NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTA 336
           +  I+RFK +++    AAFA+G +EF  + A+EQ NP+++I SA+K ++YRI+ I+L + 
Sbjct: 321 DKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSI 380

Query: 337 ALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXX 396
            L+GFLVPYNS EL+GSGSAAT ASP+VIA+ASHGV+VVPH                   
Sbjct: 381 TLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFY 440

Query: 397 XXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAI 456
                     +QG+AP  FNY+DR GRP R +++S +F ++ F A S KEE VFTWLLAI
Sbjct: 441 SSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAI 500

Query: 457 SGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFW 516
           SGLS+LFTW +I +SH+RFRR+M VQGRS+DE+G++S  GVWG+ YA          +FW
Sbjct: 501 SGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFW 560

Query: 517 VAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDA 576
           V+I+P+G + LDA NFFENYLAMPILI LY GYK+  RDW++ I A ++DLVSHRKI+D 
Sbjct: 561 VSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDG 620

Query: 577 EIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           E+++ E+ E KE+LR+  + K+   FWC
Sbjct: 621 ELIKQEEEEFKERLRNGPFWKKVVAFWC 648

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/635 (48%), Positives = 403/635 (63%), Gaps = 34/635 (5%)

Query: 4   FEMKNIKSPEDGV--VESFDSVEVVKETSPRS------EGSRDGL-FHRFVDSFKRPEEE 54
           +EMK I++ E  +  +   + VE  + T  ++      EG R      RF+DSFKR E  
Sbjct: 27  YEMKEIQAKEREINSIAPENEVEYFENTMEKTMENLEYEGDRKASHLRRFIDSFKRAEGS 86

Query: 55  Y----------NGGDGIHSTHERVSGEDFE--------------RLAPDDSSKHKTLKQN 90
           +           GG    ST++  S  D E              + + +     + LK+ 
Sbjct: 87  HPNSPDSSNSIGGGATPISTNDSSSQLDNELNPKGSFVTESGIKQPSQEQDQNQENLKKT 146

Query: 91  IKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIY 150
           IKPRH++M+SL TGIGTG+LVGN K L+N GPA L+IGYAI+ + +YC+IQ+  ELA+IY
Sbjct: 147 IKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELAVIY 206

Query: 151 TSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXX 210
           + L GGFN YP+ LVD A  FSV+WVYCLQWLC+ PLELVTASMTIKYW   ++PD    
Sbjct: 207 SDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVV 266

Query: 211 XXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHD 270
                                   N CK+LM          ++CGGAG DGY+GS YWH+
Sbjct: 267 IFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRYWHN 326

Query: 271 PGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIG 330
           PGAFRGN GI RFKG+VA  V AAFA+G +E   +TA+EQ NP+K+I SA+KK++YRI+ 
Sbjct: 327 PGAFRGNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILF 386

Query: 331 IYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXX 390
           ++L +  L+GFLVPY S +LLG+  +AT ASP+VIA+ASHGV+VVPH             
Sbjct: 387 VFLGSLVLVGFLVPYTSDQLLGASGSATKASPYVIAVASHGVRVVPHFINAVILLSVLSV 446

Query: 391 XXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVF 450
                           +QG APK F+Y+DR GRP   +LVS +FG++ F A+SPKEE VF
Sbjct: 447 ANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDVF 506

Query: 451 TWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXX 510
           TWLLAISGLS+LFTW +I LSH+RFRR+M VQGRSL E+GY+S  G+WG+ YA       
Sbjct: 507 TWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVLA 566

Query: 511 XXGQFWVAISPV-GSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVS 569
              QFWVAISP+ G  KL A +FFENYLAMPILI LY+ YK+W +DW + IPA+++DLV+
Sbjct: 567 LIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYKVWKKDWTLFIPADKIDLVT 626

Query: 570 HRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            R+IFD E+++ E  E +E+LR+  + KR  +FWC
Sbjct: 627 DRQIFDEELLKQEDEEYQEKLRNGPYWKRVVDFWC 661

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/635 (48%), Positives = 402/635 (63%), Gaps = 36/635 (5%)

Query: 4   FEMKNI--KSPEDGVVESFDSVEVVKETSPRSEGSRD-------GLFHRFVDSFKRPEEE 54
           +EMK I  K  E+  +E  + VE  + T  ++  + +         FHRF+DSF+R E  
Sbjct: 31  YEMKEIQPKEKENASIERENEVEYFENTMEKTMENMEYKGDHQRSYFHRFIDSFRRAEGS 90

Query: 55  Y---------NGGDGIHSTHERVSGEDFERLAPDDS---------------SKHKTLKQN 90
           +         NG   I ST +  S  D E L P  S                K + LK++
Sbjct: 91  HPNSPDSTNLNGSTPI-STKDSSSRLDNE-LNPKSSYITVDGIKQSSQEQEPKQENLKKS 148

Query: 91  IKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIY 150
           IKPRH +M+SL TGIGTG+LVGN K L+N GP  L+IGYAI+ + +YC+IQ+  ELA+IY
Sbjct: 149 IKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIY 208

Query: 151 TSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXX 210
           + L GGFN YP+ LVD A  FSV+W++CLQWLC+ PLELVTASMTIKYW   +N D    
Sbjct: 209 SDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVI 268

Query: 211 XXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHD 270
                                   N CK+LM          ++CGGAG DGY+GS YW D
Sbjct: 269 IFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRD 328

Query: 271 PGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIG 330
           PGAFRG+  I RFKG+VA  V AAFA+G +E   +TA+EQ NP+K+I SA+KK++YRI+ 
Sbjct: 329 PGAFRGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILF 388

Query: 331 IYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXX 390
           ++L + AL+GFLVPY S +LLG+  +AT ASP+VIA++SHGV+VVPH             
Sbjct: 389 VFLASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSV 448

Query: 391 XXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVF 450
                           +QG APK F+Y+DR GRP   ++VS VFG++ F A+S KEE VF
Sbjct: 449 ANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVF 508

Query: 451 TWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXX 510
           TWLLAISGLS+LFTW +I LSH+RFR+ M VQGRSL E+GY+S  GVWG+ YA       
Sbjct: 509 TWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLA 568

Query: 511 XXGQFWVAISPVGSN-KLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVS 569
             GQFWVAISP+G + KL A +FFENYLAMPILI LY+ YK+W RDW + IPA+++DLVS
Sbjct: 569 LIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDWSLFIPADKIDLVS 628

Query: 570 HRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           HR IFD E+++ E  E K++LR+  + KR  +FWC
Sbjct: 629 HRNIFDEELLKQEDEEYKDRLRNGPFWKRVLDFWC 663

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/595 (48%), Positives = 393/595 (66%), Gaps = 19/595 (3%)

Query: 27  KETSPRSEGSRDGLFHRFVDSFKRP-----------EEEYNGG--DGIHSTHERVSGEDF 73
           K+ +P  +  +  +  RF+DSFK+P           E +Y     +GI +T    S  + 
Sbjct: 55  KDLNPSDKKKKSNI-KRFIDSFKQPIRPNSDYIDAAELDYEQALENGI-TTSVSPSAPNL 112

Query: 74  ERL----APDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGY 129
            +L     P D++ +K LKQ I+PRHV+MISL TGIGTG+LVGNG +L N GPA L+IGY
Sbjct: 113 RKLNQLRTPTDANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGY 172

Query: 130 AIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLEL 189
           +I+ +++YC+IQ+  E+AI Y++L GG+N YP+ LV+K F F+++WVYC+QWL + PLEL
Sbjct: 173 SIMGSIIYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLEL 232

Query: 190 VTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXX 249
           VTAS+TIKYW  S+N D                            N CKVLM        
Sbjct: 233 VTASLTIKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILS 292

Query: 250 XXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309
             +  GGAGNDGYLG +YWH PGAFRG++ I+ FKG+   LV AAFAYGG EF  LTAAE
Sbjct: 293 ITITAGGAGNDGYLGGLYWHTPGAFRGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAE 352

Query: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIAS 369
           Q NP+ +I SA+KK++YRII +YL++  ++GFLVP++S  LLGS  +AT ASP+V+A + 
Sbjct: 353 QSNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASL 412

Query: 370 HGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLL 429
           HGV+VVPH                              QG+APK F+Y+DR GRP R +L
Sbjct: 413 HGVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAML 472

Query: 430 VSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDEL 489
           +S +FG++ F AASPKE  VFTWLLAISGLS+LFTW +I LSH+RFR +M VQGRSL E+
Sbjct: 473 MSALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEV 532

Query: 490 GYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGY 549
           GY + TGVWG++YA          QFWVAI+P+GS +L A NFFENYLAMPILI LYLGY
Sbjct: 533 GYLAQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGY 592

Query: 550 KLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           K++Y+DW ++I A ++DL SHR+IFD ++++ E  E +++L++  + +R  +FWC
Sbjct: 593 KIYYKDWTLLIKAEDIDLQSHRQIFDEDLLKEEDFEYRQRLKNGPFWRRVVDFWC 647

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/633 (48%), Positives = 400/633 (63%), Gaps = 32/633 (5%)

Query: 4   FEMKNIKSPED--GVVESFDSVEVVKETSPRS------EGSRDGLF-HRFVDSFKR---- 50
           +EMK I+  E   G +E  + VE  ++T  ++      EG     +  RF+DSF+R    
Sbjct: 31  YEMKEIQPKEKQIGSIEPENEVEYFEKTVEKTIENMEYEGEHHASYLRRFIDSFRRAEGS 90

Query: 51  ----PEEEYNGGDGIHSTHERVSGEDFE-------------RLAPDDS-SKHKTLKQNIK 92
               P+   + G    ST +  S  D E             + +P +   K + LK++IK
Sbjct: 91  HANSPDSSNSNGTTPISTKDSSSQLDNELNRKSSYITVDGIKQSPQEQEQKQENLKKSIK 150

Query: 93  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTS 152
           PRH +M+SL TGIGTG+LVGN K L+N GP  L+IGYAI+ + +YC+IQ+  ELA+IY+ 
Sbjct: 151 PRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSD 210

Query: 153 LSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXX 212
           L GGFN YP  LVD A  FSV+W++CLQWLC+ PLELVTASMTIKYW  S+NPD      
Sbjct: 211 LIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIF 270

Query: 213 XXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPG 272
                                 N CK+LM          ++CGGAG DGY+GS YW DPG
Sbjct: 271 YVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPG 330

Query: 273 AFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIY 332
           AFRG+  I RFKG+VA  V AAFA+G +E   +TA+EQ NP+K+I SA+KK++YRI+ ++
Sbjct: 331 AFRGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVF 390

Query: 333 LMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXX 392
           L +  L+GFLVPY S +LLG+  +AT ASP+VIA++SHGV+VVPH               
Sbjct: 391 LASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVAN 450

Query: 393 XXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTW 452
                         +QG APK F+Y+DR GRP   +LVS +FG++ F A+S KEE VFTW
Sbjct: 451 GAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTW 510

Query: 453 LLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXX 512
           LLAISGLS+LFTW +I LSH+RFRR+M VQGRSL E+GY+S  GVWG+ YA         
Sbjct: 511 LLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALI 570

Query: 513 GQFWVAISPV-GSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHR 571
            QFWVAI+P+ G  KL A +FFENYLAMPI I LY+ YK+W +DW + IPA++VDLVSHR
Sbjct: 571 AQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSHR 630

Query: 572 KIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            IFD E+++ E  E KE+LR+  + KR  +FWC
Sbjct: 631 NIFDEELLKQEDEEYKERLRNGPYWKRVLDFWC 663

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/633 (47%), Positives = 395/633 (62%), Gaps = 32/633 (5%)

Query: 4   FEMKNI--KSPEDGVVESFDSVEVVKETSPRSEGSRD-------GLFHRFVDSFKRPEEE 54
           +EMK I  K  E G +E  + +E  +ET  ++  S +           RF+DSFKR E  
Sbjct: 31  YEMKEIQPKEKEIGSIEPENEIEYFEETVEKNIESMEYQGENHASYLRRFIDSFKRAEGS 90

Query: 55  YNG----------------------GDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIK 92
           +                         + ++     ++ +  ++   +   K + LK++IK
Sbjct: 91  HANSSDSSNSNTTTPIFTNDSSSQLDNELNRKSSYITVDGIKQAPQEQEQKQENLKKSIK 150

Query: 93  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTS 152
           PRH +M+SL TGIGTG+LVGN K L+N GP  L+IGYAI+ + +YC+IQ+  ELA+IY+ 
Sbjct: 151 PRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSD 210

Query: 153 LSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXX 212
           L GGFN YP  LVD A  FSV+W++CLQWLC+ PLELVTASMTIKYW   ++PD      
Sbjct: 211 LIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIF 270

Query: 213 XXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPG 272
                                 N CK+LM          ++CGGAG DGY+GS YW DPG
Sbjct: 271 YVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPG 330

Query: 273 AFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIY 332
           AFRG+  I RFKG+VA  V AAFA+G +E   +TA+EQ NP+K+I SA+KK++YRI+ ++
Sbjct: 331 AFRGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVF 390

Query: 333 LMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXX 392
           L +  L+GFLVPY S +LLG+  +AT ASP+VIA++SHGV+VVPH               
Sbjct: 391 LASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVAN 450

Query: 393 XXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTW 452
                         +QG APK F+Y+DR GRP   +LVS +FG++ F A+S KEE VFTW
Sbjct: 451 SAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTW 510

Query: 453 LLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXX 512
           LLAISGLS+LFTW +I LSH+RFRR+M VQGRSL E+GY+S  GVWG+ YA         
Sbjct: 511 LLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMMLALI 570

Query: 513 GQFWVAISPV-GSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHR 571
            QFWVAI+P+ G  KL A +FFENYLAMPILI LY+ +K+W  DW + IPAN+VDLVSHR
Sbjct: 571 AQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFKVWKNDWSLFIPANKVDLVSHR 630

Query: 572 KIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            IFD E+++ E  E KE+LR+  + KR  +FWC
Sbjct: 631 NIFDEELLKQEDEEYKERLRNGPYWKRIVDFWC 663

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/586 (51%), Positives = 379/586 (64%), Gaps = 12/586 (2%)

Query: 22  SVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDD- 80
           +VE+  +T   S  S+ G    F+DSFKR E +        +  E       E +  +D 
Sbjct: 18  AVEIPIDT--ESVHSQHGFVRNFMDSFKRAEPQG------QTIREEKLENGLETVRTNDY 69

Query: 81  SSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140
           ++  K +KQ +K RH+ MISL TGIGTG+LV NGK+LH GGP  L+IGY   STMLYCVI
Sbjct: 70  NATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVI 129

Query: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN 200
           Q+  EL + Y +L G +N+YP+ LVD  F F+V+WVY LQW  +LPLELVT+SMTIKYWN
Sbjct: 130 QACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWN 189

Query: 201 DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND 260
           DSINPD                            N+CKVLM          VNC GA   
Sbjct: 190 DSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNC-GASKS 248

Query: 261 GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 320
           GY+G  YWH PGAF G   I+ FKG+ +V V +AFAYGG+EF  LTAAEQ NP+KS+  A
Sbjct: 249 GYIGGKYWHTPGAFVGEKAIDHFKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPKA 308

Query: 321 SKKLVYRIIGIYLMTAALLGFLVPYNSPELLGS-GSAATHASPFVIAIASHGVKVVPHXX 379
           +K+ +YR++ ++L    L+GFLVPY+SP LLGS G AA+HASPFVIA ASHGVKVVPH  
Sbjct: 309 TKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHII 368

Query: 380 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCF 439
                                      EQG  PK+F YVDR+GRP+  +L   +FGL+ F
Sbjct: 369 NAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLISF 428

Query: 440 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWG 499
           VAAS  EETVFTWL AI  LS+LFTW +ISLSH+RFR +M  QGRSL ELGY++ TG WG
Sbjct: 429 VAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYWG 488

Query: 500 AYYAXXXXXXXXXGQFWVAISPVGS-NKLDANNFFENYLAMPILIGLYLGYKLWYRDWRV 558
           ++YA          QFWVAI+P+G+  KLD NNFF+NYLA P+L+  Y GYKLWYRDW++
Sbjct: 489 SWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRDWKL 548

Query: 559 IIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            IPA++VDL SHRKIFDA++++ E  E KE++R++S+  RA +FWC
Sbjct: 549 FIPADKVDLESHRKIFDADLIKQEDFEHKERIRNSSFWVRALDFWC 594

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/608 (47%), Positives = 389/608 (63%), Gaps = 22/608 (3%)

Query: 1   MKGFEMKNIKSPE----DGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYN 56
           + G E+K++KS          E F+   V K      EG     F RFV+SFK+      
Sbjct: 17  LVGNELKDVKSGNVLTGSDTTEFFEKASVQKSDFEYFEGDETK-FRRFVNSFKK------ 69

Query: 57  GGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKS 116
                        G + ++ +  D++KH+ LKQ I+PRHV+MISL TGIGTG+LVG GK+
Sbjct: 70  -----------APGRENDQESLQDNNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKA 118

Query: 117 LHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWV 176
           L+NGGP  L +G+ ++ T +YCVIQ+A E+A+ Y +LSGGFNAYP+ LVD  F F+ +W+
Sbjct: 119 LYNGGPGGLAVGFFVMGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWL 178

Query: 177 YCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNT 236
           YC+QWLC+ PLELVTAS+TIKYW  +INPD                            NT
Sbjct: 179 YCIQWLCVFPLELVTASITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNT 238

Query: 237 CKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFA 296
           CKVLM          VN G AGNDGY+G+ YW +PG+F G+  I+ FKG+V+ LVNAAF+
Sbjct: 239 CKVLMIIGFFIVGILVNTGAAGNDGYIGAKYWREPGSFGGHTAIDHFKGVVSTLVNAAFS 298

Query: 297 YGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSA 356
            G +EF  LTAAEQ NP+KS+ SA+KK++Y++  ++L +  L+GFLVP NS EL+GS  +
Sbjct: 299 LGCSEFVALTAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDS 358

Query: 357 ATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFN 416
           + H SP+VIA+ASHGV+VVPH                             EQG+AP +F 
Sbjct: 359 SVHVSPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFK 418

Query: 417 YVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFR 476
           Y+DR+GRP+  ++VS   G LCFVAASPKEETVF WLLAISGLS+LFTW SI +SH+RFR
Sbjct: 419 YIDRQGRPLMAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFR 478

Query: 477 RSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENY 536
           ++++VQGR  D LG+++ TGVWG+YY+          QFW  + P+GS+K +A +FFE Y
Sbjct: 479 KALLVQGRGWDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGY 538

Query: 537 LAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWT 596
           LA PI + LY GYK++ ++W++ IPA ++DL  HRKIFDA++++ E  E + +LR +S  
Sbjct: 539 LAFPIFVALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLKQEDAEYRAKLRDSSMW 598

Query: 597 KRAAEFWC 604
            R A  WC
Sbjct: 599 HRIAALWC 606

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/569 (50%), Positives = 377/569 (66%), Gaps = 9/569 (1%)

Query: 41  FHRFVDSFKRPEEEYNGGDGIHSTHERVSGE-DFE---RLAPDDSSKHKTLKQNIKPRHV 96
           F RF+DSFK+ E    G       H+ ++G+ D E   R  P+     + LK+ IKPRHV
Sbjct: 63  FRRFIDSFKKAEGPQPG----SLDHDVLAGDSDIEGKPRTEPEKDDDARELKKTIKPRHV 118

Query: 97  LMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGG 156
           +MISL TGIGTGMLVGNG SL N GPA L+IGYAI+ + +YC+IQ+  ELA++YT L+GG
Sbjct: 119 VMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGG 178

Query: 157 FNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXX 216
           FNAYP++L+D AF F+V+WVYC+QWLC+ PLELVTASMTIKYW   ++PD          
Sbjct: 179 FNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYCLI 238

Query: 217 XXXXXXXXXX-XXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFR 275
                              N+ K+LM          V CGGAGNDGY+G+  WH+PG+FR
Sbjct: 239 LCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSFR 298

Query: 276 GNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMT 335
           G+  ++RFKG+V+ LVNAAFA+G +EF  +TA+EQ NP+K+I SA+KK++YRII IYL +
Sbjct: 299 GDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGS 358

Query: 336 AALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXX 395
             ++GFLVPY+S +LLGS  AAT ASP+V+AI+ HGV+VVPH                  
Sbjct: 359 VTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLHGVRVVPHFINAVILLSVLSVGNSAF 418

Query: 396 XXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLA 455
                      + G+AP   NYVDR GRP++   VS + G++ F A SPKE+ VF WLLA
Sbjct: 419 YSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLA 478

Query: 456 ISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQF 515
           ISGLS+LFTWFSI LSH+RFRR+M VQGRS+ E+G++S  G++G+ Y+          QF
Sbjct: 479 ISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQF 538

Query: 516 WVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFD 575
           W A+ PVG  K D   FFENYLAMPI I LY G+K+W +DWR+ I A ++DLVSHR+IFD
Sbjct: 539 WTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFD 598

Query: 576 AEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            E+++ E  E + +LR     +R  +FWC
Sbjct: 599 EELLKQEDEEYRRKLRDGPMWRRVYDFWC 627

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/585 (48%), Positives = 382/585 (65%), Gaps = 12/585 (2%)

Query: 32  RSEGSRDG-LFHRFVDSFKRPEEEYNGGDGIHS-----------THERVSGEDFERLAPD 79
           R++GS  G +F  F+D F+R     +  + + +           +  + SG+       +
Sbjct: 58  RNDGSAKGNIFVNFIDGFRRQTNHNSAAEDLENELTTCVSPATLSDYKKSGDSGSVDELE 117

Query: 80  DSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCV 139
             +K + LK++IKPRHV+MISL TGIGTG+LVGN K+L++ GPA L IGYAI+ + +YC+
Sbjct: 118 GKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCI 177

Query: 140 IQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW 199
           IQ+A E+A+ Y++L GGFNAYP+ LV     F+V+WVY LQW C+ PLELVTASMTIKYW
Sbjct: 178 IQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYW 237

Query: 200 NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGN 259
              +NPD                            N CKVLM          +NCGGAGN
Sbjct: 238 TTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGN 297

Query: 260 DGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 319
           DGY+G  YWHDPGAFRG+  I+RFKG+ A LV AAFA+GG+EF  LTA+EQ NP+K+I +
Sbjct: 298 DGYIGGKYWHDPGAFRGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPA 357

Query: 320 ASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXX 379
           A+KK++YRII I+L +  ++GFLVP+NS +L+GS S+ T ASP+VIAI+SHGV+VVPH  
Sbjct: 358 AAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVRVVPHFV 417

Query: 380 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCF 439
                                      +QG+APK FNY+DR GRP R +++  +F ++ F
Sbjct: 418 NAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAF 477

Query: 440 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWG 499
            AAS KEE VFTWLLAISGLS++FTW +I LSH+RFRR+M VQGRSL E+G++S  GVWG
Sbjct: 478 CAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWG 537

Query: 500 AYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVI 559
           +YYA          QFWV ++P+G NKLDA +FFE+YLAM +LI  Y+GY  W +DW + 
Sbjct: 538 SYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLF 597

Query: 560 IPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           I A ++DL  HR+IFD ++++ E  E KE+LR+    KR   FWC
Sbjct: 598 IRAKDIDLDHHRQIFDEDVLRQEDEETKEKLRNGPLWKRILNFWC 642

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/610 (47%), Positives = 382/610 (62%), Gaps = 10/610 (1%)

Query: 4   FEMKNIKSPEDGV--VESFDS---VEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEY--- 55
           F   N     D +  +E  DS   V V+ E          G F  F+DSF+R E+     
Sbjct: 9   FTTNNYTEKSDSIDPIEQGDSDLQVTVLDEEKSEFSNGLRGRFDEFIDSFRRAEDVRILP 68

Query: 56  NGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGK 115
           N  + I S HE V       ++  D+  ++ LK+ I+PRHV+MI+L TG+GTG+LVGNG 
Sbjct: 69  NEMNPILS-HESVFDTAVVEISAVDNQINEKLKKTIQPRHVIMITLGTGVGTGLLVGNGT 127

Query: 116 SLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSW 175
           +L + GPA L+IGYAI+ST +YCV+Q+  E+A+ Y +L GGF+AYP  L+D    F+VSW
Sbjct: 128 TLSHAGPAGLIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSW 187

Query: 176 VYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXX-XXXXXXXX 234
           +YC+QW C+ PLELVTASMTI+YW   +N D                             
Sbjct: 188 IYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFC 247

Query: 235 NTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAA 294
           N CK+LM          + CGGAGN G++G+ YWH PGAFRG+NGINRFKG+V+ LV AA
Sbjct: 248 NVCKILMMTGFFILGIILICGGAGNSGFIGARYWHSPGAFRGDNGINRFKGIVSTLVTAA 307

Query: 295 FAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSG 354
           FA+GG EF  +TA+EQ NP+K+I SA+KK++YR + IY+ +  ++GFLVPYNS ELLGS 
Sbjct: 308 FAFGGTEFLAITASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSS 367

Query: 355 SAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKL 414
             AT ASP+VIA+ASHG++VVPH                              QGFAPK+
Sbjct: 368 GPATKASPYVIAVASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKI 427

Query: 415 FNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVR 474
           F YVD+RGRP    +V  +  ++ F A S KE  VF WLL+ISGLSE+FTW  ISLSH+R
Sbjct: 428 FTYVDKRGRPTLGFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIR 487

Query: 475 FRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFE 534
           FRR+M VQGRSLDE+G++S  GVWG+ YA         GQFWV I PVG +  DA +FF+
Sbjct: 488 FRRAMKVQGRSLDEIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQ 547

Query: 535 NYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHAS 594
            YLAMP+ I LY GYK+W RDWR+ I A  +DL++HR I+D E+++ E+ E +E+ R+A 
Sbjct: 548 AYLAMPVFIVLYFGYKIWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAP 607

Query: 595 WTKRAAEFWC 604
             ++   FWC
Sbjct: 608 LWRKIYNFWC 617

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/639 (47%), Positives = 402/639 (62%), Gaps = 43/639 (6%)

Query: 3   GFEMKNIK------SPEDGVVESFDSV--------EVVKETSPRSEGSRDGLFHRFVDSF 48
           G+EM + K      S ++  VE  DS           +KE  P S G++ G F  FVDSF
Sbjct: 7   GYEMSDTKAEAHVFSSQENEVEYLDSQLNGDSSSNNSIKE--PTSTGAK-GHFKSFVDSF 63

Query: 49  KRPEEEYNGGDGIHSTHERVSG---------------EDFERLAPDDSSKHKT------- 86
           +R +   N    +H     ++                ED E +    S++H+        
Sbjct: 64  RRGDHAKNA---LHDLENDITTSISHASLVHAVSKAREDDEIMQSVASAEHRKVNNTESD 120

Query: 87  -LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASE 145
            L++ IKPRHV+MISL TGIGTG+LVGN   L   GPA L+IGY+I+ + LYC+IQ+A E
Sbjct: 121 DLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQAAGE 180

Query: 146 LAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINP 205
           +A++Y+ L+GGFN YP+ L+D A  FSV+WVYCLQWLC+ PLELVTAS+TIKYW   ++P
Sbjct: 181 MAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTKVDP 240

Query: 206 DAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGS 265
           D                            N CKVLM          +  GGAGNDGYLG+
Sbjct: 241 DVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGNDGYLGA 300

Query: 266 VYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLV 325
            YWH+PGAFRG + ++RFKG++   V AAFA+G  EF  LTAAEQ NP+K+I SA+KK++
Sbjct: 301 KYWHEPGAFRGEHAVDRFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVL 360

Query: 326 YRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXX 385
           YRI+ I+L++  +LGFLVPY+S +LLGS  +   ASP+V+A++ HGV+VVPH        
Sbjct: 361 YRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKASPYVLAVSLHGVRVVPHFINAVILL 420

Query: 386 XXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPK 445
                                +QG+APK F+YVDR+GRP R +L+S +FG++ F A SPK
Sbjct: 421 SVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVIAFCATSPK 480

Query: 446 EETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXX 505
           E  VF WLLAISGLS+LFTWF+I +SHVRFR +M VQGRS+ E+G+ S TGV+G+ YA  
Sbjct: 481 ETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYGSLYAAT 540

Query: 506 XXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEV 565
                   QFWVAI+P+   KLDA NFF++YLAMPILI LY GYKL+YRDW++ I A+++
Sbjct: 541 MMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLYYRDWKLYIKADKI 600

Query: 566 DLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           DL+SHR+IFD  I++ E  E KE+LR+    +R A+FWC
Sbjct: 601 DLISHRQIFDENILKQEDEEYKEKLRNGPAWRRIADFWC 639

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/577 (49%), Positives = 377/577 (65%), Gaps = 13/577 (2%)

Query: 27  KETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKT 86
           +ET   S+GS    F +FVDSFKR +E+    D + S    V GE+ +            
Sbjct: 70  EETIHNSDGSSRSPFGKFVDSFKRVDEKQTTSD-LESGLGEVPGENSD------------ 116

Query: 87  LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASEL 146
           LKQ IK RHVL+ISL TGIGTG+LVGN K L + GP  L+IGY+I+ + LYC+IQ+  EL
Sbjct: 117 LKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQACGEL 176

Query: 147 AIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPD 206
           A+ Y+SL   FN YP  LVDKAF F+V+WVYCLQWLC+ PLELVTASMTIKYW  S+NPD
Sbjct: 177 AVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPD 236

Query: 207 AXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSV 266
                                       N+CKVLM          + CGGAG  GY+G+ 
Sbjct: 237 IFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGYIGAK 296

Query: 267 YWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 326
           YWH PGAF GN  I+ FKG++A    AAFA+G +EF  LTAAEQ NP+K+I  A+K ++Y
Sbjct: 297 YWHSPGAFNGNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAIPKAAKMMIY 356

Query: 327 RIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXX 386
           RI+ ++L +  L+GFLVPYNSP LLGSGS AT ASP+V+A+ASHGV+VVPH         
Sbjct: 357 RILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRVVPHFINAVILLS 416

Query: 387 XXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKE 446
                               +QG+APK+F Y+D+RGRP+  ++ S +F  + F AASPKE
Sbjct: 417 VLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTIAFCAASPKE 476

Query: 447 ETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXX 506
           E VFTWLLAISGLS+LFTW +I +SH+RFRR++ VQG SL E+G++S  G++G+ YA   
Sbjct: 477 EQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGIYGSLYAATM 536

Query: 507 XXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVD 566
                  QFWVA++P+G N LDA NFF+NYLAMPIL+ LY GYK+  RDW+  IPA+ +D
Sbjct: 537 LILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKIRKRDWKFWIPAHRID 596

Query: 567 LVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFW 603
           LVSHRK+FD +I++ E  E +++ ++ S  ++  EF+
Sbjct: 597 LVSHRKVFDEDILKQEVAEIEQEKKNLSTGRKIQEFF 633

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/598 (48%), Positives = 389/598 (65%), Gaps = 21/598 (3%)

Query: 18  ESFDSVEVVKE-------TSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSG 70
           E F S+E   E        S     ++  ++HRF DSFKR +            +  + G
Sbjct: 33  EGFPSIEGEAEYYEKTFSQSDEEYAAKSSVWHRFKDSFKRADH----------INTNIHG 82

Query: 71  EDFERLAPDDS---SKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLI 127
                L P  S    K  +LK++IKPRHV+M+SLATGIGTG+LVGNGK+L  GGPA L I
Sbjct: 83  NAELELNPSQSLLPEKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTI 142

Query: 128 GYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPL 187
           GYAI+ + LY +IQ+A ELA+ Y +L+G FN YP+ LVD A  F+ + +YC+QWLC+ PL
Sbjct: 143 GYAIMGSCLYSIIQAAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPL 202

Query: 188 ELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXX 247
           E+++A++TIKYWN SINP+                            NTCK+LM      
Sbjct: 203 EVISAAITIKYWNTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFI 262

Query: 248 XXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTA 307
               +NCGGAG+  Y+G  YW+DPGAF G+ GI+RFK +V+ LV AAFA+G +E   LTA
Sbjct: 263 LGIIINCGGAGDSVYIGGKYWNDPGAFNGDTGISRFKAIVSTLVTAAFAFGASEAVALTA 322

Query: 308 AEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAI 367
           +EQ NP+K+I SA+K+++YRII IYL +  L+GFLVPYNSPEL+GSGS++ H+SP+VIA+
Sbjct: 323 SEQANPRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAV 382

Query: 368 ASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRC 427
           ASHGVKVVP                              E G+APK F YVDR+GRP+  
Sbjct: 383 ASHGVKVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYA 442

Query: 428 LLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLD 487
           ++V  + G +CFV+AS  EE+VFTWL+A+SGLS+LFTW +I +SHVRFR++M VQ RS+ 
Sbjct: 443 MIVGALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIG 502

Query: 488 ELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPV-GSNKLDANNFFENYLAMPILIGLY 546
           ELG++S  GVWG+YY          GQFWVA+ PV G++  DA NFF NYLAMP+ + LY
Sbjct: 503 ELGFRSQVGVWGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALY 562

Query: 547 LGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            G+K+W +DWR+ IPA+E+DL+SHRKIFD EI++ E  E K +++HAS   + + FWC
Sbjct: 563 FGFKIWKKDWRLYIPASEIDLISHRKIFDEEILKQEDEEYKIKMKHASIWVKLSNFWC 620

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/611 (46%), Positives = 389/611 (63%), Gaps = 18/611 (2%)

Query: 4   FEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHS 63
           F   + + P   +   F+ +   + T+  S       F  F+DSFKR ++E        S
Sbjct: 39  FAQTDSQLPSSTLSNDFEPISQDQNTTSHSRTRAK--FQNFIDSFKRADKEQ------PS 90

Query: 64  THERVSGEDFE-RLAPDD--------SSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNG 114
           T E    + FE  L P +        + K + LK +IKPRHV+MISL TGIGTGMLVGNG
Sbjct: 91  TLEHDLTKTFEGTLEPSEDGTQPAEVAGKSEELKHSIKPRHVIMISLGTGIGTGMLVGNG 150

Query: 115 KSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVS 174
            SL N GPA L+IGYAI+ + +YC+IQ+  E+A++Y+ L GGFN+YP+ L++ A  FSV+
Sbjct: 151 TSLANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVA 210

Query: 175 WVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXX-XXXXXXX 233
           WVYC+QWLC+ PLELVTASMTIKYW   ++PD                            
Sbjct: 211 WVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIILINVLGGAAGYAEAEFF 270

Query: 234 XNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNA 293
            N+CK+LM          + CGGAG+DGY+G  YWHDPGAFRG + I+RFKG+V+ LVNA
Sbjct: 271 FNSCKILMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAFRGEHAIDRFKGVVSTLVNA 330

Query: 294 AFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGS 353
           AFA+G +E   +TA+EQ NP+K+I SA+KK++YRI+ IYL +  ++GFLVP+NS +LLGS
Sbjct: 331 AFAFGLSEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGS 390

Query: 354 GSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPK 413
                 ASP+V+A+++HGV+VVPH                             EQG+APK
Sbjct: 391 SGGGVKASPYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPK 450

Query: 414 LFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHV 473
           +F YVDR GRP   + V+ +  ++ F A SPKE+ VF WLLAISGLS+LFTW +I LSH+
Sbjct: 451 IFKYVDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHI 510

Query: 474 RFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFF 533
           RFRR+M VQGRSL E+G++S  GVWG++YA          QFWVAI+P+G  +LD   FF
Sbjct: 511 RFRRAMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFF 570

Query: 534 ENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHA 593
           ENYLA PILI LY GYK++ +DWR+ I A ++DL  +R +FD E+++ E+ E KE++R+A
Sbjct: 571 ENYLAAPILIALYFGYKIYTKDWRLFIRAKDIDLDINRDVFDEELIRQEEEEYKEKMRNA 630

Query: 594 SWTKRAAEFWC 604
              ++  EFWC
Sbjct: 631 PIWQKIYEFWC 641

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/578 (49%), Positives = 369/578 (63%), Gaps = 17/578 (2%)

Query: 32  RSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNI 91
            S   +     RFVDSFKR E      D I+   E  + E    +A    S    LKQ I
Sbjct: 62  ESPAKKKSNLRRFVDSFKRAEHMIPADDKIN---EMTTAEPEAEMA----SVEDNLKQTI 114

Query: 92  KPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYT 151
           KPRHV+MISL TGIGTG+LVGNG +L   GPA L+ GYAI+ T +YC+IQSA E+A++Y+
Sbjct: 115 KPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYS 174

Query: 152 SLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASM-----TIKYWNDSINPD 206
            L+GGFNAYP +LV+  F     WV C   +    ++ ++  +       KYW   ++PD
Sbjct: 175 KLNGGFNAYPTMLVEPGF-----WVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTRVDPD 229

Query: 207 AXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSV 266
                                       N CKVLM          +N GGAGNDGYLG++
Sbjct: 230 VFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYLGNI 289

Query: 267 YWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 326
           YW +PGAFRG+ GI+ FKG+VA LV AAFA+GG EF  LTAAEQ NP+K+I SA+KK++Y
Sbjct: 290 YWRNPGAFRGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKVLY 349

Query: 327 RIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXX 386
           RI+ +YL +  L+GFLVP+ SPELLGSGSAAT ASP+VIA+ASHGV+VVPH         
Sbjct: 350 RIVLVYLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHFINAVILLS 409

Query: 387 XXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKE 446
                               +QG+APK F+YVDR GRP R ++VS +FG++ F A SPKE
Sbjct: 410 VLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIAFCATSPKE 469

Query: 447 ETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXX 506
             VFTWLLAISGLS++FTW SI LSH+RFR +M  QGRS+ E+G+++ TG+WG+YY+   
Sbjct: 470 TEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFL 529

Query: 507 XXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVD 566
                 GQFWVAI+P+G+ +L A NFFENYLAMPILIG Y GYK+W +DW + I A ++D
Sbjct: 530 MILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKKDWTLYIKAEDID 589

Query: 567 LVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           L+SHR+IFD E+++ E  E KE+L++    +R   FWC
Sbjct: 590 LISHRQIFDEELLKQEDYELKEKLKNGPVWRRIVAFWC 627

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/588 (49%), Positives = 374/588 (63%), Gaps = 28/588 (4%)

Query: 18  ESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLA 77
           ES+D   V    +  + G   GLF  FVDSFK+ +++             V G D     
Sbjct: 15  ESYD--RVTPAIALNANGGGRGLFRDFVDSFKKKQDD------------DVVGYD----- 55

Query: 78  PDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLY 137
            +++     +K+ IK RH+LMISL TGIGTG+LVGNG +L   GP  L+IGY + S MLY
Sbjct: 56  -EETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLY 114

Query: 138 CVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIK 197
           C+IQ+A EL I Y+ ++G + AY +LLVD A  FSVSWVYC+QW+ + PL+LVTA++TIK
Sbjct: 115 CIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIK 174

Query: 198 YWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGA 257
           YW D+ NPD                            NTCKVLM          +NCGGA
Sbjct: 175 YWTDT-NPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGA 233

Query: 258 GNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317
           GNDGY+G+ YWH PGAF        FKG+  V   AAFAYGG E  VLTA+EQ+NP+KSI
Sbjct: 234 GNDGYIGARYWHTPGAFS-----TGFKGVCYVFCYAAFAYGGIEVMVLTASEQENPRKSI 288

Query: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377
            SA KK++YRI+ IY++T  ++ FLVPY++PEL  +GS A+ ASPFVIAIASHG+ VVPH
Sbjct: 289 PSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGS-ASRASPFVIAIASHGISVVPH 347

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437
                                        EQG+APK+FNYVDR+GRP+ C LV+   GLL
Sbjct: 348 IINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLL 407

Query: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497
            F+AAS  EE VF+WLLAISGLS+LF W SI LSHVRFR +M  QGRSL E+GY+S TG 
Sbjct: 408 AFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGY 467

Query: 498 WGAYYAXXXXXXXXXGQFWVAISPVGS-NKLDANNFFENYLAMPILIGLYLGYKLWYRDW 556
           WG+++A          QFWVAI+P+G+  KL A +FF++YLA P+LI +Y GYK++Y+DW
Sbjct: 468 WGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDW 527

Query: 557 RVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           R+ IPA EVDL SHRKIFD + ++ E L+ KE++R AS   +   FWC
Sbjct: 528 RLCIPATEVDLNSHRKIFDEDELKQEDLDWKEKMRTASIWVKIYHFWC 575

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/628 (46%), Positives = 390/628 (62%), Gaps = 34/628 (5%)

Query: 4   FEMKNI-KSPE------DGVVESFDSVEVVKETSPRSE----------GSRDGLFHRFVD 46
           FEM +I K PE      D +VE F S       S              G       +FVD
Sbjct: 17  FEMVDIVKKPEIKNSEQDNIVEFFTSSNTAHSASSSESYSRSPDKPLFGITKPHVRKFVD 76

Query: 47  SFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSK---------HKTLKQNIKPRHVL 97
           SF+R E++         T E +  E    L+P  S +            L+++I+PRHVL
Sbjct: 77  SFRRAEDD-------EETAEDLENELVSTLSPSKSKQLHGQKNGDDDAHLQKSIRPRHVL 129

Query: 98  MISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGF 157
           M+SL TGIGTG+LVGNG +L   GP +L+IGY I+ + LYC+IQ+  E+A+ Y+ L G F
Sbjct: 130 MMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNF 189

Query: 158 NAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXX 217
           NAYP+ LVD+  AF V+WVYCLQWLC++PLELVTASMTI YW   +N D           
Sbjct: 190 NAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFVVIFFVLIT 249

Query: 218 XXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGN 277
                            N+CKVLM          +N GGAGNDGY+G+ YWH+PGAFRG+
Sbjct: 250 LINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGD 309

Query: 278 NGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAA 337
             I+RFK +++    AAFA+G +EF  + A+EQ NP+++I SA+K ++YRI+ I+L +  
Sbjct: 310 KSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSIT 369

Query: 338 LLGFLVPYNSPELLGSGSAATHAS-PFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXX 396
           L+GFLVPY+S ELLGSG +A+  + P+VIA+ASHGV+VVPH                   
Sbjct: 370 LVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAYY 429

Query: 397 XXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAI 456
                     +QG+APK F Y+DR GRP R +LV+ +FG++ F + S KEE VF WLL+I
Sbjct: 430 SSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSI 489

Query: 457 SGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFW 516
           +GLS+LFTW +I LSH+RFRR+M VQGRS+DE+G++S  GVWG+ YA          +FW
Sbjct: 490 AGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMMILALIAEFW 549

Query: 517 VAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDA 576
           V+I+P+G + LDA NFFENYLAMPILI LY GYK++ +DW++ I A ++DL+SHR IFD 
Sbjct: 550 VSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDLISHRTIFDG 609

Query: 577 EIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           E+++ E+ E KE+LR+    KR   FWC
Sbjct: 610 ELVRQEEEEYKEKLRNGPKWKRVVAFWC 637

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/588 (47%), Positives = 372/588 (63%), Gaps = 8/588 (1%)

Query: 18  ESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLA 77
            +F S    K  S +  GS D L HRF DSFKR E     G    +     +  D E   
Sbjct: 29  NNFQSSSSEKTYSKQKSGS-DKLIHRFADSFKRAE-----GSTTRTKQINENTSDLEDGV 82

Query: 78  PDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLY 137
              +S  K LK+++K RHV+M+SL TGIGTG+LV N K LH GGPA+L+IGY +VS + Y
Sbjct: 83  ESITSDSK-LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTY 141

Query: 138 CVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIK 197
            +IQ+A E+A+ Y +L   FNAY ++ + K+F F+  W+YC QWL +LPLEL+TASMTI+
Sbjct: 142 FMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQ 201

Query: 198 YWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGA 257
           +WND INPD                            N CK+LM          +NCGGA
Sbjct: 202 FWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGA 261

Query: 258 GNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317
           GNDGY+G+ YWH+PGAF G+  I RFK +  +LV A F++GG E   L+  EQ NP+KS 
Sbjct: 262 GNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKST 321

Query: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377
             A+K+ +YRI+ IYL+T  L+GF VPYN  +L+G+G +ATHASP+V+A + HGVK+VPH
Sbjct: 322 PVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPH 381

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437
                                        +QG+APK  +YVDR GRP+R L+V CVFG++
Sbjct: 382 IINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVI 441

Query: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497
            FVAAS KEE VFTWL AI+GLSELFTW SI LSH+RFR++M VQGRSLDELGY++ TG+
Sbjct: 442 AFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGI 501

Query: 498 WGAYYAXXXXXXXXXGQFWVAISPVGS-NKLDANNFFENYLAMPILIGLYLGYKLWYRDW 556
           WG+ Y           QFWVA++P+G+  K DA +FF+NYLA PI +  Y GY ++ RD+
Sbjct: 502 WGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDF 561

Query: 557 RVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            ++ P +++DL  HR+I+D E+M+ E  E KE+LR+ S  ++A  FWC
Sbjct: 562 TLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMSLMRKAYHFWC 609

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/594 (46%), Positives = 376/594 (63%), Gaps = 9/594 (1%)

Query: 20  FDSVEVVKETSPR------SEGSRDGLFHRFVDSFKRPEEEYNGGDGIHS--THERVSGE 71
           F+ V+V+   S        +  +    F  F+DSFK PE  ++    ++   +H+ V  +
Sbjct: 24  FNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDD 83

Query: 72  DFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAI 131
               ++  D   ++ LK+ I+PRHV+M+SL TGIGTG+LVGNG +L + GPA L+IGYAI
Sbjct: 84  AKVEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAI 143

Query: 132 VSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVT 191
           +++ +YC+IQ+  E+A+ Y +L GGFNAYP  LVD A  FS++W+YC+QW C+ PLELVT
Sbjct: 144 MASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVT 203

Query: 192 ASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXX-XXXXXXXXNTCKVLMXXXXXXXXX 250
           ASMTI+YW   +N D                             N+CK+LM         
Sbjct: 204 ASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGI 263

Query: 251 XVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQ 310
            + CGGAGNDG++G  YW DPGAFRG++G NRFKG+V+ LV AAF++G  EF  +TA+EQ
Sbjct: 264 VIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQ 323

Query: 311 QNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASH 370
            NP+K+I SA+KK++YR + IYL +  ++G LVPY+S ELLGS SAAT ASP+V+A+++H
Sbjct: 324 SNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTH 383

Query: 371 GVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLV 430
           GV+VVPH                              QG+APK+F +VDR GRP    LV
Sbjct: 384 GVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLV 443

Query: 431 SCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELG 490
             V  ++ F A S KE  VF WLLAISGLS++FTW  I LSH+RFRR+M VQGRS+DE+G
Sbjct: 444 GAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIG 503

Query: 491 YQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYK 550
           Y+S  GVWG+ YA         GQ WV I PVG    D   FF++YLAMP+ I LYLGYK
Sbjct: 504 YKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563

Query: 551 LWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           +W RDWR+ I A ++DL+SHR I D EI++ E+ E +E+LR+    +R  +FWC
Sbjct: 564 IWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/642 (45%), Positives = 390/642 (60%), Gaps = 41/642 (6%)

Query: 4   FEMKNIKSPED-----GVVESFDSVEVVKETSPRSEGS------------------RDGL 40
           FEMK++K  E       + E  + +E   E S     S                  +   
Sbjct: 38  FEMKDVKPKEREIGTASITEQENIIEYFGEKSNDDTSSSPVTRQYVSGADFEEHTTKPSR 97

Query: 41  FHRFVDSFKRPEEE----YNGGDGIHSTHER--VSGED--------FERLAPDDSSKHKT 86
              F+DSFKR E+      N G    S  E   +  ED              +D+SK   
Sbjct: 98  IRNFMDSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHDAQINDNSKSDE 157

Query: 87  LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASEL 146
           LK+ IKPRHVLMISL TGIGTG+LVG G SL   GPA L+IG+ I+ + LYC+IQ+  EL
Sbjct: 158 LKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGEL 217

Query: 147 AIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPD 206
           A+ Y+ L GGFNAYP+ LVD+AF F+V+W+Y +QWLC+ PLELVTASMTIKYW   ++PD
Sbjct: 218 AVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDPD 277

Query: 207 AXXXXXXXXXXXXXXXXXXX-XXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGS 265
                                        N+CK++M          V CGGAG DGY+G+
Sbjct: 278 IFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGA 337

Query: 266 VYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLV 325
            YWHDPGA RG+  I RFKG +A LVNAAFA+G +EF  +TA+EQ NP+K+I SA+KK++
Sbjct: 338 KYWHDPGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMI 397

Query: 326 YRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXX 385
           YRI+ ++L +  ++GFLVPYNS +LLGS  +   ASP+V+AI++HGV+VVPH        
Sbjct: 398 YRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFINAVILI 457

Query: 386 XXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPK 445
                                EQG+APK+++Y+DR GRP+  +  + +FG++ F A SPK
Sbjct: 458 SVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSPK 517

Query: 446 EETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXX 505
           E+ VF WLLAISGLS+LFTW +I +SH+RFRR+M VQGRS+ ELG++S  G +G+ YA  
Sbjct: 518 EDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAI 577

Query: 506 XXXXXXXGQFWVAISPVGSN---KLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPA 562
                   QFWVA+ P+ ++   KLDA NFFENYLAMPIL+  Y GYK+W +DW++ I A
Sbjct: 578 MMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWKLFIRA 637

Query: 563 NEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
             +DL+SHR IFD E+++ E+ E +E+LR     +R  +FWC
Sbjct: 638 KNIDLISHRNIFDEELIKQEEDEYRERLRTGPKWRRVYDFWC 679

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/575 (49%), Positives = 378/575 (65%), Gaps = 5/575 (0%)

Query: 35  GSRDGLFHRFVDSFKRPEEEYNGGDGIHS----THERVSGEDFER-LAPDDSSKHKTLKQ 89
           G ++    RF+DSFKR EE       + +    T   +S    E  +A     +   L++
Sbjct: 70  GVKEPHLKRFIDSFKRAEEGTEETKHMETELTTTLSPLSAAIKEHDVAITSKEEDAHLRK 129

Query: 90  NIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAII 149
           +I+PRHVLM SLATG+GTG+LVGNG +LH  GPA L+IGYAI+ T LYC+IQ+  E+A+ 
Sbjct: 130 SIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVS 189

Query: 150 YTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXX 209
           Y++L G FNAYP  LVD+ F F+V+WVYC+QWLC++PLELVTASMTI YW   +N D   
Sbjct: 190 YSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDIFV 249

Query: 210 XXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWH 269
                                    NTCKVLM          +N GGAG  GY+G+ YWH
Sbjct: 250 VIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGYIGAKYWH 309

Query: 270 DPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRII 329
           DPGAFRG+  I+RFK ++A    AAFA+G +EF  + A+EQ NP+++I SA+K ++YRI+
Sbjct: 310 DPGAFRGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKIMIYRIL 369

Query: 330 GIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXX 389
            I+L + AL+GFLVPY+S EL+GSGS  T ASP+V+AI+SHGV+VVPH            
Sbjct: 370 FIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLS 429

Query: 390 XXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETV 449
                            +QG+AP+ FNY+DR GRP R +++S +FG++ F A S KEE V
Sbjct: 430 VSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEV 489

Query: 450 FTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXX 509
           FTWLLAISGLS++FTW +I LSH+RFRR+M VQGRS+ ELG++S  GVWG+ YA      
Sbjct: 490 FTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFL 549

Query: 510 XXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVS 569
               +FWV+I+P+G + LDA +FFENYLAMPILI  Y GYK++ RDW++ I A  +DL++
Sbjct: 550 ALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLIT 609

Query: 570 HRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           HR IFDAEI++ E+ E +EQL++    KR   FWC
Sbjct: 610 HRNIFDAEIIRQEEEEYREQLKNGPTWKRLVHFWC 644

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/612 (46%), Positives = 389/612 (63%), Gaps = 16/612 (2%)

Query: 8   NIKSPEDGVVESFDSVE--------------VVKETSPRSEGSRDGLFHRFVDSFKRPEE 53
           N+ + ++  +E F++++                  TS R      G F  F+DSFK P E
Sbjct: 24  NVSTEQENEIEYFETLKGKNAATTREEEYDFTTDSTSGRKRHGVKGYFRDFIDSFK-PAE 82

Query: 54  EYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGN 113
                  +      V+ E  E+   D+      LK+ I+PRHV++ISL TGIGTG+LVGN
Sbjct: 83  NPQPHTNLDMELVGVTSETIEQHKKDEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGN 142

Query: 114 GKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSV 173
           G +L   GPA L+IGY I+ +++YC+IQ+  E+A+ Y +L GGFNAYP  L+D  F+F+ 
Sbjct: 143 GATLAQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFAT 202

Query: 174 SWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXX-XXXXXX 232
           +WVYCLQWLC+ PLELVTASMTIKYW   ++PD                           
Sbjct: 203 AWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVFILGINILGGARGYAEAEF 262

Query: 233 XXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVN 292
             N+CK+LM          + CGGAG DGY+G  YWHDPGAFRG   ++RFKG+VA LV 
Sbjct: 263 IFNSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAFRGERAVDRFKGVVATLVT 322

Query: 293 AAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLG 352
           AAF++G +EF  +TA+EQ NP+++I SA+KK++YR + IYL +  LLGFLVPYNS +LLG
Sbjct: 323 AAFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLG 382

Query: 353 SGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAP 412
           + S    ASP+V+A+A+HGV+VVPH                             +QGFAP
Sbjct: 383 AQSNGIKASPYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAP 442

Query: 413 KLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSH 472
           K+F+YVDR GRP   ++V+ +F ++ F A SPKE+ VFTWLLA+SGLS++FTW SI LSH
Sbjct: 443 KIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSH 502

Query: 473 VRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNF 532
           +RFRR+M VQGRSL E G+ S  G++G+ Y+         GQFWVA+ PVGS K+DAN+F
Sbjct: 503 LRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALILVGQFWVALKPVGSKKVDANSF 562

Query: 533 FENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRH 592
           FENYLA PI I LY+GYK + +DWR+ I + ++DLV+HR+I+D +I++ E+ EE E+L++
Sbjct: 563 FENYLAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYDEDILRQEREEETERLKN 622

Query: 593 ASWTKRAAEFWC 604
             + KRA  FWC
Sbjct: 623 GPYWKRAYSFWC 634

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/533 (50%), Positives = 349/533 (65%), Gaps = 2/533 (0%)

Query: 74  ERLAPDDSSK--HKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAI 131
           E L P    +  +  L+Q IKPRHV+M+SL TGIGTG+LVGN K L   GPA L+IGY I
Sbjct: 144 EELLPGQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGI 203

Query: 132 VSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVT 191
           + T +YC+IQ+  E+A+ Y +L+G FN +P+ LVD  F F+V+WVYC+QWLC+ PLELVT
Sbjct: 204 MGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 263

Query: 192 ASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXX 251
           ASMTI+YW   ++PD                            NTCKVLM          
Sbjct: 264 ASMTIQYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAIC 323

Query: 252 VNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQ 311
           ++ G AG DGY+G+ YW+DPGAFRG   I RFKG++   V AAFA+G  EF  LTAAEQ 
Sbjct: 324 IDTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQS 383

Query: 312 NPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHG 371
           NP+K+I SA+KK++YR++ I+L T  L+GFLVPY+S +LLGSG +AT ASP+V+AI+ HG
Sbjct: 384 NPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHG 443

Query: 372 VKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVS 431
           V+V  H                             +QG APK+F+YVDR GRP+  +  S
Sbjct: 444 VRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCS 503

Query: 432 CVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGY 491
            V  ++ F A SPKE  VFTWL+AI+GLS+LFTWF+I LSH+RFRR+M VQGRSL E+GY
Sbjct: 504 AVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGY 563

Query: 492 QSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKL 551
            S TG+ G+ YA          QFWVA+ P+G++  DAN+FF NYLAMPILI  Y GYK+
Sbjct: 564 LSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKI 623

Query: 552 WYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           W RDWR+ I A ++DL+SHR I+D E+++ E  E +E+LR+    KR A FWC
Sbjct: 624 WKRDWRLFIRAKDIDLISHRTIYDEELLRQEDEEYREKLRNGPKWKRVAAFWC 676

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/633 (47%), Positives = 397/633 (62%), Gaps = 33/633 (5%)

Query: 4   FEMKNIKSPEDGV-VESFDSVEVVKETSPRSEGSRDGLFHR-----------------FV 45
           +EMKN+K  E  +  E  + VE  + T  +  G  D    +                 F+
Sbjct: 36  YEMKNLKPKEKEISTEQENEVEYFENTKIQEGGIDDSTITQTNDYEQNITKPTSRVRNFI 95

Query: 46  DSFKRPEEEYNGGD----GIHSTHERVSGE-------DFERLAPDDSSKHKT--LKQNIK 92
           DSFK P E  N  +     I S    +  E       D +R+ P    ++K+  LK+ IK
Sbjct: 96  DSFK-PAEVKNSPEKDTASITSNEMMIDEEILSLSNLDGQRVPPPRKIENKSDELKKTIK 154

Query: 93  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTS 152
           PRHVLMISL TGIGTG+LVG G SL   GPA LL+G+ I+ T LYC+IQ+  E+A+ Y+ 
Sbjct: 155 PRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSD 214

Query: 153 LSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXX 212
           L GGFNAYP+ LVD AF FSV+WVY LQWLC+ PLELVTASMTIKYW   ++PD      
Sbjct: 215 LVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIF 274

Query: 213 XXXXXXXXXXXXXX-XXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDP 271
                                  N+CK+LM          + CGGAGNDGY+G  YWH+P
Sbjct: 275 YVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEP 334

Query: 272 GAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGI 331
           GAFRG + I+RFKG++A LVNAAFA+G +EF  +TA+EQ NP+K+I SA+KK++YRI+ +
Sbjct: 335 GAFRGEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCM 394

Query: 332 YLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXX 391
           +L +  ++GFLVPY+S +LLGS      ASP+V+A+++HGVKVVPH              
Sbjct: 395 FLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVPHFINAVILISVLSVA 454

Query: 392 XXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFT 451
                          EQG+APK+F Y+DR GRP+  + ++ +FG++ F A SPKE+ VF 
Sbjct: 455 NSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVFV 514

Query: 452 WLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXX 511
           WLLAISGLS+LFTW +I +SHVRFRR+M VQG+S+ ELG++S  G WG+ YA        
Sbjct: 515 WLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCIL 574

Query: 512 XGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHR 571
             QFWVAI+P+G  KLDA NFFENYLAMPIL+ LY GYK++ ++W + I A ++DLVSHR
Sbjct: 575 IAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIFIRAKDIDLVSHR 634

Query: 572 KIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            IFD EI++ E+ E +E+LR+    +R  +FWC
Sbjct: 635 NIFDEEIIKQEEEEYREKLRNGPMWRRVYDFWC 667

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/608 (45%), Positives = 379/608 (62%), Gaps = 27/608 (4%)

Query: 5   EMKNIKSPEDGVVESFDSVEVVKETSPRS------EGSRDGLFHRFVDSFKRPEEEYNGG 58
           E+K+IKS   G V + ++ E  ++TS +       EG  D  F RF+ SFKR        
Sbjct: 21  ELKDIKS---GKVVTTETTEFFEKTSAQKSDFEYLEGD-DTRFKRFLSSFKRAHGSGGTD 76

Query: 59  DGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLH 118
                                 ++KH+ LKQ IK RH++MISL TGIGTG+LVG+G +LH
Sbjct: 77  TEGGGGQ---------------NAKHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALH 121

Query: 119 NGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYC 178
           +GGPA   IG+ I+   +YCVIQ+A ELA+ YTSL+GGFNAYP+ L+D A  F+ +WVYC
Sbjct: 122 DGGPAGSAIGFLIMGLCVYCVIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYC 181

Query: 179 LQWLCILPLELVTASMTIKYW--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNT 236
           LQWLC+ PLELVTAS+TIK+W  + S+NPD                            N+
Sbjct: 182 LQWLCVFPLELVTASITIKFWPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNS 241

Query: 237 CKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFA 296
           CKVLM          +N G  G  GY+G  YW DPG+  G    + FKG+VA LVNAAF+
Sbjct: 242 CKVLMMIGFFIVGILINTGAVGTSGYIGGKYWRDPGSLGGRTHFDHFKGIVATLVNAAFS 301

Query: 297 YGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSA 356
            G +EF  LTAAEQ NP+KSI +A+KK++Y+I  ++L +  L+GFLVP +S EL+GS  +
Sbjct: 302 LGCSEFVALTAAEQANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDS 361

Query: 357 ATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFN 416
             H SP+VIA+  HGV VVP                              EQ +APK+F 
Sbjct: 362 DLHVSPYVIAVRMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFK 421

Query: 417 YVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFR 476
           Y+DR GRP+  +++S +FG +CFVAASPKEE VF WLLAISGLS+LFTW +I LSH+RFR
Sbjct: 422 YIDRAGRPLMAMIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFR 481

Query: 477 RSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENY 536
           R++ VQG S DELG+++ TG+ G+Y +         GQFWV++ P+G+ + DA +FF  Y
Sbjct: 482 RALAVQGYSTDELGFKAQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGY 541

Query: 537 LAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWT 596
           LAMP+ +  Y GYK+W +DWR+ I A+++DLVSHR+IFDA++++ E +E + +LR++S  
Sbjct: 542 LAMPMFLLFYFGYKIWNKDWRLFIRADQIDLVSHRRIFDADVLKQEDIEYRAKLRNSSIW 601

Query: 597 KRAAEFWC 604
            R A FWC
Sbjct: 602 HRIANFWC 609

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/595 (45%), Positives = 379/595 (63%), Gaps = 9/595 (1%)

Query: 13  EDGVVESFDSVEVVKETSPRSEGSRDGL--FHRFVDSFKRPEEEYNGGDGIHSTHERVSG 70
           +DG+  S +   +V   +  +E     +     FVDSFK+ ++  N  +   +    +  
Sbjct: 10  KDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKS 69

Query: 71  EDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYA 130
           + F      +   +  L++ I+PRHV+MISL TGIGTG+LVGNG +LHN GPA LLIGY 
Sbjct: 70  DQF------NDKLNNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYI 123

Query: 131 IVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELV 190
           I+++ +YC+IQ+  E+A+ Y +L GGFN YP+ LVD A+ F+V+WVYC+QWLC+ PLELV
Sbjct: 124 IMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELV 183

Query: 191 TASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXX-XXXXXXXXNTCKVLMXXXXXXXX 249
           TASMTIKYWN+ ++PD                             N CK+LM        
Sbjct: 184 TASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILG 243

Query: 250 XXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309
             + CGGAG  GY+G  YW++PGAFRG+    RFKG+V+ LV AAF++G  EF  +TA+E
Sbjct: 244 IILICGGAGTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASE 303

Query: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIAS 369
           Q NP+K+I SA+KK++YR + IY+ +  ++GFLVPYNSPELLGS S+ T ASP+VIA+AS
Sbjct: 304 QSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVAS 363

Query: 370 HGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLL 429
           HG+++ PH                             +QG+APK+F Y+DR+GRP+  ++
Sbjct: 364 HGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGII 423

Query: 430 VSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDEL 489
            + +   + F A+SPKE  VF+WLLAISGLS++FTW +I LSH+RFRR+M +QGRSL+EL
Sbjct: 424 AASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNEL 483

Query: 490 GYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGY 549
           GY+S  GVWG+ YA         GQFWVA+ P+ SN  +  NFF+ YLAMPIL+  Y GY
Sbjct: 484 GYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGY 543

Query: 550 KLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           K W +DW + I A ++DL+SHR I+D ++++ E+ + KE L++ S   +   FWC
Sbjct: 544 KTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/582 (46%), Positives = 367/582 (63%), Gaps = 11/582 (1%)

Query: 24  EVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSK 83
           ++  E  P+    R+ L HRF DSFKR E        I   +E  S  D E      +S 
Sbjct: 38  KIYSEQKPK----RNRLIHRFTDSFKRAE---GSTTKIKPINENTS--DLEDGIQSFTSD 88

Query: 84  HKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSA 143
            K LK+++K RHV+M+SL TGIGTG+LV N K LH GGPA+L+IGY +VS + Y +IQ+A
Sbjct: 89  SK-LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAA 147

Query: 144 SELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSI 203
            E+A+ Y +L   FNAY ++ + K F F+  W+YC QW  +LPLEL+TASMTI++WND I
Sbjct: 148 GEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDKI 207

Query: 204 NPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYL 263
           NPD                            N CK+LM          +NCGGAGNDGY+
Sbjct: 208 NPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYI 267

Query: 264 GSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKK 323
           G  YWH PGAF G+  I RFK +  +LV A F++GG E  VL+  EQ NP+KS   A+K+
Sbjct: 268 GGAYWHKPGAFAGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTPVAAKR 327

Query: 324 LVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXX 383
            +YRI+ IYL+T  L+GF VPYN  +LLG+G +ATHASP+V+A + HGV++VPH      
Sbjct: 328 SIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHGVRIVPHIINAVI 387

Query: 384 XXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAAS 443
                                  +QG+APK  +YVDR GRP+R L+V CV G++ FVAAS
Sbjct: 388 LISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIAFVAAS 447

Query: 444 PKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYA 503
            KEE VFTWL AI+GLSELFTW SI LSH+RFR++M VQGRSL+ELGY++ TG+WG+ Y 
Sbjct: 448 SKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGIWGSIYG 507

Query: 504 XXXXXXXXXGQFWVAISPVGS-NKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPA 562
                     QFWVA++P+G+  K +A  FFE+YLA PI +  Y+GY ++ RD+ ++ P 
Sbjct: 508 SFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIYNRDFTLLNPL 567

Query: 563 NEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           +++DL  HR+++D E+M+ E  E KE++++ S+  +A  FWC
Sbjct: 568 DKIDLDFHRRVYDPELMRQEDEENKEKIKNMSFLSKAHHFWC 609

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/579 (46%), Positives = 367/579 (63%), Gaps = 13/579 (2%)

Query: 27  KETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKT 86
           +E    SE SR+GL HRFVDSFKR E ++   D            D E       S ++ 
Sbjct: 38  QEVKEHSEESRNGLVHRFVDSFKRAESQHLEDD-----------NDLEDGTRSMKSNNR- 85

Query: 87  LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASEL 146
           LK+++K RHV+M+SL TGIGTG+LV N K L   GP SL+IGY +VS + Y ++Q+A E+
Sbjct: 86  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEM 145

Query: 147 AIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPD 206
            + Y +L G FNAY ++ + K+F F+ +W++C+QWL +LPLEL+T+SMTIKYWND IN D
Sbjct: 146 GVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKINSD 205

Query: 207 AXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSV 266
                                       ++CK+LM          +NCGGAG DGY+G  
Sbjct: 206 VFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGK 265

Query: 267 YWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 326
           YW DPG+F   NG  RFKG+  +LV A F++GG E  VL+  EQ NP+KS   A+K+ VY
Sbjct: 266 YWRDPGSFAEGNGATRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVY 325

Query: 327 RIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXX 386
           RI+ IYL+T  L+GF VP+N+ +L+GSGSAATHASP+V+A + H V+VVPH         
Sbjct: 326 RILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVVPHIINAVILIS 385

Query: 387 XXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKE 446
                               +QG+APK  +Y+DR GRP+R L V C+ G++ FVA SP+E
Sbjct: 386 VISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQE 445

Query: 447 ETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXX 506
           E  FTWL AI+GLSELFTW  I LSH+RFR++M VQGRSLDE+GY++ TG+WG+YY    
Sbjct: 446 EQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFF 505

Query: 507 XXXXXXGQFWVAISPVGS-NKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEV 565
                  QFWVA+SP+G+  K +A  FFE+YLA P+ + +YLGY L+ RD+  + P +++
Sbjct: 506 NILVFMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKI 565

Query: 566 DLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           DL  HR+++D EI++ E  E KE+L+++S+  R   FWC
Sbjct: 566 DLDYHRRVYDPEIIRQENEENKERLKNSSFFFRIYNFWC 604

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/603 (45%), Positives = 376/603 (62%), Gaps = 24/603 (3%)

Query: 6   MKNIKSPEDGVVESFDSVEVVKETSPRSEGSR--DGLFHRFVDSFKRPEEEYNGGDGIHS 63
           M +  S  +   E   +  +++ +SP S+      G  +RF++SF+R  E  +       
Sbjct: 1   MSSDMSTANSKKEEESTYAIIQTSSPCSKKYSYISGQVNRFINSFRRKGESED------- 53

Query: 64  THERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPA 123
             + + GE+      ++      +K++IK RH+LMISL TGIGTG+LVGNGK+L   GPA
Sbjct: 54  -VKELKGEN------EECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPA 106

Query: 124 SLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLC 183
            L+IGYA+ S MLYC+IQ+A EL I Y+ ++G + AY +LLVD A  FSVSWVYC+QW+ 
Sbjct: 107 GLVIGYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMT 166

Query: 184 ILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXX 243
           +LPL+LVTA+MT++YW ++ NPD                            N CKVLM  
Sbjct: 167 VLPLQLVTAAMTVRYWTNA-NPDIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIA 225

Query: 244 XXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFS 303
                   +NCGGAG  GY+G+ YWH PG+F        FKG+  V   AAF+YGG E  
Sbjct: 226 GFVILGIAINCGGAGTSGYIGAKYWHSPGSFAAG-----FKGVCYVFCYAAFSYGGIEVM 280

Query: 304 VLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLG-SGSAATHASP 362
           VLTA+EQ+NP+KSI +A KK++YRI+ IY++T  ++ FLVPYNS EL+G SG +A+HASP
Sbjct: 281 VLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASP 340

Query: 363 FVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRG 422
            VIA+ASHGVK+VPH                             EQG+APK  NYVDR+G
Sbjct: 341 LVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQG 400

Query: 423 RPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQ 482
           RP+ C  ++ +  L+ FVAAS  EE +F WLLAISGLS++F W SI LSHVRFR +M  Q
Sbjct: 401 RPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQ 460

Query: 483 GRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPI 541
           G SL ++GY+S TG WG+++A          QFWVAI+P+G   +L+A  FF+NYLA PI
Sbjct: 461 GLSLGQIGYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPI 520

Query: 542 LIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAE 601
           L+G Y GYK++++DWR+ IPA+EVDL SHR I D EI++ E  E  E++ ++S   R   
Sbjct: 521 LLGAYFGYKVYHKDWRLCIPASEVDLSSHRNISDEEILRQEDYEWNEKMSNSSIWVRLCH 580

Query: 602 FWC 604
           FWC
Sbjct: 581 FWC 583

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/600 (46%), Positives = 368/600 (61%), Gaps = 29/600 (4%)

Query: 31  PRSEGSRDGLFHRFVDSFKRPE-------------------EEYNGG--DGIHSTHERVS 69
           P+ +  R   F  ++DSFKR E                   +E++    +   + H R  
Sbjct: 71  PQVKNER---FRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDD 127

Query: 70  GEDFERLAPD-----DSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPAS 124
             D+  +  D        ++  LKQ IKPRHV+M+SL TGIGTG+LVGNG  L   GPA 
Sbjct: 128 ELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAP 187

Query: 125 LLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCI 184
           L+IGY I+ T LYC+IQ+  ELA+ Y+ ++G FN +P+ LVD  F F+V+WVYC+QWLC+
Sbjct: 188 LVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCV 247

Query: 185 LPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXX 244
            PLELVT+SMTIKYW   ++PD                            N CKV+M   
Sbjct: 248 CPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIG 307

Query: 245 XXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSV 304
                  +N G AG DGY+G+ YW+DPGAFRG   I RFKG++   V AAFA+G  EF  
Sbjct: 308 FFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFVTAAFAFGATEFIA 367

Query: 305 LTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFV 364
           LTAAEQ NP+K+I SA+KK+ YRI+ I+L +  L+GFLVPYNS +L+GS S    ASP+V
Sbjct: 368 LTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYV 427

Query: 365 IAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRP 424
           +A + HGV VV H                             + G+APK F+YVDR GRP
Sbjct: 428 LAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRP 487

Query: 425 VRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGR 484
           +R +L + +  ++ F A SPKE  VFTWLLAISGLS++FTWF+I +SH+RFRR M VQGR
Sbjct: 488 LRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGR 547

Query: 485 SLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIG 544
           SL ELG+++ TGV G+YYA          QFWVA+ P+ ++ LDA NFF+NYLAMPIL+ 
Sbjct: 548 SLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLA 607

Query: 545 LYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           LY+G+KLW RD+R+ I A  +DL+SHR IFD E+++ E  E KE+LR+    KR  +FWC
Sbjct: 608 LYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/572 (48%), Positives = 368/572 (64%), Gaps = 16/572 (2%)

Query: 35  GSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPR 94
           G+R+  + RF DSFKR + +         T   + G+D +      +   +TLK NIK R
Sbjct: 29  GNRNA-WTRFTDSFKRAQVD---------TAVDLEGKDADN---GLNKTQQTLKHNIKTR 75

Query: 95  HVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLS 154
           H+ MISL TGIGTG+LV +GK+LH GGPA L+IGY   STMLYCV+Q+  EL + Y +L 
Sbjct: 76  HLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLP 135

Query: 155 GGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXX 214
           G +NAYP  LVDK F F+V+ VY LQW  +LPLELVTASMT+KYW  S+NPD        
Sbjct: 136 GNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYV 195

Query: 215 XXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF 274
                               N+ KVL+          +   GA   GY+G  YWHDPGAF
Sbjct: 196 FLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTA-GASEQGYIGGQYWHDPGAF 254

Query: 275 RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLM 334
            G+  I+RFKG+ +V V AAFAYGG+EF  LTAAEQ NP++S+  A+K+ +YR++ ++L+
Sbjct: 255 GGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLL 314

Query: 335 TAALLGFLVPYNSPELLGS-GSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXX 393
              L+GFLVP+NS +LL + G + + ASPFVIA A HGV+VVPH                
Sbjct: 315 PVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNS 374

Query: 394 XXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWL 453
                        E G  PK+F YVDR+GRP+  L+   +FGL+ FVAAS +EE VFTWL
Sbjct: 375 AMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWL 434

Query: 454 LAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXG 513
            AI+GLS+LFTW +I++SHVRFRR+M VQGRSL ELGY++ TG  G+YYA          
Sbjct: 435 SAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIA 494

Query: 514 QFWVAISPVGSN-KLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRK 572
           QFW+AI+P+  + +LD   FF+NYLA P+L+  YLGYKLW RD+R++IP++EVDL+SHR+
Sbjct: 495 QFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQ 554

Query: 573 IFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           IFD E++  E+ E KE+LR+++  KR  +FWC
Sbjct: 555 IFDEEVLLQEEAERKERLRNSTLFKRLLDFWC 586

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/604 (45%), Positives = 372/604 (61%), Gaps = 20/604 (3%)

Query: 7   KNIKSPEDGVVES--FDSVEVVKETSPRSEGS---RDGLFHRFVDSFKRPEEEYNGGDGI 61
           KN  SPE   + S    +  V ++  P  + +       F+RFVDSFKR E  +NG D  
Sbjct: 6   KNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLE 65

Query: 62  HSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGG 121
             T+          +  DD+     LK+ +K RHV+M+SL TGIGTG+LV N K L+  G
Sbjct: 66  DGTNS---------IQSDDN-----LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAG 111

Query: 122 PASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQW 181
           PASL+IGY +VS + Y VIQ+A E+A+ Y +L GGFN Y ++ V K F F+  W++C+QW
Sbjct: 112 PASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQW 171

Query: 182 LCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLM 241
           L +LPLEL+TASMTIKYWND IN D                            N+CK+LM
Sbjct: 172 LTVLPLELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILM 231

Query: 242 XXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAE 301
                     VNCGGAG DGY+G  YW DPGAF  +N  +RFKG+  VLV A F+YGG E
Sbjct: 232 IGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVE 291

Query: 302 FSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHAS 361
              L+  EQ+NP++S  +A+K+ +YRI+ IYL+T  L+GF VP+NS +L+G+G +ATHAS
Sbjct: 292 LFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHAS 351

Query: 362 PFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRR 421
           P+V+A++ HGVKVVPH                             EQG+APK FNYVDR 
Sbjct: 352 PYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDRE 411

Query: 422 GRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIV 481
           GRP+R L++  +FG++ F A S +EE +FTWL AI+GLSELFTW SI LSHVRFR +M  
Sbjct: 412 GRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKA 471

Query: 482 QGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKL-DANNFFENYLAMP 540
           QG+SL+ELGY S TG+WG+ Y           QFWVA+SP GS  +  A  FFE+YLA P
Sbjct: 472 QGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFP 531

Query: 541 ILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAA 600
           + +  YLGY L+ RD+  +    ++DL +HR+++D E+++ E  E KE++R+  WT++  
Sbjct: 532 VWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLL 591

Query: 601 EFWC 604
            FWC
Sbjct: 592 NFWC 595

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/604 (45%), Positives = 368/604 (60%), Gaps = 12/604 (1%)

Query: 7   KNIKSPEDGVVESFDSVEVVKETSPRSEGS-----RDGLFHRFVDSFKRPEEEYNGGDGI 61
           K   SP+   + SF +V  ++ +S     S      + L HRFVDSFKR E     G   
Sbjct: 12  KKEASPDSISIRSFSAVNNLQSSSSEKNYSGQTTRNNKLIHRFVDSFKRAE-----GSTT 66

Query: 62  HSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGG 121
           H+     +  D E      +S  K LK+++K RHV+M++L TGIGTG+LV N K LH GG
Sbjct: 67  HTKQINENTSDLEGDVNSFTSDSK-LKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGG 125

Query: 122 PASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQW 181
           PA+L+IGY +VS + Y +IQ+A E+A+ Y +L   FNAY ++ + K F F+  WVYC QW
Sbjct: 126 PAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQW 185

Query: 182 LCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLM 241
           L +LPLEL+TA+MTIK+WND+INPD                            N CK+LM
Sbjct: 186 LTVLPLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILM 245

Query: 242 XXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAE 301
                     +NCGGAGNDGY+G  YW +PGAF G+    RFK +  +LV A F++GG E
Sbjct: 246 IAGFIILSVVINCGGAGNDGYIGGKYWRNPGAFAGDTSAGRFKNVCYILVTAYFSFGGME 305

Query: 302 FSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHAS 361
              L+  EQ NP+K+   A+K+ +YRI+ IYL+T  L+GF VPYN  +L+G+G +ATHAS
Sbjct: 306 LFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHAS 365

Query: 362 PFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRR 421
           P+V+A + HGVKVVPH                             +QG+ PK  +YVDR 
Sbjct: 366 PYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDRE 425

Query: 422 GRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIV 481
           GRP+  L+V  VFG++ FVAAS KEE VF WL AI+GLSELFTW SI LSH+RFR++M V
Sbjct: 426 GRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKV 485

Query: 482 QGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGS-NKLDANNFFENYLAMP 540
           QGRSLDELGY++ TG+WG+ Y           QFWVA++P+ +  K  A +FF++YLA P
Sbjct: 486 QGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAFP 545

Query: 541 ILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAA 600
           I I  YLGY ++ RD+  + P +++DL  HR I+D E+M+ E LE +E+ R  S  ++  
Sbjct: 546 IWIAFYLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLENEERKRDMSLMRKTY 605

Query: 601 EFWC 604
            FWC
Sbjct: 606 HFWC 609

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/605 (47%), Positives = 378/605 (62%), Gaps = 16/605 (2%)

Query: 5   EMKNIKSPEDGVVESFDSVEVVKETSPRSEGSR---DGLFHRFVDSFKRPEEEYNGGDGI 61
            + N K P      S  ++     ++  S+G R   +   H F +SFKR   +       
Sbjct: 8   NLSNEKLPATECGSSNSNLRESISSNDLSDGDRGFVNRKLHNFCNSFKRANSD------- 60

Query: 62  HSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGG 121
             T +  + +D E  + +    +   KQ++K RHV+M+SL TGIGTG+LV NGKSLH GG
Sbjct: 61  --TFD--ASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGG 116

Query: 122 PASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQW 181
           PA LLIGY++VS + Y ++Q+A E+A+ Y +L G FN Y ++ + K+F F+  W+YCLQW
Sbjct: 117 PAGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQW 176

Query: 182 LCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLM 241
           L +LPLEL+TAS+TIKYWN SINPDA                           +TCKV M
Sbjct: 177 LTVLPLELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSM 236

Query: 242 XXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAE 301
                     +NCGGAG  GY+G  YW +PGAF G + I  FKG+  VLV A F+YGG E
Sbjct: 237 IAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGGSPIGHFKGIAYVLVTAYFSYGGME 296

Query: 302 FSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLG-SGSAATHA 360
              LT  EQ NP+K++ SA+KK +YRI+ IY++T  L+GFLVPYNS EL+G SG +ATHA
Sbjct: 297 LFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHA 356

Query: 361 SPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDR 420
           SP+VIA+ASHGVKVVPH                             EQG+APK+F+YVDR
Sbjct: 357 SPYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDR 416

Query: 421 RGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMI 480
            GRP+  L+   +FGLL FVAAS KEE VFTWL AI+GLSELFTW +I LSHVRFR +M 
Sbjct: 417 AGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMK 476

Query: 481 VQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGS-NKLDANNFFENYLAM 539
            QG SL ELGY+S TG WG+ YA          QFWVA++P+G+  K DA  FF++YLA 
Sbjct: 477 YQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYLAF 536

Query: 540 PILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRA 599
           PI I  Y+GYK++ ++W++++P +E+DL SHR IFD  I+Q E  E KE+L+++ W  + 
Sbjct: 537 PIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDDEHKEKLKNSGWWVKM 596

Query: 600 AEFWC 604
           A FWC
Sbjct: 597 ANFWC 601

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/584 (44%), Positives = 367/584 (62%), Gaps = 13/584 (2%)

Query: 22  SVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDS 81
           +  +  E    SE SR+GL HRFVDSF+R E +            R+  ++         
Sbjct: 33  TASLTPEIKEHSEESRNGLVHRFVDSFRRAESQ------------RLEEDNDLEDGTKSM 80

Query: 82  SKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQ 141
             +  LK+++K RHV+M+SL TGIGTG+LV N K L   GP SL+IGY +VS + Y ++Q
Sbjct: 81  KSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQ 140

Query: 142 SASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWND 201
           +A E+ + Y +L G FNAY ++ + K+F F+ +W++C+QWL +LPLEL+T+SMT+KYWND
Sbjct: 141 AAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWND 200

Query: 202 SINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDG 261
           +IN D                            N+CK+LM          +NCGGAG DG
Sbjct: 201 TINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDG 260

Query: 262 YLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSAS 321
           Y+G  YW DPG+F   +G  RFKG+  +LV+A F++GG E  VL+  EQ NP+KS   A+
Sbjct: 261 YIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAA 320

Query: 322 KKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXX 381
           K+ VYRI+ IYL+T  L+GF VP+N+ +L+GSG +ATHASP+V+A + H V+V+PH    
Sbjct: 321 KRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINA 380

Query: 382 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVA 441
                                    +QG+APK  NY+DR GRP+R L+V  + G++ FVA
Sbjct: 381 VILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVA 440

Query: 442 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAY 501
            SP+EE  FTWL AI+GLSELFTW  I LSH+RFR++M VQGRSLDE+GY++ TG+WG+Y
Sbjct: 441 CSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSY 500

Query: 502 YAXXXXXXXXXGQFWVAISPVGS-NKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVII 560
           Y           QFWVA+SP+G+  K DA  FFE+YLA P+ I +Y+GY ++ RD+  + 
Sbjct: 501 YGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLN 560

Query: 561 PANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           P +++DL  HR+++D EIM+ E  E KE+L+++S   R  +FWC
Sbjct: 561 PLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSSIFVRVYKFWC 604

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/604 (44%), Positives = 370/604 (61%), Gaps = 13/604 (2%)

Query: 2   KGFEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGI 61
           K  E +   SP      +  +  +  E    SE SR+GL HRFVDSF+R E +       
Sbjct: 13  KNTEFEVTDSPLYNNFNTSTTASLSPEVKEHSEESRNGLVHRFVDSFRRAESQ------- 65

Query: 62  HSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGG 121
               E    ED  R  P  S+ H  LK+++K RHV+M+SL TGIGTG+LV N K L   G
Sbjct: 66  -CLEENNDLEDGTR--PMKSNNH--LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAG 120

Query: 122 PASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQW 181
           P SL+IGY +VS + Y ++Q+A E+ + Y +L G FNAY ++ + K+F F+ +W++C+QW
Sbjct: 121 PGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQW 180

Query: 182 LCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLM 241
           L +LPLEL+T+SMTIKYWNDSIN D                            N+CK+LM
Sbjct: 181 LTVLPLELITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILM 240

Query: 242 XXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAE 301
                     +NCGGAG DGY+G  YW DPG+F   +   RFKG+  +LV A F++GG E
Sbjct: 241 VAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFADGSNATRFKGICFILVTAYFSFGGIE 300

Query: 302 FSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHAS 361
             VL+  EQ N +KS   A+K+ VYRI+ IYL+T  L+GF VP+N+ +L+GSGSAATHAS
Sbjct: 301 LFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHAS 360

Query: 362 PFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRR 421
           P+V+A + H V+V+PH                             +QG+AP+  NY+DR 
Sbjct: 361 PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDRE 420

Query: 422 GRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIV 481
           GRP+R L V  + G++ FVA SP+EE  FTWL AI+GLSE+FTW  I LSH+RFR++M V
Sbjct: 421 GRPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKV 480

Query: 482 QGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGS-NKLDANNFFENYLAMP 540
           QGRSL ELGY++ TG+WG+YY           QFWVA+SP+G+  K D   FFE YLA P
Sbjct: 481 QGRSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAP 540

Query: 541 ILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAA 600
           + I +YLGY L+ +D+ ++ P +++DL  HR+++D EIM+ E  E KE+LR++S   R  
Sbjct: 541 LWIFMYLGYMLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENKEKLRNSSIFFRMY 600

Query: 601 EFWC 604
            FWC
Sbjct: 601 NFWC 604

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/604 (44%), Positives = 372/604 (61%), Gaps = 12/604 (1%)

Query: 7   KNIKSPEDGVVESF----DSVEVVKETSPRSEGSR-DGLFHRFVDSFKRPEEEYNGGDGI 61
           K   SPE   + SF    D     +E +   + S+ + L HR  +SFKR E     G   
Sbjct: 12  KKEASPESISIRSFSGGNDFQISSREKAYSGQPSKSEKLIHRLANSFKRAE-----GSIT 66

Query: 62  HSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGG 121
            +     +  D E      +S  K LK+++K RHV+M+SL TGIGTG+LV N K LH GG
Sbjct: 67  KTRQINENTSDLEDGIESITSDSK-LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGG 125

Query: 122 PASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQW 181
           PA+L+IGY +VS + Y +IQ+A E+A+ Y +L   FNAY ++ + K F F+  W+YC QW
Sbjct: 126 PAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQW 185

Query: 182 LCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLM 241
           L +LPLEL+TASMTI+YWND +NPD                            N CK+LM
Sbjct: 186 LTVLPLELITASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILM 245

Query: 242 XXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAE 301
                     +NCGGAG+DGY+G  YWH+PGAF G+  I RFK +  +LV   F++GG E
Sbjct: 246 IAGFIILSVVINCGGAGDDGYIGGAYWHNPGAFAGDTSIARFKNVCYILVTGYFSFGGME 305

Query: 302 FSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHAS 361
              L+  EQ NP+KS   A+K+ +YRI+ IYL+T  L+GF VPYN  +L+G+G +ATHAS
Sbjct: 306 LFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHAS 365

Query: 362 PFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRR 421
           P+V+A + HGVK+VPH                             +QG+APK  +YVDR 
Sbjct: 366 PYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDRE 425

Query: 422 GRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIV 481
           GRP+R L+V C+FG++ FVAAS KEE VFTWL AI+GLSELFTW SI LSH+RFR++M V
Sbjct: 426 GRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKV 485

Query: 482 QGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMP 540
           QGRSLDELGY++ TG+WG+ Y           QFWVA++P+G++ +    +FFE+YLA P
Sbjct: 486 QGRSLDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAP 545

Query: 541 ILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAA 600
           I +  + GY ++ RD+ ++ P +++DL  HR+I+D E+++ E  E +E+ ++ S  ++A 
Sbjct: 546 IWLTFFFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQENEEKTKNMSLMRKAY 605

Query: 601 EFWC 604
            FWC
Sbjct: 606 HFWC 609

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/618 (44%), Positives = 381/618 (61%), Gaps = 17/618 (2%)

Query: 1   MKGFEMKNIKSPEDGVVESFDSVEVVKETSPRSEGS------------RDGLFHRFVDSF 48
           +KG  +   +SP D  VE FD +   ++ +   EG             ++ LF  F+DSF
Sbjct: 15  VKGEAVSASRSPPDNEVEYFDKLGDARQYTSNLEGEGTPTEGVSRHRIKNPLFRNFIDSF 74

Query: 49  KRPEEEYNGGDGIHSTHERVSGE--DFERLAPDDSS--KHKTLKQNIKPRHVLMISLATG 104
           KR E      D  +     VS +  ++    P D    K + LK++I  RH++ +++ +G
Sbjct: 75  KRGETTARIADLENDLTTAVSPQLSNYHGSIPSDEVVIKKEELKRDINQRHMVFMAIGSG 134

Query: 105 IGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALL 164
           +GTG+LVGN  +L++ GPA LLIGYA++ T +YCVIQ+A EL + Y +L GGFNAYPA+L
Sbjct: 135 VGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQAAGELGVTYANLIGGFNAYPAIL 194

Query: 165 VDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXX 224
           V  +FAFSV W+Y LQWLC+ PLELVTAS+TIKYW   ++PD                  
Sbjct: 195 VAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTKVDPDVFVVIFYLLILLINFFGS 254

Query: 225 XXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFK 284
                     N  K+ M          V CGGAG+DGYLG  YWH+PGAFRG   I+ FK
Sbjct: 255 KGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGYLGGKYWHNPGAFRGEKAIDHFK 314

Query: 285 GLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVP 344
           G+ +V V +AFA+GG+EF  L+A+EQ NP+KSI SA+K ++YRII +YL +  +LGFLVP
Sbjct: 315 GVSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSAAKLILYRIIWVYLTSITILGFLVP 374

Query: 345 YNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXX 404
           ++SP+L  S S     SP+V+AIA HGVKVVPH                           
Sbjct: 375 WDSPQLQPS-SDGKKTSPYVVAIAMHGVKVVPHLINAVILMAVLSVSNSAFFYSSRLLLS 433

Query: 405 XXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFT 464
             ++G+APK F+YVDR+GRPVR +L+S +FG++CF A S KE  VF+WLLAISGLS +FT
Sbjct: 434 LSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFCATSKKETDVFSWLLAISGLSTIFT 493

Query: 465 WFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGS 524
           +FSI +SH+R R +M VQGRSL ELG++S  G +G++YA          +FWVA++P+G 
Sbjct: 494 YFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGSFYACLLLVLSLMAEFWVALAPIGE 553

Query: 525 NKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQL 584
            KLDA +FFENYLA PI I  Y GY +W +D+R+ I + ++DL   R++FD ++++ E  
Sbjct: 554 GKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDIDLDFKRQVFDEDLIKQEDE 613

Query: 585 EEKEQLRHASWTKRAAEF 602
           E  EQ+R+A   ++   F
Sbjct: 614 EYAEQMRNAPRWRKVIAF 631

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/563 (47%), Positives = 357/563 (63%), Gaps = 19/563 (3%)

Query: 44  FVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLAT 103
           F+DSFKR ++  +     H+  E+ +            + H+  K+ +K RHV+M+SL T
Sbjct: 67  FIDSFKRADDSPD-----HNDLEKTT------------TAHQEQKKTMKSRHVIMMSLGT 109

Query: 104 GIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPAL 163
           GIGTG+LV NGK L   GPASL+I Y +VS + Y +IQ+A E+A+ Y +L G FNAY + 
Sbjct: 110 GIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSF 169

Query: 164 LVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXX 223
            + K F F+ +W++C+QWL +LPLEL+TA+MTIKYWN SI+PD                 
Sbjct: 170 FISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFG 229

Query: 224 XXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRF 283
                      N CK+LM          VNCGGAG DGY+G  YWHDPGAF  +NG +RF
Sbjct: 230 VQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFASSNGASRF 289

Query: 284 KGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLV 343
           KG+   LVNA F+YGG E  VL+  +Q+NP+KS  +A+K  VYRI+ IYL+T  L+GF+V
Sbjct: 290 KGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVV 349

Query: 344 PYNSPELLG-SGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXX 402
           P+NS ELLG SG    HASP+V+A + HG+KVVPH                         
Sbjct: 350 PHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLL 409

Query: 403 XXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSEL 462
               +QG+AP+  +YVDRRGRP+  LL+S + G++ F A SP+EE VFTWL AISGLSEL
Sbjct: 410 SSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSEL 469

Query: 463 FTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPV 522
           FTW SI  SH+RFRR+M +Q +SLD LGY++ TG+WG+Y+           QFWVA+SP 
Sbjct: 470 FTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPP 529

Query: 523 GS-NKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQS 581
            S  K DAN+FF +YLAMPI +  Y GY  WY+D+ V+   N+VDL +HRK++D E ++ 
Sbjct: 530 NSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQ 589

Query: 582 EQLEEKEQLRHASWTKRAAEFWC 604
           E LE KE+LR++S+  +  EFWC
Sbjct: 590 EDLENKERLRNSSFLVKIYEFWC 612

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/578 (44%), Positives = 361/578 (62%), Gaps = 13/578 (2%)

Query: 28  ETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTL 87
           E    SE SR GL HRFVDSF+R E +            R+  ++           +  L
Sbjct: 39  EVKEHSEESRSGLVHRFVDSFRRAESQ------------RLEDDNDLEDGTRSMRSNNHL 86

Query: 88  KQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELA 147
           K+++K RHV+M+SL TGIGTG+LV N K L   GP SL+IGY +VS + Y ++Q+A E+ 
Sbjct: 87  KKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMG 146

Query: 148 IIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDA 207
           + Y +L G FNAY ++ V K+F F+ +W++C+QWL +LPLEL+T+SMTIKYWND+IN D 
Sbjct: 147 VTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDTINADV 206

Query: 208 XXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVY 267
                                      N+CK+LM          +NCGGAG DGY+G  Y
Sbjct: 207 FIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGYIGGEY 266

Query: 268 WHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYR 327
           W +PG+F   +   RFKG+  +LV A F++GG E  VL+  EQ NP+KS   A+K+ +YR
Sbjct: 267 WRNPGSFADGSSATRFKGICFILVTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYR 326

Query: 328 IIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXX 387
           I+ IYL+T  L+GF VP+++ +L+GSGS+ATHASP+V+A + HGVKV+PH          
Sbjct: 327 ILIIYLLTMILIGFNVPHDNDQLMGSGSSATHASPYVLAASIHGVKVIPHIINAVILISV 386

Query: 388 XXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEE 447
                              +QG+APK  NY+DR GRP+R L+V    GL+ FVA S +EE
Sbjct: 387 ISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEE 446

Query: 448 TVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXX 507
             FTWL AI+GLSE+FTW  I LSH+RFR++M VQGRSLDE+GY+S TG+WG+YY     
Sbjct: 447 QAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFN 506

Query: 508 XXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVD 566
                 QFWVA+SP GS+ K D  +FF++YLA P+ I +YLGY ++ +D+ ++ P +++D
Sbjct: 507 ILVFMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKID 566

Query: 567 LVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           L  HR+++D EIM+ E  E KE+LR++S   R    WC
Sbjct: 567 LDFHRRVYDPEIMRQEDEENKERLRNSSVFFRMYNMWC 604

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/603 (43%), Positives = 373/603 (61%), Gaps = 25/603 (4%)

Query: 11  SPEDGVVESFDSV----EVVKETSP----RSEGSRDGLFHRFVDSFKRPEEEYNGGDGIH 62
           SPE   +++FDS     E+ ++++P     S   R   F +FVDSF+R E+++       
Sbjct: 10  SPE---IKTFDSSVKLSEITEKSTPVFPLDSTLKRRTHFTKFVDSFRRAEDKH------- 59

Query: 63  STHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGP 122
                 +  D E  +   +S    +K+ +K RHV+M++L TGIGTG+LV NGK L   GP
Sbjct: 60  ------ADSDLEDGSKSITSDDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGP 113

Query: 123 ASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWL 182
           A L++GY +VS + Y +IQ+A E+A+ Y ++   FN Y ++ V K F F+  W++C+QWL
Sbjct: 114 APLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWL 173

Query: 183 CILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMX 242
            +LPLEL+TASMTIKYWND+INPD                            N+CK+LM 
Sbjct: 174 TVLPLELITASMTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMI 233

Query: 243 XXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEF 302
                    +NCGGAG DGY+G+ YW +PGAF   +   RFKG+  +LV   F+YGG E 
Sbjct: 234 AGFIILSIVINCGGAGRDGYIGNKYWINPGAFASESPAARFKGVAYILVTGYFSYGGTEL 293

Query: 303 SVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASP 362
             L+  EQ+NP+KS  +A+K+ +YRI+ IYL+T  L+GF VP++S +L+G+G +ATHASP
Sbjct: 294 FSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASP 353

Query: 363 FVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRG 422
           +V+A + HGVKVVPH                             EQG+APK FNYVDR G
Sbjct: 354 YVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREG 413

Query: 423 RPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQ 482
           RP+R L +  +FG++ FVA SP+EE  FTWL AI+GLSELFTW SI +SH+RFR +M VQ
Sbjct: 414 RPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQ 473

Query: 483 GRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPI 541
           G+SL+ELGY++ TG+WG+ Y+          QFWVA+SP  SN K DA  FFE+YLA P+
Sbjct: 474 GKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPL 533

Query: 542 LIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAE 601
            +  Y GY ++ RD+  + P +++DL  HR+I+D E+++ E  E KE+LR++ W  R   
Sbjct: 534 WLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQEDAETKERLRNSGWLARLRS 593

Query: 602 FWC 604
           FWC
Sbjct: 594 FWC 596

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/596 (45%), Positives = 362/596 (60%), Gaps = 18/596 (3%)

Query: 21  DSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEE----------EYNGGDGIHSTHERVSG 70
           DS     E+ PR++     L HRFVDSFKR ++            NGG       E  S 
Sbjct: 45  DSDNTSIESEPRTK-----LVHRFVDSFKRAQDVPTGRKSKEIGNNGGSKTKGGFEEDS- 98

Query: 71  EDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYA 130
            D E    D    +  LK+ +K RHV+M+SL TGIGTG+LV N K LH GGPA+L+IGY 
Sbjct: 99  LDLEGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYV 158

Query: 131 IVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELV 190
           +VS + Y +IQ+A E+A+ Y +L G FNAY ++ V  AF F+  W++C+QWL +LPLEL+
Sbjct: 159 LVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELI 218

Query: 191 TASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXX-XXXXXXNTCKVLMXXXXXXXX 249
           TAS+TIKYWND IN D                             N CK+LM        
Sbjct: 219 TASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMS 278

Query: 250 XXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309
             +N GGAGN  Y+G  +WHDPGAF G    +RFKG+  VLV+  F+YGG E   L+  E
Sbjct: 279 IVINAGGAGNREYIGGKFWHDPGAFAGKTAGSRFKGICYVLVSGYFSYGGTELFALSVNE 338

Query: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIAS 369
           Q NP++S   ASK  +YRI+ IYL+T  L+GF VPY+S EL+GSG +ATHASP+V+A + 
Sbjct: 339 QSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHASPYVLAASL 398

Query: 370 HGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLL 429
           +GVK+ PH                             +QG+APK  +YVDR+GRP+  L+
Sbjct: 399 NGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALI 458

Query: 430 VSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDEL 489
              + G++ FVAASPKEE VFTWL AI+GLSELFTW SI LSHVRFR +M +Q RSL+EL
Sbjct: 459 ACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEEL 518

Query: 490 GYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPILIGLYLG 548
           GY++ TG++G+ Y           QFW A+ P G + K +AN+FF NYLAMPI +  Y G
Sbjct: 519 GYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVFYFG 578

Query: 549 YKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           Y LW RD++++ P +++DL  HR+I+D E+M+ E  E KE+LR+ S+  R   FWC
Sbjct: 579 YMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESKERLRNGSFMMRMYHFWC 634

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/568 (49%), Positives = 364/568 (64%), Gaps = 13/568 (2%)

Query: 39  GLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLM 98
           GLF RF DSFKR        D +   HE+   E  E  A   +   + LK NIK RH+ M
Sbjct: 33  GLFQRFKDSFKR-------ADVVEDVHEK---EGQEEYATGLNKTQQKLKHNIKTRHLTM 82

Query: 99  ISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFN 158
           ISL TGIGTG+LV +GK+LH GGP  LLIGY   STMLYCV+Q+  EL + Y +L G +N
Sbjct: 83  ISLGTGIGTGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATLPGNYN 142

Query: 159 AYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXX 218
           AYP  LVD+ F F+V+ VY LQW  +LPLELVTASMTIKYW +S+NPD            
Sbjct: 143 AYPTFLVDRGFGFAVALVYGLQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFYLFIVF 202

Query: 219 XXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNN 278
                           NT KVL+          +NC GA   GY+G+ YW +PG F G  
Sbjct: 203 IHFFGSRGYAESEFIFNTLKVLLMAGFIIMGISLNC-GASKLGYIGAKYWSNPGTFAGER 261

Query: 279 GINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAAL 338
            IN  KG+ +V V +AFAYGG+EF  LTAAEQ NP++S+ SA+K+ +YR++ ++L+  AL
Sbjct: 262 SINHLKGICSVWVQSAFAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIAL 321

Query: 339 LGFLVPYNSPELL-GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXX 397
           + FLVPY S +LL  SG++A+HASPFVIA A HGVK+VPH                    
Sbjct: 322 ICFLVPYTSDQLLSSSGASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYS 381

Query: 398 XXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAIS 457
                    E G  PK+F YVDR GRP+  LL  CVFGLL FVAAS  +E+VFTWL AI+
Sbjct: 382 APRILLSLAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIA 441

Query: 458 GLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWV 517
           GLS+LFTW SI+LSH+RFR +M VQGRSL ELGY S TG  G+YYA          QFW+
Sbjct: 442 GLSQLFTWTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWI 501

Query: 518 AISPVGSN-KLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDA 576
           AI+P+  + +LDA +FF+NYLA  +L+  Y+GYK+WYR+ +++IP +++DL +HR+IFD 
Sbjct: 502 AIAPIDKHGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQIFDE 561

Query: 577 EIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           E++Q E+LE KE+++ AS+ +R   FWC
Sbjct: 562 EVLQQEELERKERMKTASFKQRFIAFWC 589

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/583 (45%), Positives = 355/583 (60%), Gaps = 34/583 (5%)

Query: 28  ETSPRSEGS----RDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSK 83
           + SP + GS    R G+   F+DSF+R                   G D + +   D+  
Sbjct: 19  KVSPNTVGSGDERRTGIMRGFIDSFRR-------------------GRDVDLMCKADAED 59

Query: 84  HKT--LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQ 141
             T  +K+ IK RH+LMI+L TGIGTG+LVGNG +L   GPA L++GY + S MLY +++
Sbjct: 60  GTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVE 119

Query: 142 SASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWND 201
           +A EL I Y+ ++G + AY +LLVD A  FSVSWVYC+QW+ + PL+LVTA+M I+YW D
Sbjct: 120 AAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTD 179

Query: 202 SINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDG 261
            INPD                            N CKVLM          +NCGGAG  G
Sbjct: 180 -INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSG 238

Query: 262 YLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSAS 321
           Y+G  YWH+P  F     +N FKGL  V   AAFAYGG E  VL+A+EQ+NP+KSI SA 
Sbjct: 239 YIGDKYWHEPRPF-----MNGFKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSAC 293

Query: 322 KKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXX 381
           KK++YRI+ IYL+T  ++ FLVP + P L   GS    ASP VIA++ HGVK+VPH    
Sbjct: 294 KKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS---RASPLVIAVSFHGVKIVPHIINA 350

Query: 382 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVA 441
                                    EQG+APK+F Y+DR+GRP+    V+ VFGLL F+A
Sbjct: 351 VILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLA 410

Query: 442 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAY 501
           ASP ++ VF WLLAISGLS++F W SI +SH+RFR +M  QGRS+ E+GY++ TG WG++
Sbjct: 411 ASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSW 470

Query: 502 YAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIP 561
            A          QFWVAISPV +  +DA +FF++YLA PIL+  Y GYK++++DWR+ IP
Sbjct: 471 IAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRICIP 530

Query: 562 ANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           A+EVDL+SHR++FD + ++ E LE K +L+ +    R   FWC
Sbjct: 531 ASEVDLISHRQVFDEDELKQEDLEWKLKLKSSPIWVRIYHFWC 573

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  523 bits (1347), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 265/583 (45%), Positives = 359/583 (61%), Gaps = 25/583 (4%)

Query: 30  SPRS---EGSRDGLFHRFVDSFKRPE----EEYNGGDGIHSTHERVSGEDFERLAPDDSS 82
           SPRS   E S+  L HRFVDSF+R E    EE +  DG  S   +               
Sbjct: 6   SPRSDDVEISKSNLVHRFVDSFRRAESPELEENDLEDGTRSIVTKTH------------- 52

Query: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
               LK+ +K RHV+M+S+ TGIGTG+LV N K L+  GPASL+IGY +VS + Y +IQ+
Sbjct: 53  ----LKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQA 108

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
           A E+A+ Y +L G FN+Y +  + K F F+  W++ +QWL + PLEL+TAS+T+KYWND 
Sbjct: 109 AGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDK 168

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           IN D                            N+CKVLM          +NCGGAG DGY
Sbjct: 169 INADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGY 228

Query: 263 LGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 322
           +G+ YWHDPG+F     I RFKG+  +LV+A F+YGGAE   L+  EQ+NP+KS  +A+K
Sbjct: 229 IGAKYWHDPGSFADGPPITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAK 288

Query: 323 KLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXX 382
           + +YRI+ IYL T  L+GF VP+NS EL+G+GSAATHASP+V+A + H VKVVPH     
Sbjct: 289 QSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAV 348

Query: 383 XXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAA 442
                                   EQG+APK  NYVDR GRP+R L++  +FG++ FV+A
Sbjct: 349 ILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSA 408

Query: 443 SPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYY 502
           S KEE VFTWL AI+GLSELFTW  I LSH+RFR++M   G+S DE+G+++ TG+WG+YY
Sbjct: 409 SSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYY 468

Query: 503 AXXXXXXXXXGQFWVAISPVGS-NKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIP 561
                      QFWVA+SP GS  K DA  FF++YLA PI +  Y GY ++ RD+ ++ P
Sbjct: 469 GCAFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNP 528

Query: 562 ANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
             ++DL  HR+I+D + ++ E  E KE+L+++S   R   +WC
Sbjct: 529 LEKIDLDFHRRIYDPDFIKQEDEENKERLKNSSIWARIYHWWC 571

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  522 bits (1344), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 264/598 (44%), Positives = 361/598 (60%), Gaps = 16/598 (2%)

Query: 7   KNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHE 66
           K++    +  VES+ S   V  T+P        +F RFVDSFK  E+  N    + S  E
Sbjct: 26  KSVDQINEKSVESYASNAEVGATNPT-------MFRRFVDSFKPAED--NKHSEVDSDVE 76

Query: 67  RVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLL 126
           R +G+    +  D       LK+ +K RHV+M++L TGIGTG+LV N K LH GGPA+L+
Sbjct: 77  R-NGDAAYSVNTDTH-----LKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALV 130

Query: 127 IGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILP 186
           IGY +VS + Y +IQ+A E+A+ Y +L G FN Y ++ V K F F+  W++C+QWL +LP
Sbjct: 131 IGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLP 190

Query: 187 LELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXX 246
           LEL+TAS+ IKYW + +N D                            N CK+LM     
Sbjct: 191 LELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFI 250

Query: 247 XXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLT 306
                VNCGGAG+DGY+G  YWH PGAF G N   RFKG+  VLV+  F+YGG E  VL+
Sbjct: 251 IFSIVVNCGGAGHDGYIGGKYWHSPGAFAGTNAAERFKGVCYVLVSGYFSYGGTELYVLS 310

Query: 307 AAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIA 366
             EQ+NP+KS   A+K+ +YRI+ IYL+T  L+GF VP+N  +L+G+G +ATHASP+V+A
Sbjct: 311 VNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASPYVLA 370

Query: 367 IASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVR 426
            + HGV+VVPH                             EQG+APK   YVDR GRP+ 
Sbjct: 371 ASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLY 430

Query: 427 CLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSL 486
            LL   VFG++ F A S +EE VFTWL AI+GLSELFTW SI LSHVRFR++M +QGR L
Sbjct: 431 ALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDL 490

Query: 487 DELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLY 546
           +E+GY + TG WG+ Y           QFWVA++P  S  + A +FFE+YLA PI I  Y
Sbjct: 491 NEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPPKS-PITAQSFFESYLAFPIWIAFY 549

Query: 547 LGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            GY +W +D+  + P +++DL  HR+I+D E+++ E +E KE++R+ +   +   FWC
Sbjct: 550 FGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENKERVRNGNIWTKLKWFWC 607

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  519 bits (1337), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 259/588 (44%), Positives = 358/588 (60%), Gaps = 12/588 (2%)

Query: 17  VESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERL 76
           +E  + +E +  ++   E  R GL HRF+DSFKR + +  G D            D E  
Sbjct: 42  MEHSEKLENLASSTALDEAPRTGLVHRFMDSFKRADGQRAGFDD----------NDLESG 91

Query: 77  APDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTML 136
                S+   LK+++K RHV+M++L TGIGTG+LV N   LH  GPA L++ Y +VS + 
Sbjct: 92  TRSFISESH-LKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVT 150

Query: 137 YCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTI 196
           Y +IQ+A E+A+ Y +L G FN+Y +L V K F F+  W++ LQWL +LPLEL+T+S+TI
Sbjct: 151 YFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTI 210

Query: 197 KYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGG 256
           KYWND IN D                            N+CK+LM          VNCGG
Sbjct: 211 KYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGG 270

Query: 257 AGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 316
           AG+DGY+G  YWHDPGAF  +  I RFKG+  +LV A F+YGG E  VL+  EQ+NP+KS
Sbjct: 271 AGHDGYIGGKYWHDPGAFTSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKS 330

Query: 317 IRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVP 376
              A+K+ +YRI+ IYL+T  L+GF VP+++ +L+GS  +ATHASP+V+A + HGV++VP
Sbjct: 331 TPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVP 390

Query: 377 HXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGL 436
           H                             +QG+APK   Y+DR+GRP+  L    +FG+
Sbjct: 391 HFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGV 450

Query: 437 LCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTG 496
           + F AAS +EE VFTWL AI+GLSELFTW  I LSHVRFR++M VQGR L+ELGY++ +G
Sbjct: 451 IGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSG 510

Query: 497 VWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDW 556
           VWG+ Y           QFWVA++P GS K  A +FFE+YLA PI    Y GY LW +D+
Sbjct: 511 VWGSVYGVFFNILVFFAQFWVALAPPGS-KPTALSFFESYLAFPIFFTFYFGYMLWNKDF 569

Query: 557 RVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
             +IP   +DL  HR+++D E ++ E+ E+K +L+++S   R   FWC
Sbjct: 570 TFLIPLESIDLDFHRRVYDPEFIRQEREEKKIKLKNSSIWTRMYYFWC 617

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  517 bits (1331), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 263/606 (43%), Positives = 368/606 (60%), Gaps = 23/606 (3%)

Query: 7   KNIKSPEDGVVESFDSVEVVKET--SPR-----SEGSRDGLFHRFVDSFKRPEEEYNGGD 59
           +N+  P       + S E +     SP      +E SR GL HRFVDSFKR ++      
Sbjct: 3   RNVIQPNKEKTVDYSSTEYLPNELESPSFNLDATEESRSGLVHRFVDSFKRAQD------ 56

Query: 60  GIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHN 119
              ST   +  ED  +  P   + H  LK+ +K RHV+M+ + TGIGTG+LV N   L  
Sbjct: 57  ---STENDL--EDGTK--PLGDASH--LKKAMKSRHVIMMCVGTGIGTGLLVANASGLSY 107

Query: 120 GGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCL 179
           GGP SL+IGY +VS + Y +IQ+A E+A+ Y +L G FN+Y ++ + K F F+  W++ +
Sbjct: 108 GGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFI 167

Query: 180 QWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKV 239
           QWL + PLEL+TAS+TIKYWND IN D                            N+CKV
Sbjct: 168 QWLTVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKV 227

Query: 240 LMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGG 299
           LM          +NCGGAG DGY+G+ YW DPG+F   + + +FKG+  +LV A F+YGG
Sbjct: 228 LMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEGDSVEKFKGICYILVTAYFSYGG 287

Query: 300 AEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATH 359
           AE   L+  EQ+NP+KS   A+K+ +YRI+ IYL+T  L+GF VP+N+ +L+GSG +ATH
Sbjct: 288 AELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATH 347

Query: 360 ASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVD 419
           ASP+V+A + HGVKVVPH                             EQG+APK  +YVD
Sbjct: 348 ASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVD 407

Query: 420 RRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSM 479
           R GRP+R L++  VFG++ FV+AS KEE VFTWL AI+GLSELFTW  I LSHVRFR+ M
Sbjct: 408 REGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCM 467

Query: 480 IVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVG-SNKLDANNFFENYLA 538
            + GRS +E+G+++ TG+WG+ Y           QFWVA++P     K+DA +FF++YLA
Sbjct: 468 KLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLA 527

Query: 539 MPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKR 598
            PI +  Y GY L+ RD+  ++P +++DL  HR+I+D E+++ E  E KE+++++S   R
Sbjct: 528 APIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENKEKIKNSSVWVR 587

Query: 599 AAEFWC 604
              FWC
Sbjct: 588 MFHFWC 593

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  512 bits (1319), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 264/607 (43%), Positives = 361/607 (59%), Gaps = 19/607 (3%)

Query: 5   EMKNIKSPEDGVVESFDSVE-----VVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGD 59
            M  IK  +D       SV+     + +E +     +R+  + RFV+SFKR E+      
Sbjct: 8   SMSEIKDSDDSAQPVLSSVKSESGSIGQEWNAWDNENRNA-WGRFVNSFKRAEK------ 60

Query: 60  GIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHN 119
                H   S  D E       +    LK++IKPRHV M+S+ TGIGTG+LV NGKSL  
Sbjct: 61  -----HSTPSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRF 115

Query: 120 GGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCL 179
           GGPA L+IGYA VS + Y ++Q+A E+A+ Y SL G FNAY + L+ + F F+  W+YC+
Sbjct: 116 GGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCI 175

Query: 180 QWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKV 239
           QWL +LPLEL+TAS+TIKYWNDSIN D                              CKV
Sbjct: 176 QWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKV 235

Query: 240 LMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGG 299
           LM          +NCGGAG+  Y+G+ YW+DPGAF   +G  +FKG+  VLV   F+YGG
Sbjct: 236 LMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGSGATKFKGVAYVLVTGYFSYGG 295

Query: 300 AEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLG-SGSAAT 358
            E   +T  EQ NP+++I+S +K+ +YRI+ IY++T  L+GFLVP+ S EL+G SG +AT
Sbjct: 296 TELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSAT 355

Query: 359 HASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYV 418
           HASP+V+A++ HGVK+VPH                             EQG+AP+   YV
Sbjct: 356 HASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYV 415

Query: 419 DRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRS 478
           DR GRP+  L+   VFGLL FVAAS  EE VFTWL AI+GLSELFTW +I LSHVRFR++
Sbjct: 416 DRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQA 475

Query: 479 MIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYL 537
           M    R L ELGY++ TGV G+             QFWV+I+P G + KLD  +FF++YL
Sbjct: 476 MRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYL 535

Query: 538 AMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTK 597
           A P+ + L+ GY + +R+W +I P  ++DL  +R I+D + +  E LE K  ++++SW +
Sbjct: 536 AFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDLEHKILIQNSSWAR 595

Query: 598 RAAEFWC 604
           +   FWC
Sbjct: 596 KLHNFWC 602

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  508 bits (1309), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 253/565 (44%), Positives = 343/565 (60%), Gaps = 12/565 (2%)

Query: 40  LFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMI 99
           + HRFV+SFKR E+     D   S  E    ED + +  D       LK+ +K RHV+M+
Sbjct: 40  MIHRFVNSFKRAEQPPLKQD---SDLE----EDTDTIVTDTQ-----LKKTMKSRHVVMM 87

Query: 100 SLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNA 159
           SL TGIGTG+LV N + LH  GPA L+I Y +VS + Y +IQ+A E+A++Y +L G FNA
Sbjct: 88  SLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNA 147

Query: 160 YPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXX 219
           Y +  + K F F+  W++ +QWL +LPLEL+TA+MT++YWNDSIN D             
Sbjct: 148 YISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDSINADVYVVIFYVFLLFI 207

Query: 220 XXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNG 279
                          N CK+L           VN GGAGN GY+G+ YWHDPGAF  +  
Sbjct: 208 HFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAFTSDTN 267

Query: 280 INRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALL 339
             RFKG+  VLV A F+YGG E   L+  EQ+NP++S  +A+K+ +YRI+ IYL+T  L+
Sbjct: 268 AGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILV 327

Query: 340 GFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXX 399
           GF VP NS EL+GSG + THASP+V+A + HGVKVVPH                      
Sbjct: 328 GFNVPSNSNELMGSGGSVTHASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAP 387

Query: 400 XXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGL 459
                  +QGFAPK  +YVDR GRP+  L+V  VFG++ FVA S KEE VF WL AI+GL
Sbjct: 388 RLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGL 447

Query: 460 SELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAI 519
           +ELFTW  I +SH+RFR++M +Q +SLDE+GY+S  GV+G+Y+           QFWVA+
Sbjct: 448 AELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVAL 507

Query: 520 SPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIM 579
           +P    ++ A+ FFE+YLA PI    Y GY +W RD+ +      VDL  HR+I+D E++
Sbjct: 508 APPMYTEMSADTFFESYLAFPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYDPELV 567

Query: 580 QSEQLEEKEQLRHASWTKRAAEFWC 604
           + E  E+KE L+++   KR   FWC
Sbjct: 568 KQEDEEKKEMLKNSPMWKRMYYFWC 592

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  508 bits (1307), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 258/608 (42%), Positives = 364/608 (59%), Gaps = 23/608 (3%)

Query: 1   MKGFEMKNIKSPEDGVVESFDSVEVVKETSPRS--EGSRDGLFHRFVDSFKRPEEEYNGG 58
           M G   +++K  ++ + E  +S  +     P S  +G RDGLF R VDSFKR E E    
Sbjct: 1   MSGTSTEDVKWEKESIREVAESPNI-----PISGGDGHRDGLFQRIVDSFKRVEGEVRNS 55

Query: 59  DGIHSTHERVSGEDFERLAPDDSSKHKT-LKQNIKPRHVLMISLATGIGTGMLVGNGKSL 117
             +         ED E      +S H T LKQN+K RHV+++SL TGIGTG+LV N  SL
Sbjct: 56  SDL---------EDGEV-----TSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSL 101

Query: 118 HNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVY 177
           H GGP  LLIGY  VS + Y ++Q+A E+A+ Y +L G FNAY ++ + K F F+  W++
Sbjct: 102 HFGGPGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLF 161

Query: 178 CLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTC 237
           C+QW  ILPLEL+T+S+ +KYW   IN D                            N+C
Sbjct: 162 CIQWTTILPLELITSSIVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSC 221

Query: 238 KVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAY 297
           KVLM          +NCG  G+DGY+G  YWH+PGAF   +GI+RFKG+  VLV A F+Y
Sbjct: 222 KVLMVAGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAGSGIDRFKGIAYVLVTAYFSY 281

Query: 298 GGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAA 357
           GG E   L+  E  NP+K+I SA  K VYRI+ IY++T  ++GFLVP++S +LLGSGS+ 
Sbjct: 282 GGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSG 341

Query: 358 THASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNY 417
            H SP+V+A++ HG+K+VPH                             +QG+APK+ +Y
Sbjct: 342 VHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDY 401

Query: 418 VDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRR 477
           VDR+GRP+  L++  VFGL+ FVAAS  EE +F WL AISGLSELFTW +I LSH RFRR
Sbjct: 402 VDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRR 461

Query: 478 SMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGS-NKLDANNFFENY 536
           +M +QGRSL+ LGY+S TG WG+ YA          Q WVA+ P+ +  K    + F++ 
Sbjct: 462 AMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSC 521

Query: 537 LAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWT 596
           LA+P+ + + +GY +  ++W ++ P + + + SHR+ +D E+M+ E LE K++++ + W 
Sbjct: 522 LALPLWLSMAVGYMIVTKNWTILNPLSSISVDSHRRSYDVEVMKQEDLEYKQKMKRSKWY 581

Query: 597 KRAAEFWC 604
            R +  WC
Sbjct: 582 VRMSYTWC 589

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  507 bits (1305), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 253/589 (42%), Positives = 349/589 (59%), Gaps = 13/589 (2%)

Query: 18  ESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLA 77
           ES  + E+            +G + RF DSFKR ++                G D E  +
Sbjct: 21  ESVTASELYDSRPHAQHEEHEGAWCRFRDSFKRAQKR-----------SVPQGGDLETAS 69

Query: 78  PDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLY 137
                    L+++I+PRHV M+S+ TGIGTG+LV NGKSL  GGP  L+IGYA VS + Y
Sbjct: 70  VQTDLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAY 129

Query: 138 CVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIK 197
            ++Q+A E+A+ Y S+ G FNAY ++ + K F F+  W+YCLQWL + PLEL+TAS+TIK
Sbjct: 130 IMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIK 189

Query: 198 YWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGA 257
           YW DS+N D                              CKVLM          +NCGGA
Sbjct: 190 YWTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGA 249

Query: 258 GNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317
           GN GY+G+ YWHDPGAF   +  ++FKG   VLV   F+YGG E   +T  EQ +P+++I
Sbjct: 250 GNSGYIGARYWHDPGAFAVGDPASKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRAI 309

Query: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGS-GSAATHASPFVIAIASHGVKVVP 376
            SA+K+ +YRI+ IY++T  L+GFLVP+ S EL+GS G +ATHASP+V+A++ HGVKVVP
Sbjct: 310 HSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKVVP 369

Query: 377 HXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGL 436
           H                             EQG+APK   Y+DR GRP+  L+   V GL
Sbjct: 370 HIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVIGL 429

Query: 437 LCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTG 496
           L FVAAS  EE VFTWL AI+GLSELFTW +I LSH+RFR++M   G SL +LGY+S TG
Sbjct: 430 LAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSITG 489

Query: 497 VWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPILIGLYLGYKLWYRD 555
           +WG+ Y           QFWVA++P+G+N K D  +FF++YLA P+    +LGY ++  +
Sbjct: 490 LWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMVYSGE 549

Query: 556 WRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           W ++ P  ++D+   R ++D E ++ E+LE K  L++++W  R   FWC
Sbjct: 550 WMILRPLKDIDINHFRCVYDEERIEQEKLEHKTMLQNSNWLGRLKHFWC 598

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  496 bits (1276), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 250/600 (41%), Positives = 352/600 (58%), Gaps = 12/600 (2%)

Query: 7   KNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHE 66
           K  KSP     E    V      S        G F  F+DS+KR +          S   
Sbjct: 7   KETKSPSYASSEHSSIVSANSYNSSAGNSKTRGYFRNFIDSYKRADP---------SQLH 57

Query: 67  RVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLL 126
               ED E       S  +  K+++  RHV+M+SL TGIGTG+LV N K L+ GGP SL+
Sbjct: 58  NARSEDVEDGIASIRSDTQ-FKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLI 116

Query: 127 IGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILP 186
           IGY +VS + Y +IQ+A E+A+ Y +L G FNAY ++ + K++ F+  W++C+QWL +LP
Sbjct: 117 IGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLP 176

Query: 187 LELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXX-XXXXXXNTCKVLMXXXX 245
           LEL+T+S+TIKYWND IN D                             N+CK+LM    
Sbjct: 177 LELITSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGF 236

Query: 246 XXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVL 305
                 +N GGAGNDGY+G  YWH+PG+F   +  +RFKG+  VLV+  F+YGG E  VL
Sbjct: 237 IILSIVINAGGAGNDGYIGGKYWHEPGSFAEGDATSRFKGICLVLVSGYFSYGGTELYVL 296

Query: 306 TAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVI 365
           +  EQ  P+K+  +A+KK +YRI+ IYL+T  L+GF VP+N+ +L+G+G +ATHASP+V+
Sbjct: 297 SVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHASPYVL 356

Query: 366 AIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPV 425
           A   HGVK+VPH                              QG+APK+ +YVDR GRP+
Sbjct: 357 AATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRPL 416

Query: 426 RCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRS 485
             L +S + GL+ FV+ +  EE VFTWL AI+GLSE+FTW  I  SHVRFR +M VQG+ 
Sbjct: 417 VALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKD 476

Query: 486 LDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGS-NKLDANNFFENYLAMPILIG 544
           ++ELGY++ TGVWG+ Y           QFWVA++P+G+  K DA  FFE+YLA PI + 
Sbjct: 477 INELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWVA 536

Query: 545 LYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            Y GY ++ +D+ ++ P +++DL S+R+I+D E+++ E  E KE L+      +   FWC
Sbjct: 537 CYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEENKENLKSRPLYYKIYRFWC 596

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  495 bits (1274), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 243/571 (42%), Positives = 341/571 (59%), Gaps = 17/571 (2%)

Query: 34  EGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKP 93
           EG   G+FHRF+DSFK P E+                 D E ++ + + +H  LK+ +K 
Sbjct: 29  EGRASGVFHRFIDSFKPPVED--------------EKSDLEEMSMESTDRH--LKKAMKS 72

Query: 94  RHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSL 153
           RHV+M++L TG+GTG+LV N K L  GGP +L+IGY +VS + Y +IQ+A E+A+ Y +L
Sbjct: 73  RHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAAGEMAVTYPTL 132

Query: 154 SGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXX 213
            G FN Y +  + K   F+  W++ +QWL +LPLEL+T +MTI+YWNDSIN D       
Sbjct: 133 PGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWNDSINADVWIVIFY 192

Query: 214 XXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGA 273
                                NTCK+L           VN GGAG DGY+G+ YW +PG+
Sbjct: 193 VFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYIGAKYWKNPGS 252

Query: 274 FRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYL 333
           F  +    RFK +  VLV A F+YGG E  VL+  EQ NP++S   A+K+ +YRI+ IYL
Sbjct: 253 FASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYL 312

Query: 334 MTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXX 393
           +T  L+GF VP+++ +L+G+G ++THASP+V+A + HGVKVVPH                
Sbjct: 313 LTMILIGFNVPHDNDQLMGAGGSSTHASPYVLAASIHGVKVVPHIINAVILICVTSMGNS 372

Query: 394 XXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWL 453
                        EQG+APK   Y+DR GRP+  L    V G++ F AAS +EE VFTWL
Sbjct: 373 SLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIAFAAASSQEEQVFTWL 432

Query: 454 LAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXG 513
            AI+ LSELFTW +I LSH+RFR +M VQG+ L+ELGY++ TGVWG+ +           
Sbjct: 433 AAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVWGSMWGFGFCVLVFIA 492

Query: 514 QFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKI 573
           QFWVA+SP G   + A  FFE+YLA P+ +  Y  Y LW RD+  +    ++DL +HR+I
Sbjct: 493 QFWVALSPPGGT-ISAEGFFESYLAFPLWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRI 551

Query: 574 FDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           +D E ++ E  E KE++R++S+  +   FWC
Sbjct: 552 YDPEFLRQEDEERKEKIRNSSFWIKMKYFWC 582

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  495 bits (1274), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 256/619 (41%), Positives = 366/619 (59%), Gaps = 27/619 (4%)

Query: 1   MKGFEMKNIKSPEDGVVE--SFDSVEVVKETSP----------RSEGSRDGL--FHRFVD 46
           M  F  K+ KSP+  V+   S D    +  T+           RS   R     +  F+D
Sbjct: 1   MSDFVGKHEKSPDFSVINNSSLDYANNLASTNDDDISIASSQNRSLSHRKNTSYYRNFID 60

Query: 47  SFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIG 106
           SFKR E         H      S +  +  A   S  +  +K+++K RHV+M+SL TGIG
Sbjct: 61  SFKRAE---------HGNLNEKSADLEDGTASIQSKSY--MKKSLKARHVIMMSLGTGIG 109

Query: 107 TGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVD 166
           TG+LV N KSL  GGPASL+IGY IVS ++Y +IQ+A E+A+ Y +L G FN Y ++ + 
Sbjct: 110 TGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFIS 169

Query: 167 KAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXX 226
           K++ F+  W++C+QW+ +LPLEL+T+S+TI+YW D +N D                    
Sbjct: 170 KSWGFATVWLFCIQWITVLPLELITSSLTIQYWTD-LNGDIFVVIFYVFLLLIHFIGVKA 228

Query: 227 XXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGL 286
                   N CK+LM          VNCGGAGNDGY+G  YWH PG+F      +RFKG+
Sbjct: 229 YGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIGGKYWHTPGSFAEGGPTSRFKGI 288

Query: 287 VAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYN 346
             VLV   F+YGG E  VL+  EQ  P+K+  +A+KK +YRI+ IYL+T  L+GF VP+N
Sbjct: 289 CYVLVAGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILVIYLLTMILIGFNVPHN 348

Query: 347 SPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 406
           S +L+G+G ++THASP+V+A + HGVKVVPH                             
Sbjct: 349 SDQLMGAGGSSTHASPYVLAASIHGVKVVPHIINAVILISVVSVANSSLYASPRLLASLA 408

Query: 407 EQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWF 466
           EQG+APK   Y+DR GRP+  LL+  VFG + FVA+S KEE VFTWL AI+GLSE+FTW 
Sbjct: 409 EQGYAPKALTYIDREGRPLVALLLCAVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWT 468

Query: 467 SISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGS-N 525
            I  SHVRFR +M VQ + +DE+GY++  G++G+++           QFWVA+SP GS  
Sbjct: 469 GIMFSHVRFRLAMKVQNKDIDEVGYKATAGIYGSWFGSIFGVLVLIAQFWVALSPPGSGG 528

Query: 526 KLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLE 585
            + A +FFENYLAMPI +  Y+ Y ++ ++W ++   +++DL +HR+I+D ++++ E  E
Sbjct: 529 AVSAESFFENYLAMPIWVFFYIVYSVYNKEWTILTDLSKIDLDAHRRIYDPDLIRQEDAE 588

Query: 586 EKEQLRHASWTKRAAEFWC 604
            KE+L+++ +  R   FWC
Sbjct: 589 NKEKLKNSPFWVRVYNFWC 607

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  490 bits (1261), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 243/590 (41%), Positives = 350/590 (59%), Gaps = 17/590 (2%)

Query: 17  VESFDSVEVVKETSPRSEGSRD--GLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFE 74
           V  F+   VV+     S  S +  G F RFVDSF+R E+    GD           ED E
Sbjct: 6   VNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRR-EDTSRSGDL----------EDGE 54

Query: 75  RLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVST 134
                +S+    L+Q ++ RHV+M+SL TGIGTG+LV N  SLH GGPA LLIGY +VS 
Sbjct: 55  ----INSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSI 110

Query: 135 MLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASM 194
           + Y ++ +A E+A+ Y +L G FNAY ++ + K F F+  W++CLQWL + PLEL+TA++
Sbjct: 111 VSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATI 170

Query: 195 TIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNC 254
            IKYW  S+N +                            N CKVLM          +N 
Sbjct: 171 VIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINV 230

Query: 255 GGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 314
           G  G+ GY+G  YW +PG+F     +++ KG   VLV A F++GG E   L+  E  NP+
Sbjct: 231 GAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPK 290

Query: 315 KSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKV 374
            +I SA KK VYRI+ +YL+T  ++GFLVP++S  L+GSGS   H SP+V+AI  HGVKV
Sbjct: 291 TAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKV 350

Query: 375 VPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVF 434
           +PH                             +QG+APK  +Y+DR GRP+  L++  +F
Sbjct: 351 LPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIF 410

Query: 435 GLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSW 494
           GL+ F AAS  +E +F WL AI+GLSELFTW SI LSH RFR++M +QGRSL+ LGY++ 
Sbjct: 411 GLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAI 470

Query: 495 TGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYR 554
           TG WG+ YA          QFWVA+ P+   K+D  +FF+NY+A P+ + ++LGY ++ R
Sbjct: 471 TGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSR 530

Query: 555 DWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           +W ++ P +++DL +HR+++D E+++ E+ E KE++R++ W  +   FWC
Sbjct: 531 NWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNSPWYVKVLNFWC 580

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  490 bits (1261), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 254/594 (42%), Positives = 350/594 (58%), Gaps = 19/594 (3%)

Query: 14  DGVVESFDSVEVVKETS-PRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGED 72
           D   +SF+ ++  + TS   SE  R G   R++DS+KR E            H R   + 
Sbjct: 36  DSGFKSFNDIDTSERTSVESSEVYRSGRIRRWIDSYKRAE------------HPREHIDG 83

Query: 73  FERLAPDDSSKHKT-LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAI 131
           FE    D  SK    LK+ +K RHV+M+SL TGIGTG+L+ N K LH  GPA L+IGY +
Sbjct: 84  FE----DGESKDGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYGM 139

Query: 132 VSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVT 191
           VS + Y +IQ+A ELA+ Y +L G FN+Y  +L+ K F F+  W+  +QWL +LPLE + 
Sbjct: 140 VSFVTYFMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFIA 199

Query: 192 ASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXX 251
           AS+TIKYWND I+ D                            N CKVLM          
Sbjct: 200 ASLTIKYWNDRISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLCKVLMIIGFIILSIV 259

Query: 252 VNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQ 311
           +N GGAGNDGY+G  YW+DPGAF G    +RFKG+  +LV   F+YGG E  VL+  EQ+
Sbjct: 260 INAGGAGNDGYIGGKYWNDPGAFAGETAGSRFKGVCYILVTGYFSYGGTELFVLSVNEQE 319

Query: 312 NPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAA-THASPFVIAIASH 370
           NP+KS   A+K  +YRI+ IYL+T  L+GF VPYN P L+G+  A+ +HASP+V+A + H
Sbjct: 320 NPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRLMGADDASGSHASPYVLAASIH 379

Query: 371 GVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLV 430
           GVK+VPH                             EQGFAPK+  YVDR GRP+  L +
Sbjct: 380 GVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQGFAPKIMAYVDREGRPLVSLGI 439

Query: 431 SCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELG 490
             +FGL+ F A+S KEE VFTWL AI+GLSELFTW +  +SH+RFR +M +QG+ + E+G
Sbjct: 440 CALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFFISHIRFRWAMKLQGKDIKEVG 499

Query: 491 YQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYK 550
           + + TG++G++Y           QFWVA+SP+GS K+ A +FFE+YLA PI +  Y GY 
Sbjct: 500 FLASTGLYGSFYGLFFNILVFAAQFWVALSPIGSKKVGAESFFESYLAFPIWLFFYFGYM 559

Query: 551 LWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           +W +D+  + P   +DL  HR+I+D E M     +EKE+ +++S   +   + C
Sbjct: 560 VWAKDFTFLNPLESIDLDFHRRIYDPEEMAEINRQEKEEYKNSSIVGKIIYWLC 613

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  487 bits (1254), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 256/557 (45%), Positives = 335/557 (60%), Gaps = 29/557 (5%)

Query: 71  EDFERLAPDD------SSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPAS 124
           + F+R  P D      S +   L ++IK RH++MISL TGIGTG+LVGNG+ L   GPA 
Sbjct: 68  DSFKRQLPADQNSELESQERNNLTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAG 127

Query: 125 LLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCI 184
           L++GY I S MLYC+IQ+A EL + Y  L+G +  Y ++LVD +  F+VS VY +QWL +
Sbjct: 128 LVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTV 187

Query: 185 LPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXX 244
           LPL+LVTA+MTIKYW + +N D                            N CK+LM   
Sbjct: 188 LPLQLVTAAMTIKYWTN-VNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIG 246

Query: 245 XXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSV 304
                  +NCGGAG+  ++G+ YWH+PG F      + FKG+  V   AAF+YGG E  +
Sbjct: 247 FVILAIVINCGGAGDRKFIGTKYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLL 301

Query: 305 LTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPF 363
           L+AAEQ+NP KSI +A KK+VYRI+ IY++T  L+ FLVPYNS ELL    S+ +HASPF
Sbjct: 302 LSAAEQENPTKSIPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSHASPF 361

Query: 364 VIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGR 423
           VIA+ASHGVKVVPH                             EQGF PK   YVDR GR
Sbjct: 362 VIAVASHGVKVVPHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGR 421

Query: 424 PVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQG 483
           P+ C LVS +FG + FVA S  EE VFTWLLAIS LS+LF W S+SLSH+RFR +M  QG
Sbjct: 422 PLLCFLVSIIFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQG 481

Query: 484 RSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPIL 542
           RS+DE+GY++ TG WG++ A          QFWVAI+PV  + KLDAN FF+NYLAMPI+
Sbjct: 482 RSMDEVGYKAQTGYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMPIV 541

Query: 543 IGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRH---------- 592
           +  Y G+K++ + W+  IPA ++DL SHR I+   I+      + + L+           
Sbjct: 542 LFAYFGHKIYTKSWKFWIPAEKIDLDSHRTIYVPPILMGTNKIDDDDLKEYETSESSENP 601

Query: 593 -----ASWTKRAAEFWC 604
                  + KR A FWC
Sbjct: 602 NGSGSRKFFKRMANFWC 618

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  487 bits (1253), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 247/601 (41%), Positives = 345/601 (57%), Gaps = 14/601 (2%)

Query: 5   EMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHST 64
           E  +  +  D + E   SVE V       E ++ G F R+ DSFKR E+     DG    
Sbjct: 28  ERIHTSTTNDYINEKLGSVEEVSSFDYVQEAAKTGRFRRWADSFKRAEKSTEAEDG---- 83

Query: 65  HERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPAS 124
                    E  +  + ++   LK+ +K RHV+M+SL TGIGTG+LV N K L   GPA 
Sbjct: 84  ---------ESGSIYNGNESTELKKAMKSRHVVMMSLGTGIGTGLLVANAKGLAISGPAP 134

Query: 125 LLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCI 184
           L+IGY +VS + Y +IQ+A EL + Y SL G FN Y   LV + F F+  W+  +QWL +
Sbjct: 135 LVIGYGLVSFITYFMIQAAGELGVTYASLPGNFNVYFGTLVSRPFGFATVWLASVQWLTV 194

Query: 185 LPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXX 244
           +PLEL+T ++TIKYW + +N D                            NTCK+LM   
Sbjct: 195 IPLELITCAITIKYWTEKVNGDIFVLIIYVFLLFIHIFGVKAYGEAEFLFNTCKILMIAG 254

Query: 245 XXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSV 304
                  +N GGAGNDGY+G  YW++PGAF  +N  +RFK +  +LV   F+YGG E  V
Sbjct: 255 FIILSIVINVGGAGNDGYIGGSYWNNPGAFASDNAASRFKSICYILVTGYFSYGGTELFV 314

Query: 305 LTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFV 364
           L+  EQ+NP+KS   A+K  +YRI+ IYL+T  L+GF VP++S +L+GS  ++ HASP+V
Sbjct: 315 LSVNEQENPRKSTPQAAKHSIYRILVIYLLTMILIGFNVPHDSDQLMGSAGSSAHASPYV 374

Query: 365 IAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRP 424
           +A + HGVKVVPH                             +QGFAPK   YVDR GRP
Sbjct: 375 LAASLHGVKVVPHFINAVILIALISVANSSLYAAPRMMVSLAQQGFAPKFLTYVDREGRP 434

Query: 425 VRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGR 484
           +  + V  VFG++ F A+S KEE VFTWL AI+GLSELFTW +  LSH+RFR++M VQG+
Sbjct: 435 LLGIAVCAVFGVIGFAASSDKEEDVFTWLAAIAGLSELFTWSAFFLSHIRFRQAMKVQGK 494

Query: 485 SLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPILI 543
           ++ E GY S TG+WG+             QFWVA+SP+G++ K DA  FF++YLA PI +
Sbjct: 495 NIKECGYLSVTGIWGSIIGLCFNILVFIAQFWVALSPIGNDGKCDAQAFFQSYLAFPIWL 554

Query: 544 GLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFW 603
             Y G   +Y+D+ ++ P   +DL  HR+I+D E ++ E L  K +L+   +  +   F+
Sbjct: 555 AFYFGCMFYYKDYTLLNPLESIDLDDHRRIYDPEELKKEDLATKAELKRRGFHAQLVAFF 614

Query: 604 C 604
           C
Sbjct: 615 C 615

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  486 bits (1251), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 252/540 (46%), Positives = 331/540 (61%), Gaps = 22/540 (4%)

Query: 80  DSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCV 139
           +S +   L ++IK RH++MISL TGIGTG+LVGNG+ L   GPA L++GY + S MLYC+
Sbjct: 83  ESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCI 142

Query: 140 IQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW 199
           IQ+A EL + Y  L+G +  YP++LVD +  F+VS VY +QWL +LPL+LVTA+MT+KYW
Sbjct: 143 IQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYW 202

Query: 200 NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGN 259
             S+N D                            N CK+LM          +NCGGAG+
Sbjct: 203 T-SVNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGD 261

Query: 260 DGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 319
             Y+G+ YWH+PG F      + FKG+  V   AAF+YGG E  +L+AAEQ+NP KSI +
Sbjct: 262 RKYIGTEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPN 316

Query: 320 ASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGS-GSAATHASPFVIAIASHGVKVVPHX 378
           A KK+VYRI+ IY++T  L+ FLVPYNS ELLGS  S+ +HASPFVIA+ASHGVKVVPH 
Sbjct: 317 ACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVVPHF 376

Query: 379 XXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLC 438
                                       EQG  PK   YVDRRGRP+ C LVS  FG + 
Sbjct: 377 INAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGCIG 436

Query: 439 FVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVW 498
           FVA S  EE VFTWLLAIS LS+LF W S+SLSH+RFR +M  QGRS++E+GY++ TG W
Sbjct: 437 FVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYW 496

Query: 499 GAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPILIGLYLGYKLWYRDWR 557
           G++ A          QFWVAI+PV  + KL+   FF+NYLAMPI++  Y G+K++++ W 
Sbjct: 497 GSWLAVLIAVFFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFKSWS 556

Query: 558 VIIPANEVDLVSHRKIF-----------DAEIMQ---SEQLEEKEQLRHASWTKRAAEFW 603
             IPA+++DL SHR IF           D ++ +    E LE    LR  +  K+    W
Sbjct: 557 FWIPADKIDLNSHRNIFVHSTLTEFDKADDDVKEYENQESLENLNNLRSRNLFKKMVNLW 616

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  485 bits (1249), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 248/537 (46%), Positives = 327/537 (60%), Gaps = 32/537 (5%)

Query: 37  RDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHV 96
           R  +F R VDSFKR +   +G                   A  ++  +KT+K    PRH+
Sbjct: 77  RRNVFVRIVDSFKRQKVRNDG-----------------EFAETETQLNKTMK----PRHI 115

Query: 97  LMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGG 156
           +MISL TGIGTG+LVGNG+ L   GPA L+IGY + S M+YCV+Q+A EL ++Y+ L+G 
Sbjct: 116 VMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAAGELGLVYSRLTGN 175

Query: 157 FNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXX 216
           +  YP  L+D A  F+VS +Y LQWL +LPL+LVTA+MTI+YW  ++NPD          
Sbjct: 176 YTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTTNVNPDIFVAAILVLV 235

Query: 217 XXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRG 276
                             N CK+LM          +NCGGAG+  Y+G  YW  PGAF  
Sbjct: 236 IAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYIGVKYWQTPGAFA- 294

Query: 277 NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTA 336
               N FKG+ AV   AAF+YGG E  VLTA EQ NP+K+I  A +K+VYR++ +Y++T 
Sbjct: 295 ----NGFKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTT 350

Query: 337 ALLGFLVPYNSPELLGSGS--AATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXX 394
            ++ FLVPYNSP LLGS +  + + ASPFVIA+ASHGV+VVPH                 
Sbjct: 351 IIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVPHIINAAILISVISVANSS 410

Query: 395 XXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLL 454
                       +QG+APK FNY+DRRGRP+ C+LVS   GL+ F+AA P  E VFTWLL
Sbjct: 411 LYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLL 470

Query: 455 AISGLSELFTWFSISLSHVRFR---RSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXX 511
           A+SGLS++F W SI++SH+RFR   RS +   R+ D + Y + TG  G+  A        
Sbjct: 471 AVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEYTAQTGYVGSLVALAISIFIL 530

Query: 512 XGQFWVAISPVGSN-KLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDL 567
             QFWVAI+P+G N +LD   FFENYLA P+L+G YL YK+W+RDWR+ IPANE+DL
Sbjct: 531 VCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAYKIWHRDWRLCIPANEIDL 587

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  480 bits (1235), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 263/616 (42%), Positives = 354/616 (57%), Gaps = 46/616 (7%)

Query: 10  KSPEDGVVESFDSVEVVKETSPRSEGSRDGL---FHRFVDSFKRPEEEYNGGDGIHSTHE 66
           K   D  +    + E  ++ SP+    +  L   F +F DSFKR               +
Sbjct: 29  KKKRDFTITEKQNEEPEQQGSPQKTDRKPKLRNEFRKFFDSFKR---------------Q 73

Query: 67  RVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLL 126
             S ++ E     +S +   L+++IK RH++MISL TGIGTG+LVGNG+ L   GPA L+
Sbjct: 74  LPSDQNSEL----ESQEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLV 129

Query: 127 IGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILP 186
           +GY I S MLYC+IQ+A EL + Y  L+G +  Y ++LVD +  F+VS VY +QWL +LP
Sbjct: 130 LGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLP 189

Query: 187 LELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXX 246
           L+LVTA+MT+KYW + +N D                            N CK+LM     
Sbjct: 190 LQLVTAAMTVKYWTN-VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFV 248

Query: 247 XXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLT 306
                +NCGGAG+  Y+G+ YWH+PG F      + FKG+  V   AAF+YGG E  +L+
Sbjct: 249 ILAIVINCGGAGDRRYIGTEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLS 303

Query: 307 AAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVI 365
           AAEQ+NP +SI +A KK+VYRI+ IY++T  L+GFLVPYNS ELL    S+ +HASPFVI
Sbjct: 304 AAEQENPTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVI 363

Query: 366 AIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPV 425
           A++SHGVKVVPH                             EQG  PK   YVDR GRP+
Sbjct: 364 AVSSHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPL 423

Query: 426 RCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRS 485
            C LVS  FG + FVA S  EE VFTWLLAIS LS+LF W S+ LSH+RFR +M  QGRS
Sbjct: 424 LCFLVSLAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRS 483

Query: 486 LDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPILIG 544
           +DE+GY++ TG WG++ A          QFWVAI+PV  + KLD   FF+NYLAMPI++ 
Sbjct: 484 MDEVGYKAQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLL 543

Query: 545 LYLGYKLWYRDWRVIIPANEVDLVSHRKIF-------------DAEIMQSEQLEEKEQLR 591
            Y G+K++++ WR  IPA ++DL SHR ++             D ++ + E  E  E L 
Sbjct: 544 AYFGHKMYFKSWRFWIPAEKIDLDSHRNVYLPPTSTGADKIDDDDDVTEYETSESSENLH 603

Query: 592 HASWT---KRAAEFWC 604
            +      K+   FWC
Sbjct: 604 SSRLNKSFKKMVNFWC 619

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  476 bits (1225), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 248/521 (47%), Positives = 329/521 (63%), Gaps = 8/521 (1%)

Query: 59  DGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLH 118
            GI ++ E  S  D  +   ++      L ++IK RH+LMISL TGIGTG+LVGNG+ L 
Sbjct: 64  SGITNSFESESLRDDSKPLENEEKTENQLNRSIKSRHLLMISLGTGIGTGLLVGNGQVLA 123

Query: 119 NGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYC 178
             GPA L+IGY + S M+Y ++Q+A EL I Y+ L+G +  YP++LVD A  F++S +Y 
Sbjct: 124 KSGPAGLVIGYGVASIMVYFIVQAAGELGICYSGLTGNYIRYPSILVDPALGFAISIIYT 183

Query: 179 LQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCK 238
           LQWL ++PL+LVTA+MTI YW + INP+                            N  K
Sbjct: 184 LQWLTVMPLQLVTAAMTIGYWTN-INPNIFVAIVLVIVVLTNCFGAKGYVEAEFLCNIFK 242

Query: 239 VLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYG 298
           VLM          +N G  G DGY+G++YW +PGAF      N FKG+ +V   AAF+YG
Sbjct: 243 VLMMVGFVLLAILINTGAIGTDGYIGTIYWKNPGAFA-----NGFKGVCSVFCYAAFSYG 297

Query: 299 GAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAAT 358
           G E   LTAAEQ+NP K+I SA KK VYRI+ +Y++T  L+GFLVPY+SP+L+GS S   
Sbjct: 298 GIEVLALTAAEQENPIKAIPSACKKTVYRILFLYMLTTILIGFLVPYDSPQLMGSTSGGG 357

Query: 359 HAS-PFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNY 417
             S PFVIAIASHGVKVVPH                             EQG  PK+FNY
Sbjct: 358 SHSSPFVIAIASHGVKVVPHLINAVILISIVSVANSAFYSSTRLLLSLSEQGKIPKIFNY 417

Query: 418 VDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRR 477
           VD+ GRP  C+L + +FG + FVA+SP +E VFTWLLAISGLS++F W SI LSH+RFRR
Sbjct: 418 VDKEGRPWYCILFASLFGSIGFVASSPYKEEVFTWLLAISGLSQIFLWMSICLSHIRFRR 477

Query: 478 SMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENY 536
           +MI QG+SLDE+GY++ TG WG++ A          QFWVAI+P+G + KLD   FF+NY
Sbjct: 478 AMIKQGKSLDEIGYKAPTGCWGSWIALSIALFSLISQFWVAIAPIGKDGKLDVLVFFQNY 537

Query: 537 LAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAE 577
           LA PI++  YLGYK +Y+DWR+ IP++++DL   R+I+  E
Sbjct: 538 LAAPIVLIAYLGYKTYYKDWRLYIPSDKIDLSYGREIYVPE 578

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  476 bits (1226), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 267/608 (43%), Positives = 354/608 (58%), Gaps = 57/608 (9%)

Query: 24  EVVKETS-PRSEGSRDGLFHR---FVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPD 79
           EV  +T+ PR   S+  L  +   F DSFKR                        +L PD
Sbjct: 42  EVSGQTAEPRRTDSKSILQRKCKEFFDSFKR------------------------QLPPD 77

Query: 80  -----DSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVST 134
                +S +   L ++IK RH++MISL TGIGTG+LVGNG+ L   GPA L++GY I S 
Sbjct: 78  RNSELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASI 137

Query: 135 MLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASM 194
           MLYC+IQ+A EL + Y  L+G +  YP++LVD +  F+VS VY +QWL +LPL+LVTA+M
Sbjct: 138 MLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAM 197

Query: 195 TIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNC 254
           T+KYW  S+N D                            N+CK+LM          +NC
Sbjct: 198 TVKYWT-SVNADIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILAIIINC 256

Query: 255 GGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 314
           GGAG+  Y+G+ YWH+PG F      + FKG+  V   AAF+YGG E  +L+AAEQ+NP 
Sbjct: 257 GGAGDRRYIGAEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPT 311

Query: 315 KSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLG-SGSAATHASPFVIAIASHGVK 373
           KSI +A KK+VYRI+ IY++T  L+ FLVPYNS ELLG S S+ +HASPFVIA+ASHGVK
Sbjct: 312 KSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVK 371

Query: 374 VVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCV 433
           VVPH                             EQG  PK   YVDR GRP+ C  VS V
Sbjct: 372 VVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLV 431

Query: 434 FGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQS 493
           FG + FVA S  EE VFTWLLAIS LS+LF W S+SLSH+RFR +M  QGRS++E+GY++
Sbjct: 432 FGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKA 491

Query: 494 WTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPILIGLYLGYKLW 552
            TG WG++ A          QFWVAI+PV  + KL+   FF+NYLAMPI++  Y G+K++
Sbjct: 492 QTGYWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHKIY 551

Query: 553 YRDWRVIIPANEVDLVSHRKIF-DAEIMQSEQLEEKEQL---------------RHASWT 596
           ++ W   IPA ++DL SHR IF    + + +++++ + L               R   + 
Sbjct: 552 FKSWSFWIPAEKIDLDSHRNIFVSPSLTEIDKVDDNDDLKEYENSESSENPNSSRSRKFF 611

Query: 597 KRAAEFWC 604
           KR   FWC
Sbjct: 612 KRMTNFWC 619

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  476 bits (1224), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 234/519 (45%), Positives = 323/519 (62%), Gaps = 2/519 (0%)

Query: 81  SSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140
           +S+    K  +K RHV+M++LATGIGTG+LV N KSLH  GPA L++GY +VS + Y V+
Sbjct: 148 ASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVV 207

Query: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN 200
           Q+A E+AI Y +L GGFN Y +L + K F F+  W++ L WL ILPLEL+T+S+T+KYW 
Sbjct: 208 QAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITSSITVKYWT 267

Query: 201 DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND 260
            SINPD                            N+CK+LM          VNCGGAG+D
Sbjct: 268 TSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHD 327

Query: 261 GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 320
           GY+G  YWHDPG F  +NG  RFK +  VL+NA F+YGG E  VL+  EQ+NP+K++  A
Sbjct: 328 GYIGGKYWHDPGPFASDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVA 387

Query: 321 SKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXX 380
           +K  VYR+  IYL+T  L+GF VPYNSP+L+G+ + +  ASP+V+A   HGVK+VPH   
Sbjct: 388 AKTSVYRVAIIYLLTMILIGFNVPYNSPDLMGNAN-SKDASPYVLAAQIHGVKIVPHFIN 446

Query: 381 XXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFV 440
                                     EQGFAPK   YVDR GRP+  L V  +FG++ F 
Sbjct: 447 AVILLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFA 506

Query: 441 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGA 500
           A S KE+ VFTWL AI+GLSELF W  I LSH+RFR +M   G+S+DE+GY++ TG+WG+
Sbjct: 507 ATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIWGS 566

Query: 501 YYAXXXXXXXXXGQFWVAISPVGS-NKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVI 559
           YY           QFWVA+S  GS  ++ A +FFE+YLA  I +  YL Y ++ +DW ++
Sbjct: 567 YYGLFFNLLVLIAQFWVALSAPGSGGQVTAISFFESYLAFVIWVFFYLCYMIYNKDWTIL 626

Query: 560 IPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKR 598
           IP  ++D+   R+I+DA+ ++ E+ E  E+ + ++  K+
Sbjct: 627 IPLKDIDVDYQRRIYDADFLRQEKEESYEKYKQSNIGKK 665

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  470 bits (1209), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 252/593 (42%), Positives = 351/593 (59%), Gaps = 45/593 (7%)

Query: 3   GFEMKNIK---SPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGD 59
           GFE+K+I    SPE  V+ +  S        P +   + G+   F+DSFKR E       
Sbjct: 23  GFEVKDISATVSPETNVITASSSAS---NEGPATPQPQLGVVASFLDSFKRKEH------ 73

Query: 60  GIHSTHERVSGEDFERLAPDDSS--KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSL 117
                              DDS+      L + I+ RH++MISL TGIGTG+LVG G  L
Sbjct: 74  -------------------DDSTAGDENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVL 114

Query: 118 HNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVY 177
              GP  L+IGY + S M++ +IQ+A EL I+Y+++ G F  YP +LVD AF F++S++Y
Sbjct: 115 SQSGPLGLIIGYIVSSLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLY 174

Query: 178 CLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTC 237
            +QW+ +LPL+LVTA+MTI++WN  +N D                            N C
Sbjct: 175 TIQWMIVLPLQLVTAAMTIQFWNVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLC 234

Query: 238 KVLMXXXXXXXXXXVNCGGAGN--DGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAF 295
           K++M          +  GG  N  DGY+G  YW +PG F      N FKG+ +V   AAF
Sbjct: 235 KIVMLTGFVILGIIITAGGIPNGPDGYIGGKYWRNPGLFA-----NGFKGVCSVFCYAAF 289

Query: 296 AYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGS 355
           +YGG E  VL+AAEQ+NP KSI SA+KK++YRI+ IYL++  ++ FLVPY SP+L+GS  
Sbjct: 290 SYGGVETLVLSAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSG 349

Query: 356 AATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLF 415
           + +H+SPFVIAIASHGV VVPH                             + G APK  
Sbjct: 350 SGSHSSPFVIAIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFL 409

Query: 416 NYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRF 475
           NY+D+RGRP  C LV  +FG++ FVAAS K E VFTWLL+ISGL ++F W SI +SH+RF
Sbjct: 410 NYIDKRGRPTTCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRF 469

Query: 476 RRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFE 534
           R +M VQG  L E+ Y++ TG WG+Y A          QFWVAI+PVG++ KLDA NFF+
Sbjct: 470 RDAMRVQGHPLTEIAYKAQTGYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQ 529

Query: 535 NYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEK 587
           NYLA P+++  YLG+K++Y+ W+++IPA++++L ++R ++  E    E LE+K
Sbjct: 530 NYLAFPVVLCAYLGFKVYYKQWQLLIPADKIELDNNRNVYVPE----EALEDK 578

>NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa]
           {ON} 
          Length = 619

 Score =  465 bits (1196), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 247/550 (44%), Positives = 327/550 (59%), Gaps = 31/550 (5%)

Query: 41  FHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMIS 100
           F  F++ FKR ++   G D                L   D+   KT    IK RH+LMIS
Sbjct: 64  FKNFLNGFKRQKQNEEGAD----------------LEMQDTQLSKT----IKARHLLMIS 103

Query: 101 LATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAY 160
           L TGI TG+LVGNG+ L   GP  L+IGY I S M+YC+IQSA EL I Y  L G F  Y
Sbjct: 104 LGTGIATGLLVGNGQVLSKAGPGGLVIGYFISSVMIYCMIQSAGELGICYRGLVGNFTRY 163

Query: 161 PALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXX 220
            +LL+D +  F++S +Y  QWL +LPL+LVTA++TI++W D +NPD              
Sbjct: 164 SSLLIDPSLGFALSILYTFQWLTVLPLQLVTAAITIEFWTD-LNPDIFVAIIFIVVIVVN 222

Query: 221 XXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGI 280
                         N CK+LM          +  GGAGNDGY+G+ YW +PGAF      
Sbjct: 223 LFGARGYAEAEFFCNLCKILMIIGFIILSIIIISGGAGNDGYIGAKYWKNPGAFA----- 277

Query: 281 NRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLG 340
           N FKG+  V   AAF+YGG E  VL+  EQ+NP K + +  KK+ YRI+ IYL+T  L+ 
Sbjct: 278 NGFKGVCTVFTYAAFSYGGIEVLVLSIDEQENPIKVVPNCCKKVAYRILFIYLLTTILVC 337

Query: 341 FLVPYNSPELLGS----GSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXX 396
           FLVPY SP+LLGS     ++ +HASPFVIA+ SHGVKVVPH                   
Sbjct: 338 FLVPYTSPQLLGSLNKGENSGSHASPFVIAVESHGVKVVPHFINAVILISVISVANSSVY 397

Query: 397 XXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAI 456
                     EQG  P+  NY+D+RGRP+RC ++S  FGL+ FVA+S K + VFTWLLAI
Sbjct: 398 SSGRLLLSLSEQGTFPQFLNYIDQRGRPIRCFVISLTFGLIGFVASSEKRQDVFTWLLAI 457

Query: 457 SGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFW 516
           SGLS+LF W +I LSH+RFR +M  Q +S+DE+GY++ TG WG++ A          QFW
Sbjct: 458 SGLSQLFIWLAICLSHIRFRDAMKTQKKSMDEVGYKAQTGYWGSWVAVLIGLFSLVTQFW 517

Query: 517 VAISPVGSN-KLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFD 575
           VAI+PV  N KLD  +FF+NYLA PI++  Y G+KL+Y +W  +IP +++DL SHRKI+ 
Sbjct: 518 VAIAPVDKNGKLDVMSFFQNYLAFPIVLVAYFGHKLYYGNWCPLIPLSKIDLDSHRKIYS 577

Query: 576 AEIMQSEQLE 585
            E +   +L+
Sbjct: 578 PEEITEIELQ 587

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  459 bits (1182), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 234/579 (40%), Positives = 338/579 (58%), Gaps = 24/579 (4%)

Query: 31  PRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPD-DSSKHKTLKQ 89
           P+    + G+  R VDS++R +               + G+D     P+ D   +  LKQ
Sbjct: 61  PKQGFFQRGILGRVVDSYRRAD---------------IPGQD----DPEGDMVSNAGLKQ 101

Query: 90  NIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAII 149
            +K RHV M+SL TGIGTG+L+ NGK L N GPA LLIGY +VS   Y ++Q+A ELA+ 
Sbjct: 102 ALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVSVNTYFMVQAAGELAVA 161

Query: 150 YTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXX 209
           + ++ G FNAY + LV + F F+ +W++ +QWL + P+EL+  +  +++W   ++ D   
Sbjct: 162 FPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMTFAVRFWTTRVDADVFV 221

Query: 210 XXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWH 269
                                    N  KVLM          V  GGAG+ GY+G+ YWH
Sbjct: 222 LIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVAAGGAGDSGYIGAKYWH 281

Query: 270 DPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRII 329
           DPGAF  +    RFKG+  VLV+A F+YGG E  VL+  EQ+NP+K+I +A+K  +YRII
Sbjct: 282 DPGAFVSHTAEGRFKGVCYVLVSAYFSYGGTELFVLSVNEQENPRKTIPTATKTTIYRII 341

Query: 330 GIYLMTAALLGFLVPYNSPELLGSGSA---ATHASPFVIAIASHGVKVVPHXXXXXXXXX 386
            IYL+T  L+GF VP N P L+GS  A       SP+V+A + H V+V+PH         
Sbjct: 342 FIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVLAASYHHVRVLPHFINAVVMLA 401

Query: 387 XXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKE 446
                               +QG+ PK F+Y+DRRGRP R L++  + G++ F ++S K 
Sbjct: 402 LVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPTRALVLCFIIGVIAFASSSEKR 461

Query: 447 ETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXX 506
           ET+F+WL AI+GLSELFTW SI LSHVRFR ++ VQG+ ++ELGY+S TGVWG+ Y    
Sbjct: 462 ETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKDINELGYKSNTGVWGSAYGVFF 521

Query: 507 XXXXXXGQFWVAIS-PVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEV 565
                  QFWVA+S P    K  A++FF++YLA+PI +  Y+G+ LW RD+  +IP N+V
Sbjct: 522 SLLVFAAQFWVALSAPNSGGKCSASDFFQSYLALPIWLTFYVGFMLWTRDFTFLIPLNKV 581

Query: 566 DLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           DL S+R+ +D E+++ E  E K+ ++ AS   +   F+C
Sbjct: 582 DLDSYRRYYDPELLRQEDEEHKQAMKSASIWIKLHSFFC 620

>NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  449 bits (1156), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 250/577 (43%), Positives = 338/577 (58%), Gaps = 30/577 (5%)

Query: 1   MKGFEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDG 60
           M   E+++ K  E  V E    +     T   S+ +    F  F  SFKR + +      
Sbjct: 38  MVSIEIESTKKREIEVSEK--PIASADTTVSTSKCNAKTYFQDFCHSFKRKDSD------ 89

Query: 61  IHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNG 120
                          L  D  ++   L + IK RH+LMISL TGI TG+LVGNG+ L   
Sbjct: 90  ---------------LDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKA 134

Query: 121 GPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQ 180
           GPA L+IGY + S M+YC+I +A EL I Y  L G F  YP++L+D +  F++S +Y LQ
Sbjct: 135 GPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQ 194

Query: 181 WLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVL 240
           WL +LPL+LVTA++TI +W D +NPD                            N CK+L
Sbjct: 195 WLTVLPLQLVTAAITISFWTD-VNPDIFVLCVFIVVIIVNLFGARGYAETEFFCNCCKIL 253

Query: 241 MXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGA 300
           M          +  GGAG DGY+G+ YW  PG F      + FKG+  V   AAF+YGG 
Sbjct: 254 MITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGI 308

Query: 301 EFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHA 360
           E  VL+  EQ++P  ++ +A KK+VYRI+ IYL+T  L+ FLVPY+SP LLGS  + +HA
Sbjct: 309 EVVVLSIDEQEDPVSAVPNACKKVVYRILLIYLLTTILVCFLVPYDSPNLLGSSHSGSHA 368

Query: 361 SPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDR 420
           SPFVIAI SHGVKVVPH                             EQG  P+  N++D 
Sbjct: 369 SPFVIAIESHGVKVVPHFINAVILISVISVANSSLYSSSRLLLSLSEQGSLPQWLNFIDM 428

Query: 421 RGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMI 480
            GRP+RC ++S +FG++ FVAAS K E VFTWLLAISGLS+LF W S+SLSH+R R +M 
Sbjct: 429 NGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMK 488

Query: 481 VQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAM 539
            QG+SLDE+GY++ TG WG++ A          QFWVAI+PV  + +LD  NFF+NYLA 
Sbjct: 489 SQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAF 548

Query: 540 PILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDA 576
           PI++  YLG+K++Y++WR+ IPA+++DL SHR+I+ A
Sbjct: 549 PIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIYSA 585

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  449 bits (1154), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 225/499 (45%), Positives = 310/499 (62%), Gaps = 6/499 (1%)

Query: 82  SKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQ 141
           S+++ LKQ+IKP HV MI++ATGIGTG+LVGNGKS+ + G    L+GY I+ +ML C +Q
Sbjct: 65  SENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQ 124

Query: 142 SASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWND 201
           S  EL + + SL+GGFN+Y    VD +F F+V+W++CLQW  +LPLELVTASMTIKYWN+
Sbjct: 125 SVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWNN 184

Query: 202 SINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDG 261
           S+NP                             N  KVLM          ++ G AG  G
Sbjct: 185 SLNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTSG 244

Query: 262 YLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQ--NPQKSIRS 319
           Y+G  Y   PGAF   N  N FK + + LVNA F+ GG EF  L+AAEQ   N  KSI+ 
Sbjct: 245 YIGIKYLKTPGAF---NTRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISKSIKR 301

Query: 320 ASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXX 379
           A  +++ R+   Y+++  ++G LVPYNSPEL+GS S   H+SP+VIA+ASHGVKVVPH  
Sbjct: 302 ACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVVPHLI 361

Query: 380 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCF 439
                                      EQGFAP  F  +D +GRP RCL+VS VFGLL F
Sbjct: 362 NAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFGLLSF 421

Query: 440 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWG 499
           +A    +E+VF WLL+ISGLS +FTW  I ++H+RFR +M  Q  SL+ELG+++W+G++G
Sbjct: 422 IAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWSGIYG 481

Query: 500 AYYAXXXXXXXXXGQFWVAISPV-GSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRV 558
           +YY           QFWV++ P+ G  + D  NFF+NY+A+P  + LY+G+K++ R W+ 
Sbjct: 482 SYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYTRSWQF 541

Query: 559 IIPANEVDLVSHRKIFDAE 577
           IIPA+++D+ + R I+  E
Sbjct: 542 IIPADKIDVDTSRDIYGVE 560

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  437 bits (1125), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 226/572 (39%), Positives = 317/572 (55%), Gaps = 14/572 (2%)

Query: 37  RDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHV 96
           ++     ++DSFK PEE       ++S  E    E               LK+ +K RHV
Sbjct: 103 KNKRIKNWIDSFKPPEECMESELELNSIDENGHREK----------PRAQLKKTMKSRHV 152

Query: 97  LMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGG 156
           +M+SL TGIGTG+LV N   L   GPA L+IGY +VS + Y +IQ+A E+ + Y +L G 
Sbjct: 153 VMMSLGTGIGTGLLVSNASCLSLSGPAPLVIGYGLVSIITYLLIQAAGEMGVAYPTLPGN 212

Query: 157 FNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXX 216
           FN Y +  + +   F+  W+  +QWL ++PLEL+ ASMTIKYW  SI+PD          
Sbjct: 213 FNTYISTFLSRPIGFATIWLSSIQWLTVVPLELIAASMTIKYWTTSISPDVFVVIFYVFL 272

Query: 217 XXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRG 276
                             N CK+LM          +NCGGAG+DGY+G  YWH PGAF G
Sbjct: 273 NFIHFFGTAAYGETEFIFNLCKILMIIGFIILSIVINCGGAGHDGYIGGKYWHTPGAFVG 332

Query: 277 NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTA 336
            N  +RFK +  +LV A F+YGG E  VLT  EQ NP+KS  +A+K  +YRI+ +YL+T 
Sbjct: 333 KNSASRFKDVCYILVTAFFSYGGTELFVLTINEQPNPRKSTPTAAKTTIYRILIVYLLTM 392

Query: 337 ALLGFLVPYNSPELLGSGSA---ATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXX 393
            LLGF VPY++  L  + S+   +   SP+V+A + HGVKVVPH                
Sbjct: 393 ILLGFNVPYDNKNLFSATSSNGDSISISPYVLAASIHGVKVVPHFINAVVLIALISVANS 452

Query: 394 XXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWL 453
                        +QG APK   Y+DR GRP+  LL+  + G++ F AAS KE+ VF WL
Sbjct: 453 ATYAAPRMMASLAQQGMAPKFLAYIDREGRPIYGLLICSLLGVIGFAAASDKEQEVFVWL 512

Query: 454 LAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXG 513
            AI+GL+ LF W    LSH+RFR +M VQG+ ++E+GY++  G+WG+             
Sbjct: 513 AAIAGLATLFLWECFFLSHIRFRWAMKVQGKDINEVGYKAACGIWGSIIGACFNVLVLIA 572

Query: 514 QFWVAISPVGS-NKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRK 572
            FWV+++P G  + + A NFFE  LA+PI I   +GY +  +DW +  P   +DL   RK
Sbjct: 573 NFWVSLTPPGQGSNVSAKNFFEQMLALPIWIFFAVGYMVIKKDWVIWNPIESIDLDYCRK 632

Query: 573 IFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           I+D E ++ E  E +E++R+A +  R   FWC
Sbjct: 633 IYDPEQLKREDEENRERIRNAGFWARCRAFWC 664

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  427 bits (1098), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 225/532 (42%), Positives = 314/532 (59%), Gaps = 10/532 (1%)

Query: 71  EDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYA 130
            D E+L+  + S+  +L+Q+IKPRHV MIS+ATGIGTG+LVGNGKS+   G    LIGY 
Sbjct: 10  SDAEKLS-SEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYL 68

Query: 131 IVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELV 190
           I+  M+ C +QS  EL + + SL+GGFN+Y    +D +  F VSW++CLQW+ +LPLELV
Sbjct: 69  IIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELV 128

Query: 191 TASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXX 250
           TASMTIKYWN +++P                             N  KV++         
Sbjct: 129 TASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGI 188

Query: 251 XVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQ 310
            +  GG GN G +G  Y   PGAF  N   N FK     LVNAAF+ GG EF  L+AAEQ
Sbjct: 189 VIITGGLGNSGPIGFQYLKTPGAF--NTNYNVFKATAGTLVNAAFSCGGVEFLALSAAEQ 246

Query: 311 Q--NPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIA 368
              N  KSIR A +++  R+   YL++ +++G LVPY+SP L+GSGS  TH SP+V AIA
Sbjct: 247 NRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIA 306

Query: 369 SHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCL 428
            HGV++VPH                             EQ FAP+ F  +++ G+P+RCL
Sbjct: 307 LHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCL 366

Query: 429 LVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDE 488
           +VS + GL+ F+A    +E VF WLL+ISGLS +FTW +I ++H+RFR ++ +QG+SLD 
Sbjct: 367 VVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDT 426

Query: 489 LGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPILIGLYL 547
           LGY+S TGV G+Y A          QFWV++ P+ +N K DA  FF+NY+A+P+ + LYL
Sbjct: 427 LGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYL 486

Query: 548 GYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRA 599
           G+KL+  DW   I  + VD+ + R ++      S+ L  K  ++ A   + A
Sbjct: 487 GHKLYTNDWTPWIRTHCVDINTDRDVYA----PSDDLSTKGVVKLAPAVQSA 534

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  411 bits (1057), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 227/561 (40%), Positives = 317/561 (56%), Gaps = 12/561 (2%)

Query: 48  FKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKH---KTLKQNIKPRHVLMISLATG 104
           FK     ++  D  +S H    G      +PDD  +      + Q++  RH++ +++   
Sbjct: 51  FKEETTSFSD-DRFNSQHSYNPG------SPDDIKEDIHTSNMNQDLNVRHLITLAVGGA 103

Query: 105 IGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALL 164
           IGTG+ V +G SL+ GGPASL+IG+ IVST L+ VI S  ELA  Y  + GGFN Y    
Sbjct: 104 IGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVINSLGELAAAY-PVVGGFNVYMTRF 162

Query: 165 VDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXX 224
           VD +FAFSV+  Y +QWL +LPLELV AS+TI+YW+D+IN DA                 
Sbjct: 163 VDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDDTINSDAWVAIFYTLILIANLLDV 222

Query: 225 XXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFK 284
                     +  K+L           + CGG    GY+G  YWHDPGAF G++   +FK
Sbjct: 223 KSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGYIGGKYWHDPGAFVGDSAGTQFK 282

Query: 285 GLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVP 344
           GL +V V AAF+Y G E   ++AAE QNP+K+I +A+K+  + I   Y+    L+G LV 
Sbjct: 283 GLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTIPTAAKRTFWIITFSYITILTLVGCLVA 342

Query: 345 YNSPELL-GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXX 403
           YN   LL GS S    ASP VIAI + G+K +P                           
Sbjct: 343 YNDTRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMV 402

Query: 404 XXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELF 463
                G  PK  + VD+RGRP+R +  +  FGLL FVAAS K+E VFTWL A+SGLS +F
Sbjct: 403 SMALIGNLPKGLSVVDKRGRPLRAIFTTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIF 462

Query: 464 TWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVG 523
            W  I+++H+RFR++M VQ RSLDE+ Y S TG++G+YY            FW ++ P+G
Sbjct: 463 CWMGINIAHIRFRQAMTVQNRSLDEMPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLG 522

Query: 524 SNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
            +  DA  FFE YL+ PILI  Y+G+KL++++WR++ P  E+DL++ RK  D +I++ E 
Sbjct: 523 GDGADAEAFFEGYLSFPILIACYIGHKLYFKNWRIMTPLEEIDLLTGRKEVDIDILKEEL 582

Query: 584 LEEKEQLRHASWTKRAAEFWC 604
             E+E LR +S+ KR    WC
Sbjct: 583 KIEREALRQSSFMKRFLLIWC 603

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  409 bits (1052), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 210/499 (42%), Positives = 296/499 (59%), Gaps = 5/499 (1%)

Query: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
           K + L+Q+I+PRHV MIS+ATGIGTG+LVGNGKS+   G    LIGY I+  ML C +QS
Sbjct: 37  KKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLVCCMQS 96

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
             EL + + SLSGGFN+Y    +D +  FSVSW++CLQW+ +LPLELVT SMTIKYWN S
Sbjct: 97  VGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIKYWNAS 156

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           ++P                             N+ KV++          ++ G  G  G 
Sbjct: 157 LSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVLIDTGCVGTSGT 216

Query: 263 LGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQ--NPQKSIRSA 320
           +G  Y  DPG F  N   N  K     LVNAAF+ GG EF  L+AAEQ   N  KSI  A
Sbjct: 217 IGFRYLIDPGMF--NKNYNIIKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIGRA 274

Query: 321 SKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXX 380
             ++  RI   YL++ +++G LVP+NSP L+GSGS   H+SP+V A+A +G+ VVPH   
Sbjct: 275 CNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYVAAVAMNGITVVPHIIN 334

Query: 381 XXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFV 440
                                     EQ FAPK F  +++ G+P+RCL +S +FGL+ FV
Sbjct: 335 AVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRCLFISALFGLISFV 394

Query: 441 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGA 500
           A    +E +F WLL+ISGLS +FTW +I ++H+RFR ++  +G+SL+ LGY+S TGV G+
Sbjct: 395 AEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLETLGYKSITGVAGS 454

Query: 501 YYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPILIGLYLGYKLWYRDWRVI 559
           Y A          QFWV++ P+ SN K +   FF+NY+A+P+ +  Y+G+K++ ++W ++
Sbjct: 455 YIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLFYIGHKVYTKNWSLL 514

Query: 560 IPANEVDLVSHRKIFDAEI 578
           I A+ VD+ + R I+   I
Sbjct: 515 IRASNVDITTDRDIYCPTI 533

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  400 bits (1028), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 213/554 (38%), Positives = 310/554 (55%), Gaps = 5/554 (0%)

Query: 52  EEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLV 111
              ++  + I S    VS  DFE    D ++  K L +++  RH+L +++   IGTG+ V
Sbjct: 56  SSSFDSKENIKSDVPHVS--DFENNVYDTANDSK-LNKDLSVRHLLTLAVGGAIGTGLFV 112

Query: 112 GNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAF 171
            +G SL+ GGPASL++ + IVST L+ ++ +  ELA ++  + GGFN Y    V+ +F F
Sbjct: 113 NSGASLNTGGPASLIVAWVIVSTCLFTIVNALGELAAVF-PVVGGFNVYITRFVEPSFGF 171

Query: 172 SVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXX 231
           +V+  Y  QW  +LPLELV AS+TI+YWN++IN DA                        
Sbjct: 172 AVNINYLAQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETE 231

Query: 232 XXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLV 291
              +  K+L           + CGG  +  Y+G  YW+DPGAF G+    RFKG+ AV V
Sbjct: 232 FVLSMIKILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAFVGDTPGRRFKGVCAVFV 291

Query: 292 NAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL 351
            AAF+Y G E   ++AAE  NP+ ++  ASK+  + I   Y+    ++G LVPYN   LL
Sbjct: 292 TAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLL 351

Query: 352 -GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGF 410
            G+ S    ASP VIAI + G+K +P                              E G 
Sbjct: 352 NGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGN 411

Query: 411 APKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISL 470
            PK  NY+D+RGRP+  +  + +FGLL F+AAS K+E VFTWL A+SGLS LF WFSI+L
Sbjct: 412 LPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINL 471

Query: 471 SHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDAN 530
           SH+RFR++M  Q RSL+EL + S TGV+G++Y            FW ++ PVGS+  DA 
Sbjct: 472 SHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAE 531

Query: 531 NFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQL 590
           +FFE YL++PI I  YLG+K++ +DWR+ +   ++DL + R+  D +I++ E   E+EQ+
Sbjct: 532 SFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLEREQM 591

Query: 591 RHASWTKRAAEFWC 604
               +  R    WC
Sbjct: 592 AQKPFYIRFLNVWC 605

>KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn
          Length = 556

 Score =  397 bits (1019), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 204/502 (40%), Positives = 291/502 (57%), Gaps = 5/502 (0%)

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           D +     LKQ+IKP HV M+S ATGIGTG+LVGNG+S+   G    L+GY I+  ML C
Sbjct: 29  DVTLPKNELKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAGVGGTLVGYLIIGIMLTC 88

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
            +Q+  EL + + S+ GGF +Y    +D +  F++SW++ L W  +LPLE+  ASMTI +
Sbjct: 89  CMQTVGELVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNWTVVLPLEICVASMTINF 148

Query: 199 WNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAG 258
           WN++INP                             N  KVLM          VN G  G
Sbjct: 149 WNENINPSIVVALCYSLVCGVNFFGARCYADADCIFNCLKVLMILGFIILGIFVNTGVVG 208

Query: 259 NDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQ--QNPQKS 316
             GYLG  Y+H PG FR + G+  FK + A L+ A F+ GG EF  L+ AEQ  ++  +S
Sbjct: 209 TSGYLGFKYFHSPGFFRNDEGL--FKSIAATLITACFSTGGTEFVALSCAEQNTEDMPRS 266

Query: 317 IRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVP 376
           I+ AS ++V RI  I+ ++  ++G LVP+NSP L+GSGS  THASP+V+A+ ++GV+++P
Sbjct: 267 IKRASIQVVVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHASPYVVALTTNGVRIIP 326

Query: 377 HXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGL 436
           H                             EQGFA K F  +D  G+P RCL VS   GL
Sbjct: 327 HIVNAIILLSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDESGKPFRCLCVSAFTGL 386

Query: 437 LCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTG 496
             F+A    +ETVF WLL+ISGLS +FTW    +SH+RFR++M  Q ++LD+LGYQS  G
Sbjct: 387 FSFIAEYKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKDQDQALDQLGYQSPCG 446

Query: 497 VWGAYYAXXXXXXXXXGQFWVAISPVGSN-KLDANNFFENYLAMPILIGLYLGYKLWYRD 555
           V+G+Y +          QFWV++ P+ SN +L+  +F +NY+A+PI I LYLG+K +  +
Sbjct: 447 VYGSYISLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVPITIVLYLGHKAYTGN 506

Query: 556 WRVIIPANEVDLVSHRKIFDAE 577
           W+  I A E+D+ + R I+  +
Sbjct: 507 WKPFIRAPEIDIQTDRDIYCVD 528

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  396 bits (1018), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 211/580 (36%), Positives = 322/580 (55%), Gaps = 18/580 (3%)

Query: 26  VKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHK 85
           + ++ P S GSR   +  FVD FKR   E    D   +  E+V+           ++   
Sbjct: 34  ITDSKPTSSGSR---WQDFVDGFKR--VELGDLDPNLTQAEKVA----------IATARS 78

Query: 86  TLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASE 145
            L++++K RH+ MI++   IGTG+ VG+G +L  GGPA++LIG+ ++  M+Y V+ +  E
Sbjct: 79  PLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGE 138

Query: 146 LAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSIN- 204
           LA+ +  ++GGF  Y    VD +F F+++++Y LQWL +LPLE+V AS+T+ YW      
Sbjct: 139 LAVTF-PVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKY 197

Query: 205 PDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLG 264
            D                            +  KV            + CGG    GY+G
Sbjct: 198 RDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVG 257

Query: 265 SVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKL 324
             YWH+PGAF G+N   RFK + +V V AAF++ G E   L AAE +NP+K++  A+K++
Sbjct: 258 GKYWHNPGAFNGDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRAAKQV 317

Query: 325 VYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXX 384
            +RI   Y+++  L+G LVPY S  L+GS S    ASPFV+AI +HG+  +P        
Sbjct: 318 FWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSVINVVIL 377

Query: 385 XXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASP 444
                                 +QGF P++F+Y+DR+GRP+  +L +C FGLLCF+A S 
Sbjct: 378 ISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLCFIAQSK 437

Query: 445 KEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAX 504
           KE  VF WL+A+SGLS LFTW  I + H+RFRR++  QGRS DEL + S+ GVWG+Y+  
Sbjct: 438 KEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVWGSYFGV 497

Query: 505 XXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANE 564
                    QFW+A+ P+G    +A++FF+ YL++ +++  YL +KL+ R+W     A +
Sbjct: 498 ILICLVFIAQFWIAVWPMGGTP-NASDFFQAYLSVVVVLFFYLAHKLYTRNWTFAKRAKD 556

Query: 565 VDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           +D+ + R+  D + ++ E  EEK +L    W  R    WC
Sbjct: 557 IDIDTGRRELDLDALKQEIAEEKLRLSTKPWWYRVYHLWC 596

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  396 bits (1018), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 233/595 (39%), Positives = 330/595 (55%), Gaps = 9/595 (1%)

Query: 16  VVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFER 75
           V++ F S +     + RS  S D      V+S  R     +G D I     +    D  +
Sbjct: 14  VIDGFHSPDRTDSANDRSS-SPDNFELSSVNSPVRVNVSSSGNDDILKGDTKEYPRDV-K 71

Query: 76  LAPDDSS-----KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYA 130
             P+ +S      +  L +++  RH+L +++   IGTG+ V +G SL  GGPASL+IG+ 
Sbjct: 72  ATPEAASYVEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWV 131

Query: 131 IVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELV 190
           IVST L+ VI S  ELA  +  + GGFN Y    ++ +FAF+++  Y  QWL +LPLELV
Sbjct: 132 IVSTCLFTVINSLGELAAAF-PVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELV 190

Query: 191 TASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXX 250
            AS+TI+YWND IN DA                           +  K+L          
Sbjct: 191 AASITIRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGI 250

Query: 251 XVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQ 310
            + CGG  + GY+G  YWH+PGAF G++  ++FKGL +V V AAF+Y G E + ++AAE 
Sbjct: 251 VLTCGGGPHGGYIGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAES 310

Query: 311 QNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIAS 369
           +NP+++I  A+K+  + I   Y+    L+G LVPYN P LL GS S    ASP VIAI +
Sbjct: 311 RNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIEN 370

Query: 370 HGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLL 429
            G+K +P                                G  PK  + VD+RGRP+  +L
Sbjct: 371 GGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAIL 430

Query: 430 VSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDEL 489
           ++  FGLL F+AAS K+E VFTWL A+SGLS +F W +I+LS +RFR +M  QGRSLDE+
Sbjct: 431 LTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEM 490

Query: 490 GYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGY 549
            + S +G WGA+Y            FW ++ PVGS+   A +FFE YL++PILI  Y+G+
Sbjct: 491 PFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGH 550

Query: 550 KLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           KLW RDWR+++P  E+DL S R++ DAE  + E   E+E L +AS+  R    WC
Sbjct: 551 KLWKRDWRLLVPLMEMDLDSGRRVLDAETREEELRVEREYLANASFFTRFLHIWC 605

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  394 bits (1013), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 208/524 (39%), Positives = 308/524 (58%), Gaps = 3/524 (0%)

Query: 82  SKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQ 141
           +    LK  +K RH+ MI++   IGTG+LVG+GK+L  GGPASLLIG+  + TM+Y ++ 
Sbjct: 80  TAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVM 139

Query: 142 SASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW-N 200
           +  ELA+++  +SGGF  Y    +D++F F+ ++ Y LQWL  LPLE+V+AS+T+ YW  
Sbjct: 140 ALGELAVVF-PISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGT 198

Query: 201 DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND 260
           D    D                            +  KV+           +NCGG    
Sbjct: 199 DPKYRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEK 258

Query: 261 GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 320
           GY+G  Y+HDPGAF G+    +FKG+ +V V AAF++ G+E   L A+E  +P+KS+  A
Sbjct: 259 GYIGGKYFHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKA 318

Query: 321 SKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXX 380
           +K++ +RI   Y+++  ++G LVPYN   L+G+ S    ASPFVIAI +HG+K +P    
Sbjct: 319 AKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLPSVVN 378

Query: 381 XXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFV 440
                                     EQGF P++F YVDR+GRP+  ++++   GL+ FV
Sbjct: 379 VVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIAFV 438

Query: 441 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGA 500
           AAS KEE VF WLLA+SGLS LFTW  I + H+RFR+++  QGRS+DEL ++S TGVWG+
Sbjct: 439 AASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVWGS 498

Query: 501 YYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVII 560
           Y+           QF+VA+ PV  +   A  FFE YL+ P+++ +Y+G+K++ R+W+++I
Sbjct: 499 YWGLFMIVIMFIAQFYVALFPVNGSP-SAEGFFEAYLSFPLVLAMYIGHKIYKRNWKLLI 557

Query: 561 PANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           PA E+D+ S R+  D E+++ E  EEK  L       R   FWC
Sbjct: 558 PAGEMDIDSGRREVDLELLKQEIAEEKAILATKPAWFRVYSFWC 601

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  393 bits (1009), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 216/611 (35%), Positives = 329/611 (53%), Gaps = 33/611 (5%)

Query: 5   EMKNIKSPEDGVVESFDSVEVVKET--SPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIH 62
           + KN    ++  +E+ D+     ET  SP    +    +  F D FKR E          
Sbjct: 5   DKKNFVYAQEEPLEAQDAGHSSYETGSSPGQTQASKSRWQDFKDGFKRVE---------- 54

Query: 63  STHERVSGEDFERLAPDDSSKHKT--------LKQNIKPRHVLMISLATGIGTGMLVGNG 114
                      E L P+ +   K         L++++K RH+ MI++   IGTG+ VG+G
Sbjct: 55  ----------LEELDPNLTEAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSG 104

Query: 115 KSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVS 174
           K+L  GGPA +LIG+ ++  M+YCV+ S  ELA+ +  +SGGF  Y    VD++F F+++
Sbjct: 105 KALRTGGPAGVLIGWGLIGLMIYCVVMSMGELAVTF-PVSGGFTTYATRFVDESFGFAIN 163

Query: 175 WVYCLQWLCILPLELVTASMTIKYWNDSIN-PDAXXXXXXXXXXXXXXXXXXXXXXXXXX 233
           + Y LQWL +LPLE+V AS+T+ +W       D                           
Sbjct: 164 YNYMLQWLVVLPLEIVAASITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFV 223

Query: 234 XNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNA 293
            +  KV+           + CGG    GY+G  YWH+PGAF G++  +RFKG+ +V V A
Sbjct: 224 FSFIKVITVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAFSGDDAGSRFKGVCSVFVTA 283

Query: 294 AFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGS 353
           AF++ G E   L +AE  NP+K++  A+K++ +RI+  Y+++  L+G LVP+ S  L+G+
Sbjct: 284 AFSFAGTELVGLASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGT 343

Query: 354 GSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPK 413
            S    ASPFV+AI +HG+K +P                              EQG  P 
Sbjct: 344 SSVDAAASPFVLAIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPH 403

Query: 414 LFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHV 473
           +F Y+DR+GRP+  ++ +CVFGLL F+A S KE  VF WLLA+SGLS LF+W +I + H+
Sbjct: 404 IFAYIDRKGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHI 463

Query: 474 RFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFF 533
           RFRR++  QGRS DEL + S+ G+ G+Y+           QFWVA+ P+G +  +A +FF
Sbjct: 464 RFRRALSAQGRSTDELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIGGSP-NAEDFF 522

Query: 534 ENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHA 593
             YL+ P+L+  Y+ +K+W R+W++   A ++D+ + R+  D E ++ E  EEK  L   
Sbjct: 523 SAYLSFPVLLAFYIFHKIWKRNWKLFTRAKDIDIDTGRREMDTEALRQEIAEEKMLLSTR 582

Query: 594 SWTKRAAEFWC 604
            W  R   FWC
Sbjct: 583 PWWYRLYFFWC 593

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  393 bits (1009), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 222/575 (38%), Positives = 313/575 (54%), Gaps = 9/575 (1%)

Query: 37  RDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGE------DFERLAPDDSSKHKTLKQN 90
           +D  + R ++ FKR +E         S  E V G+      D ER   D +     L +N
Sbjct: 54  KDVWYTRLLNDFKRADEGETTRSVADSDME-VDGKRYKEMTDVERAVCDAARNSSQLSKN 112

Query: 91  IKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIY 150
           +  RH+L +++   IGTG+ V +G SL+ GGP S+LI + ++ST L+ ++ S  ELA  +
Sbjct: 113 LSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAF 172

Query: 151 TSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXX 210
             + GGFN Y    V+ +F F+V+  Y  QW  +LPLEL  AS+TIKYWN+ IN DA   
Sbjct: 173 -PVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVA 231

Query: 211 XXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHD 270
                                   +  K+L           + CGG    G++G+ YWHD
Sbjct: 232 IFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHD 291

Query: 271 PGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIG 330
           PGAF G+    +FKGL +V V AAF+Y G E   ++AAE  NP+ +I  ASK+  + I  
Sbjct: 292 PGAFVGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITS 351

Query: 331 IYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXX 389
            YL+   + G LVP N P LL G  S    ASP VIAI + G++ VP             
Sbjct: 352 SYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIIS 411

Query: 390 XXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETV 449
                            + G  PK+FNY+DR+GRP+  +L + VFGLL FVAAS K+E +
Sbjct: 412 VANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAI 471

Query: 450 FTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXX 509
           FTWL A+SGLS LF WF+I++SH+RFRR+M  Q RSLDEL Y S TGV G++Y       
Sbjct: 472 FTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLF 531

Query: 510 XXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVS 569
                FW ++ P GS+   A +FFE YL+ PI +  Y+ +KL+ RDWR+ IPA ++D+ S
Sbjct: 532 VLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDS 591

Query: 570 HRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            R+  D E ++ ++L E+ +     +  R   FWC
Sbjct: 592 GRRALDIEELKEQKLREQAETAKKPFYVRWWIFWC 626

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  390 bits (1001), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 225/585 (38%), Positives = 318/585 (54%), Gaps = 12/585 (2%)

Query: 29  TSPRSEGSRDGLFHRFVDSFKRPEEEY-----NGGDGIHSTHERVSGEDFERLAP---DD 80
           TSP SE  +D     FV   K   +        G  GI+ T   V+  D  R +     +
Sbjct: 22  TSPVSENEKDSTI--FVTEQKSKTDSTFLLSSKGSPGINQTTNDVTSSDHFRGSEGIEQE 79

Query: 81  SSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140
              +  L +++  RH+L +++   IGTG+ V  G +L  GGPASL+I + I+ST L+ VI
Sbjct: 80  DINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVI 139

Query: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN 200
            S  EL+  +  + GGFN Y    V+ +FAF+V+  Y  QWL +LPLELV AS+TIKYWN
Sbjct: 140 NSLGELSAAF-PVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWN 198

Query: 201 DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND 260
           D IN DA                           +  K+L           ++CGG  + 
Sbjct: 199 DKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHG 258

Query: 261 GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 320
           GY+G  YWHDPGAF G++   +FKGL +V V AAF+Y G E + ++AAE +NP+++I  A
Sbjct: 259 GYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKA 318

Query: 321 SKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGVKVVPHXX 379
           +K+  + I   Y+    L+G LVP N P LL GS S    +SP VIAI + G+K +P   
Sbjct: 319 AKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLM 378

Query: 380 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCF 439
                                        G  PK  N VD+RGRP+  +L++  FGLL F
Sbjct: 379 NAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSF 438

Query: 440 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWG 499
           VAAS K+  VFTWL A+SGLS +F W +I+LSH+RFR++M VQ RSLDEL + S TGV G
Sbjct: 439 VAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKG 498

Query: 500 AYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVI 559
           ++Y            FW ++ P+GS+  +A +FFE YL+ PILI  Y G+K++ R+W ++
Sbjct: 499 SWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTRNWTLM 558

Query: 560 IPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           +   ++DL + RK  D  + + E   E+E L   S+  R   FWC
Sbjct: 559 VKLEDIDLDTGRKQVDLALRREEMKVERETLAKRSFMTRFLHFWC 603

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  384 bits (985), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 214/582 (36%), Positives = 314/582 (53%), Gaps = 20/582 (3%)

Query: 42  HRFVDSFKRPEEE----------YNGGDGIHSTHER--VSGEDFERLAPDDSSKHKTLKQ 89
            R +DSFK  E +          Y+  D    + ++  +SG + + L   DS+  +   Q
Sbjct: 9   QRMIDSFKPAETQPSRLRSARSRYDSADDRADSKQKDLMSGSETKALENLDSTSQEVEDQ 68

Query: 90  N------IKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSA 143
           +      +  RH+L +++   IGTG+ V +G +L  GGP SL+I + I+ST L+ ++ + 
Sbjct: 69  DARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNAL 128

Query: 144 SELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSI 203
            EL+  +  + GGFN Y +  V+ +F F+V+  Y  QW  +LPLELV AS+TI+YWN +I
Sbjct: 129 GELSSTF-PVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTI 187

Query: 204 NPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYL 263
           N DA                           +  K+L           + CGG    GY+
Sbjct: 188 NSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYI 247

Query: 264 GSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKK 323
           G  YW +PGAF G+   +RF GL +V V AAF+Y G E   ++AAE  NP+ ++  A K+
Sbjct: 248 GGKYWSNPGAFVGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKR 307

Query: 324 LVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGVKVVPHXXXXX 382
             + I   Y++   L+G LV  + P LL GS S    ASP VIAI + G+K +P      
Sbjct: 308 TFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAI 367

Query: 383 XXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAA 442
                                   + G  PK+F YVDR+GRP+  ++ + +FGLL F+AA
Sbjct: 368 ILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAA 427

Query: 443 SPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYY 502
           S K+E VFTWL A+SGLS LF WF+I++SH+RFRR+M  +GR+LDEL + S TGVWG+YY
Sbjct: 428 SDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYY 487

Query: 503 AXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPA 562
                       FW ++ P G    +A +FFE YL+ PIL+  Y G+KL+ R WR++ P 
Sbjct: 488 GCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPT 547

Query: 563 NEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            E+DL S R+  D E+M+ E+  E++ +R  S   R    WC
Sbjct: 548 KEIDLDSGRRAVDLELMKDEKRIEEQAMRQKSLFARFIHLWC 589

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  383 bits (984), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 217/583 (37%), Positives = 317/583 (54%), Gaps = 26/583 (4%)

Query: 45  VDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAP-DDSSK-------------------- 83
           +D F+ P+EE  G +GI  +  +V        +P ++ SK                    
Sbjct: 16  IDGFRAPDEE--GEEGIGRSSSQVHSFTSNTPSPFNEKSKDSPIEDNIDITSQSSVTKED 73

Query: 84  -HKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
            +K+L +++  RH+L +++   IG G+ V +G +L +GGPASL+I + I+ST L+ VI S
Sbjct: 74  INKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINS 133

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
             ELA  +  + GGFN Y    VD +FAF+V+  Y  QWL +LPLELV AS+TIKYWN +
Sbjct: 134 LGELAAAF-PVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNST 192

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           IN DA                           +  K+L           ++CGG    GY
Sbjct: 193 INSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGY 252

Query: 263 LGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 322
           LG  YWH+PGAF G+    +FKGL +V V AAF+Y G E + ++AAE ++P+K+I  A+K
Sbjct: 253 LGGKYWHNPGAFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAK 312

Query: 323 KLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGVKVVPHXXXX 381
           +  + I   Y+    L+G LVPY+ P L+ G+ S    ASP VIAI + G+K +      
Sbjct: 313 RTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMNA 372

Query: 382 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVA 441
                                      G  PK    VD+RGRP+   LV+  FGLL F+A
Sbjct: 373 IILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIA 432

Query: 442 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAY 501
           AS K+  VFTWL A+SGLS +F W +I++SH+RFR++MI Q RSLDE+ Y S TGVWG+ 
Sbjct: 433 ASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSL 492

Query: 502 YAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIP 561
           Y            FW ++ P+G +  D  +FFE YL++PILI  Y+G+KL++++W  ++ 
Sbjct: 493 YGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVT 552

Query: 562 ANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
             E+DL + RK  D  + ++E + E+  +   S+ KR    WC
Sbjct: 553 LEEMDLDTGRKALDPHLHRAEVIAEEAAVAKMSFIKRFWHVWC 595

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  383 bits (984), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 219/621 (35%), Positives = 337/621 (54%), Gaps = 38/621 (6%)

Query: 2   KGFEMKN--IKSPEDGVVESF-------DSVEVVKET-----SPRSEGSRDGLFHRFVDS 47
           +GF+M N   K  +  +   F       +S+++ KET     +   +GS+   + +F+DS
Sbjct: 5   EGFQMSNQDYKDAKTNINTEFIDPDLESESIDIKKETFNYNQTGEEKGSK---WRQFIDS 61

Query: 48  FKR---PEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATG 104
           FKR   PE + N      +  ER++            + H  LK ++K RH+ MI++   
Sbjct: 62  FKRVEVPELDPN-----LTEQERIA----------IITAHTPLKHHLKSRHLQMIAIGGA 106

Query: 105 IGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALL 164
           IGTG+ VG+G +L   GPASL+IG++I  +M+Y ++ + +E+A++Y  +SGGF  Y    
Sbjct: 107 IGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEMAVLY-PISGGFTTYATRF 165

Query: 165 VDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSIN-PDAXXXXXXXXXXXXXXXX 223
           +D++F F+ ++ Y LQWL +LPLE+V+AS+T+ YW       D                 
Sbjct: 166 IDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRDGFVALFWLVIVIINLFG 225

Query: 224 XXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRF 283
                      +T KV+           + CGG    GY+G+ YWHDPGAF G     +F
Sbjct: 226 VKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAKYWHDPGAFVGATAGAQF 285

Query: 284 KGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLV 343
           +G  +V V AAF++ G+E   +  +E +NP+K++  A+K++ +RI+  Y+++   +G LV
Sbjct: 286 QGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAAKQVFWRILLFYILSLLFIGLLV 345

Query: 344 PYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXX 403
           P N   L+GS +    ASPFVIAI  HG++ +P                           
Sbjct: 346 PSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINVVILIAVLSVGNSAIYTCSRTLV 405

Query: 404 XXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELF 463
              EQGF PK+ +Y+DR GRP+  + +S  FGL+ FVA S KE  VF WLLAISGLS  F
Sbjct: 406 ALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVAQSDKEGDVFNWLLAISGLSSFF 465

Query: 464 TWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVG 523
           TW +I L H+RFR ++  Q RS DEL + S  GV+G+Y+           QF+VAI PVG
Sbjct: 466 TWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSYWGLFLIVLMLAAQFYVAIFPVG 525

Query: 524 SNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
                A NFF  YL++P+++ +Y+ +KLW ++W++ IP  ++DL + RK  D ++++ E 
Sbjct: 526 DTP-SATNFFSAYLSLPVVLVMYIAHKLWTKNWKIFIPLGQLDLDTGRKQLDLDLLRQEV 584

Query: 584 LEEKEQLRHASWTKRAAEFWC 604
            EE+  L       R   FWC
Sbjct: 585 AEERATLAARPRWFRIYTFWC 605

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  382 bits (980), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 227/603 (37%), Positives = 336/603 (55%), Gaps = 23/603 (3%)

Query: 5   EMKNIKSPEDGVVES--FDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIH 62
           E KN    ++  VES  F + E   E    S GS+   +  F +SFKR E          
Sbjct: 11  EKKNYSYAQEQYVESGEFTNHEASNE---ESSGSK---WQDFKNSFKRME---------- 54

Query: 63  STHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGP 122
                 +  + E++A   ++ +  LK+++K RH+ MI++   IGTG+ VG+GK+L   GP
Sbjct: 55  VVELDPNLTEAEKIAI--ATANSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGP 112

Query: 123 ASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWL 182
           A +LIG+A+  TM+YC++ +  ELA+ +  +SGGF  Y    +D++F ++ ++ Y LQWL
Sbjct: 113 AGILIGWALTGTMIYCMVMAMGELAVTF-PVSGGFTTYATRFIDESFGYANNFNYMLQWL 171

Query: 183 CILPLELVTASMTIKYW-NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLM 241
            +LPLE+V AS+T+ YW  D    D                            +  KV+ 
Sbjct: 172 VVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVIT 231

Query: 242 XXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAE 301
                     + CGG    GY+G   WH+PGAF GN    RFKG+ +V V AAF++ G+E
Sbjct: 232 VIGFIILGIILVCGGGPVGGYIGGANWHNPGAFVGNTAGKRFKGVCSVFVTAAFSFAGSE 291

Query: 302 FSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHAS 361
              L +AE  NP+KS+  A+K++ +RI   Y+++  L+G LVPYN   L+G+ S    AS
Sbjct: 292 LVGLASAETANPRKSLPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAAS 351

Query: 362 PFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRR 421
           PFV+AI +HG+K +P                              EQGF PK+F Y+DR+
Sbjct: 352 PFVLAIKNHGIKGLPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRK 411

Query: 422 GRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIV 481
           GRP+  +  +  FGLL F+AASPKE  VF WLLA+SGLS LFTW +I + H+RFRR++  
Sbjct: 412 GRPLVGIGFTSFFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSA 471

Query: 482 QGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPI 541
           QGRS DEL + S  GVWG+ Y           QFW+A+ P+GS   DA +FFE+YL++P+
Sbjct: 472 QGRSTDELSFVSPAGVWGSIYGTVLIMLILAAQFWIALFPIGSPP-DAKDFFESYLSLPV 530

Query: 542 LIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAE 601
           ++ +Y+G+K + R+W++ I A  +D+ + R+  D E ++ E  EEK  L   S   R+  
Sbjct: 531 VLVMYIGHKCYKRNWKLFIRAENIDIDTGRREVDIEALKVELAEEKAVLASKSLWIRSYY 590

Query: 602 FWC 604
           FWC
Sbjct: 591 FWC 593

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  382 bits (980), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 213/582 (36%), Positives = 316/582 (54%), Gaps = 15/582 (2%)

Query: 37  RDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSG-------------EDFERLAPDDSSK 83
           R+G  ++ V+ FK  E+E +  +G  ST   +                D      + S  
Sbjct: 7   RNGPLNKIVNGFKSAEDEKSILEGKSSTQSSLLDLTLKKCDNGIEVVNDATSTVSNASVT 66

Query: 84  HKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSA 143
           +  L +N+  RH+L +++   IG G+ V +G +L +GGPASL+I + I+ST L+ VI + 
Sbjct: 67  NVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINAL 126

Query: 144 SELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSI 203
            E+A  +  + GGFN Y    VD +  F+V+  Y  QWL +LPLELV ASMTIKYWND+I
Sbjct: 127 GEMAAAF-PVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDTI 185

Query: 204 NPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYL 263
           N DA                           +  K+L           ++CGG    GYL
Sbjct: 186 NSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYL 245

Query: 264 GSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKK 323
           G  YWH+PG+F G+    +FKGL +V V AAF+Y G E + ++AAE ++P+++I  A+K+
Sbjct: 246 GGKYWHNPGSFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKR 305

Query: 324 LVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGVKVVPHXXXXX 382
             + I   Y+    L+G LVPY+ P LL GS S    +SP VIAI + G+K +P      
Sbjct: 306 TFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMNAI 365

Query: 383 XXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAA 442
                                     G  P++  ++D++GRPV  +L +  FGLL FVAA
Sbjct: 366 ILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAA 425

Query: 443 SPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYY 502
           S K+  VFTWL A+SGLS +F W +I++SH+RFR++M  Q +SLDEL Y S TGVWG++Y
Sbjct: 426 SDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWY 485

Query: 503 AXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPA 562
                       FW ++ P+G +  DA +FF+ YL+ PILI  Y+G+KL YR  ++++  
Sbjct: 486 GVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVAL 545

Query: 563 NEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            ++D+ + R+  D  I + E  EE+E L  +S+  R    WC
Sbjct: 546 EDMDIDTGRRQVDLTIRRQEMKEEQEHLAKSSFFARFLHVWC 587

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  381 bits (979), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/600 (35%), Positives = 320/600 (53%), Gaps = 14/600 (2%)

Query: 6   MKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTH 65
           M  ++S    +++SF   E  K++S R++ S                 ++   D   S +
Sbjct: 1   MAKVQSSWQRMLDSFKPAETYKQSS-RNDMS----------PLTSEAPDFKKADA-ASGN 48

Query: 66  ERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASL 125
           E  + E+ E  +    ++     +++  RH+L +++   IGTG+ V +G +L  GGP SL
Sbjct: 49  ESWALENVESTSGTSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSL 108

Query: 126 LIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCIL 185
           +I + I+ST L+ ++ +  EL+  +  + GGFN Y +  V+ +F F+V+  Y  QW  +L
Sbjct: 109 VIDWVIISTCLFTIVNALGELSSTF-PVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLL 167

Query: 186 PLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXX 245
           PLELV AS+TI+YWN +IN DA                           +  K+L     
Sbjct: 168 PLELVAASLTIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGF 227

Query: 246 XXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVL 305
                 + CGG    GY+G  YW +PGAF GN    RF GL +V V AAF+Y G E   +
Sbjct: 228 TILGIVLTCGGGPEGGYIGGKYWSNPGAFVGNTSSQRFHGLCSVFVTAAFSYSGTELIAV 287

Query: 306 TAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFV 364
           +AAE  NP+ ++  A K+  + I   Y++   L+G LVP + P LL GS S    ASP V
Sbjct: 288 SAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLV 347

Query: 365 IAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRP 424
           IAI + G+K +P                                G  PK F+YVDR+GRP
Sbjct: 348 IAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRP 407

Query: 425 VRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGR 484
           +  +L + +FGLL F+AAS K+ETVFTWL A+SGLS LF WF+I++SH+RFR +M  +GR
Sbjct: 408 LYAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGR 467

Query: 485 SLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIG 544
           SLDEL + S TGVWG+YY            FW A+ P       A +FFE YL+ PIL+ 
Sbjct: 468 SLDELPFVSMTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLV 527

Query: 545 LYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            Y+G+KL+ + WR++ P  E+D+ S R+  D E+++ E+  E++ +R  S+  R    WC
Sbjct: 528 CYIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREKSYLTRFLHLWC 587

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  380 bits (975), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 206/563 (36%), Positives = 315/563 (55%), Gaps = 15/563 (2%)

Query: 43  RFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLA 102
           R  DSFKR E+E    +   +          ER+A +  +    LK  +K RH+ M+++ 
Sbjct: 63  RIKDSFKRAEKEEVDPNLTEA----------ERIAIN--TAKAPLKHTLKGRHMQMVAIG 110

Query: 103 TGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPA 162
             IG+G+ VG+  +L   GPA ++IG+ + STM+YC++ +  ELA+++  +SGGF  Y  
Sbjct: 111 GAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVF-PVSGGFTTYAT 169

Query: 163 LLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSIN-PDAXXXXXXXXXXXXXX 221
             +D++F F+ ++ Y LQWL  LPLE+V+AS+T+ YW       D               
Sbjct: 170 RFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRDGFVALFWLVIVIINL 229

Query: 222 XXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGIN 281
                        +T KVL           +  GG    G++G  YWH+PGAF G+N   
Sbjct: 230 FGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPGAFVGDNAGT 289

Query: 282 RFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGF 341
           +FKG+ +V V AAF++ G+E   +TAAE  NP+KS+  A+K++V+RI+  Y+ +  ++G 
Sbjct: 290 QFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGL 349

Query: 342 LVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXX 401
           LVPY  P L+G+ S    ASPFVIAI +HG++ +P                         
Sbjct: 350 LVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRT 409

Query: 402 XXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSE 461
                EQGF P++F Y+DR+GRP+  ++V   FGL+ F+AAS K+  VF WL+A+SGLS 
Sbjct: 410 IAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSS 469

Query: 462 LFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISP 521
           LFTW  I L H+RFR ++  QGRS +EL + S  G+ G+ +           QF+VA+ P
Sbjct: 470 LFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLFMLLLMFIAQFYVALFP 529

Query: 522 VGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQS 581
            GS K  A  FFE+YL+ PI++  Y G+K++ ++W++ I A ++D+ + R+  D E+++ 
Sbjct: 530 PGS-KPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKAEDMDIDTGRRETDLELLKQ 588

Query: 582 EQLEEKEQLRHASWTKRAAEFWC 604
           E  EEK  L    W  R  +FWC
Sbjct: 589 EIEEEKAILATKGWWYRQYQFWC 611

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  379 bits (973), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 213/614 (34%), Positives = 329/614 (53%), Gaps = 28/614 (4%)

Query: 2   KGFEMKNIKSPEDGVVESFDSVEVVKE-------TSPRSEGSRDGLFHRFVDSFKR---P 51
           K +  K++++    V E+   VE                +G  D  + +  DSFKR   P
Sbjct: 4   KEYTTKDVEAGNVQVKETLPDVETGASYEHYDNYIDEEEQGPPDSRWKKIKDSFKRAEVP 63

Query: 52  EEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLV 111
           E + N  +              E++A   ++    L+  +K RH+ MIS+   IGTG+ V
Sbjct: 64  ELDPNLTEA-------------EKIAI--ATARSPLQHQLKNRHLQMISIGGAIGTGLFV 108

Query: 112 GNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAF 171
           G+G +L   GPA +LIG+ I  +M+YC++ S +ELAI +  ++GGF  Y    +D+++ F
Sbjct: 109 GSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAELAIAF-PVAGGFTTYATRFIDESYGF 167

Query: 172 SVSWVYCLQWLCILPLELVTASMTIKYWN-DSINPDAXXXXXXXXXXXXXXXXXXXXXXX 230
           + ++ Y LQW+  LPLE+V AS+T+ YW+ D    D                        
Sbjct: 168 ANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRDGFVALFWVVIVIINMFGVRGYGEA 227

Query: 231 XXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVL 290
               + CK+LM          + CGG    GY+G+ YW+ PGAF G+    +FKG  +V 
Sbjct: 228 EFIFSICKILMIVGFIILAIILICGGGPGTGYIGARYWYHPGAFAGDTSGRKFKGFCSVF 287

Query: 291 VNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPEL 350
           V AAF++ G+E   L AAE  NP+K +  A+K++ +RI   Y++   L+G LVPY  P L
Sbjct: 288 VTAAFSFAGSELVGLAAAEASNPRKDVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRL 347

Query: 351 LGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGF 410
           +G  S    ASPFVIAI + G+  +P                              +QGF
Sbjct: 348 IGGSSVDAAASPFVIAIKNQGISGLPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGF 407

Query: 411 APKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISL 470
            PK F+Y+DR GRP+  + V+  FGL+ FVA S KE  VF WL+A+SGLS LFTW +I L
Sbjct: 408 LPKCFSYIDRMGRPMVGIAVTSAFGLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICL 467

Query: 471 SHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDAN 530
            H+RFRR++  QGRS +EL + S  GVWGA +           QF+VA+ P+G+    AN
Sbjct: 468 CHIRFRRALAAQGRSTNELAFASPAGVWGAAWGLFLCIIMLAAQFYVALFPLGAPP-SAN 526

Query: 531 NFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQL 590
           +FF+ YL++PI++ ++LG+K+W ++W++ I A ++D+ + R+  D ++++ +  EE+  L
Sbjct: 527 DFFQGYLSLPIVLAMWLGHKIWKKNWKLFIKAEDMDIDTGRRELDLDLLRQQVEEERAAL 586

Query: 591 RHASWTKRAAEFWC 604
                  R  +F+C
Sbjct: 587 AAKPMWYRIYKFFC 600

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  379 bits (973), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 207/524 (39%), Positives = 307/524 (58%), Gaps = 3/524 (0%)

Query: 82  SKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQ 141
           +    LK ++K RH+ MI++   IGTG+LVG+G +L  GGPASLLIG+    TM+Y ++ 
Sbjct: 81  TAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVM 140

Query: 142 SASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW-N 200
           +  ELA+I+  +SGGF  Y    +D++F ++ ++ Y LQWL +LPLE+V+AS+T+ +W  
Sbjct: 141 ALGELAVIF-PISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT 199

Query: 201 DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND 260
           D    D                            +  KV+           +NCGG    
Sbjct: 200 DPKYRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEG 259

Query: 261 GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 320
           GY+G  YWHDPGAF G+    +FKGL +V V +AF++ G+E   L A+E  +P+KS+  A
Sbjct: 260 GYIGGKYWHDPGAFAGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKA 319

Query: 321 SKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXX 380
           +K++ +RI   Y+++  ++G LVPYN P L+G+ S    ASPFVIAI +HG+K +P    
Sbjct: 320 AKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTVVN 379

Query: 381 XXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFV 440
                                     EQ F P++F YVDR+GRP+  + V+  FGL+ FV
Sbjct: 380 VVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIAFV 439

Query: 441 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGA 500
           AAS KE  VF WLLA+SGLS LFTW  I + H+RFR+++  QGR LDEL ++S TGVWG+
Sbjct: 440 AASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGS 499

Query: 501 YYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVII 560
           Y+           QF+VA+ PVG++   A  FFE YL+ P+++ +YLG+K++ R+W++ I
Sbjct: 500 YWGLFMVVIMFIAQFYVALFPVGASP-SAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLFI 558

Query: 561 PANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           PA ++D+ + R+  D E+++ E  EEK  +       R   FWC
Sbjct: 559 PAEDMDIDTGRREVDLELLKQEIAEEKAIMATKPKWYRIWNFWC 602

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  379 bits (973), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 212/554 (38%), Positives = 303/554 (54%), Gaps = 9/554 (1%)

Query: 57  GGDGIHSTHERVSGEDFERLAPDDSSKHK-----TLKQNIKPRHVLMISLATGIGTGMLV 111
           G  G++ T   ++     R   DD  + +      L + +  RH+L +++   IGTG+ V
Sbjct: 53  GSSGVNQTTNDITSSG--RFHSDDDVQQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFV 110

Query: 112 GNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAF 171
             G +L  GGPASL+I + I+ST L+ VI S  EL+  +  + GGFN Y    V+ +FAF
Sbjct: 111 NTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAF-PVVGGFNVYSMRFVEPSFAF 169

Query: 172 SVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXX 231
           +V+  Y  QWL +LPLELV AS+TIKYWND IN DA                        
Sbjct: 170 AVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETE 229

Query: 232 XXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLV 291
              +  K+L           ++CGG  + GY+G  YW+DPGAF G++   +FKGL +V V
Sbjct: 230 FVLSMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAFVGHDSGTKFKGLCSVFV 289

Query: 292 NAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL 351
            AAF+Y G E + ++AAE +NP+++I  A+K+  + I   Y+    L+G LVP N P LL
Sbjct: 290 TAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLL 349

Query: 352 -GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGF 410
            GS S    +SP VIAI +  +K +P                                G 
Sbjct: 350 NGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGN 409

Query: 411 APKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISL 470
            PK    VD+RGRP+  ++++  FGLL FVAAS K+  VFTWL A+SGLS +F W +I+L
Sbjct: 410 LPKFLRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINL 469

Query: 471 SHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDAN 530
           SH+RFR++M  Q RSLDEL + S TGVWG+ Y            FW ++ P+GS+  +A 
Sbjct: 470 SHIRFRQAMKFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAE 529

Query: 531 NFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQL 590
           +FFE YL+ PILI  Y G+K++ RDWR+++   ++DL + RK  D  + + E   E+E L
Sbjct: 530 SFFEGYLSFPILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETL 589

Query: 591 RHASWTKRAAEFWC 604
              S+  R    WC
Sbjct: 590 AKRSFLTRFLRVWC 603

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  378 bits (970), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 206/523 (39%), Positives = 299/523 (57%), Gaps = 9/523 (1%)

Query: 78  PDDSS-------KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYA 130
           P+DS+           L +++  RH+L +++   IGTG+ V +G SL+ GGPASL+IG+ 
Sbjct: 73  PNDSNMLSKEDIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWV 132

Query: 131 IVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELV 190
           IVST L+ VI S  ELA  Y  + GGF+ Y    +D + AFS++  Y +QWL +LPLELV
Sbjct: 133 IVSTALFTVINSLGELAAAY-PVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELV 191

Query: 191 TASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXX 250
            AS+TI+YWND IN DA                           +  K+L          
Sbjct: 192 AASITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGI 251

Query: 251 XVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQ 310
            ++CGG    GY+G  YWHDPGAF G+   ++FKGL +V V AAF+Y G E   ++AAE 
Sbjct: 252 VLSCGGGPVGGYIGGKYWHDPGAFVGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAES 311

Query: 311 QNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIAS 369
            +P+K+I  A+K+  + I   Y+    L+G LVPY+ P LL GS S    +SP VIAI +
Sbjct: 312 IDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIEN 371

Query: 370 HGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLL 429
            G+K +P                                G  PK    +D++GRP+   L
Sbjct: 372 GGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATL 431

Query: 430 VSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDEL 489
           V+  FGL+ FVAAS K+  VFTWL A+SGLS +F W  I++SH+RFRR+M +QGRSL+E+
Sbjct: 432 VTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEM 491

Query: 490 GYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGY 549
            Y S  GV+G++Y            FW ++ PVGS++ +A  FFE YL++PIL+  Y+G+
Sbjct: 492 PYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGH 551

Query: 550 KLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRH 592
           K ++++WR+  P NE+DL S ++  D E+++ E+  E+  L+ 
Sbjct: 552 KFYFKNWRLFTPYNEIDLDSGKRDIDLELLREEKKMEELALKK 594

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  378 bits (971), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 211/547 (38%), Positives = 304/547 (55%), Gaps = 6/547 (1%)

Query: 59  DGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLH 118
           + I S+      +D E++  ++++    L +++  RH+L +++   IGTG+ V  G +L 
Sbjct: 62  NDITSSERSRDNDDVEQVDINNTN----LNKDLSVRHLLTLAVGGAIGTGLYVNTGTALS 117

Query: 119 NGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYC 178
            GGPASL+I + I+ T L+ VI S  EL+  +  + GGFN Y    V+ +FAF+V+  Y 
Sbjct: 118 TGGPASLVIDWVIIGTCLFTVINSLGELSAAF-PVVGGFNVYGMRFVEPSFAFAVNLNYL 176

Query: 179 LQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCK 238
            QWL +LPLELV AS+TIKYWND IN DA                           +  K
Sbjct: 177 AQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIK 236

Query: 239 VLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYG 298
           +L           ++CGG  + GY+G  YW +PGAF G+N   +FKGL +V V AAF+Y 
Sbjct: 237 ILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAFVGHNSGTKFKGLCSVFVTAAFSYS 296

Query: 299 GAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAA 357
           G E + ++AAE +NP+++I  A+K+  + I   Y+    L+G LVP N P LL GS S  
Sbjct: 297 GIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVD 356

Query: 358 THASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNY 417
             +SP VIAI +  +K +P                                G  PK  N 
Sbjct: 357 AASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNR 416

Query: 418 VDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRR 477
           VD+RGRP+  +L++  FGLL FVAAS KE  VFTWL A+SGLS +F W +I+LSH+RFR+
Sbjct: 417 VDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRK 476

Query: 478 SMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYL 537
           +M VQ RSLDEL + S TGV G++Y            FW ++ P+GS+   A +FFE YL
Sbjct: 477 AMKVQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYL 536

Query: 538 AMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTK 597
           + PILI  Y G+K++ R+W +++   ++DL + RK  D  + + E   E+E L   S+  
Sbjct: 537 SFPILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIERENLAKKSFIT 596

Query: 598 RAAEFWC 604
           R   FWC
Sbjct: 597 RFLHFWC 603

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  377 bits (968), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 226/601 (37%), Positives = 320/601 (53%), Gaps = 13/601 (2%)

Query: 16  VVESFDSVEVVKETSPRSEGSRDGLF-----HRFVDSFKRPEEEYN------GGDGIHST 64
           VV+ F      +  +P + GS  G       + F+ +     E YN      G  G   +
Sbjct: 14  VVDGFRPAASARAEAPVTTGSTGGDSLGDEKNGFMGAGTTSYEMYNYSNSSTGAGGKGDS 73

Query: 65  HERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPAS 124
           H     E    +  +D   H  + +++  RH+L +++   IGTG+ V +G +L +GGPAS
Sbjct: 74  HSLTRDEAGSGVMKEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPAS 133

Query: 125 LLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCI 184
           L+I + I+ST L+ V+ S  ELA  +  + GGFN Y    +D +F F+V+  Y  QWL +
Sbjct: 134 LVIDWVIISTCLFTVVNSLGELAAAF-PVVGGFNVYITRFIDPSFGFAVNINYLAQWLVL 192

Query: 185 LPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXX 244
           LPLELV AS+TI+YWND IN DA                           +  K+L    
Sbjct: 193 LPLELVAASITIRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVG 252

Query: 245 XXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSV 304
                  ++CGG    GY+G  YWHDPGAF G     +FKGL +V V AAF+Y G E + 
Sbjct: 253 FTILGIVLSCGGGPKGGYIGGKYWHDPGAFVGETSGTKFKGLCSVFVTAAFSYSGMELTA 312

Query: 305 LTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPF 363
           ++AAE  NP+++I  A+K+  + I   Y+    L+G LVPYN+P+LL GS S    +SP 
Sbjct: 313 VSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPL 372

Query: 364 VIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGR 423
           VIAI + G++ +P                                   P+    VDR+GR
Sbjct: 373 VIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGR 432

Query: 424 PVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQG 483
           P+   L++  FGLL F+AAS K+E VFTWL A+SGLS +F W +I+LSH+RFR++M  QG
Sbjct: 433 PLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQG 492

Query: 484 RSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILI 543
            SLDEL Y S TGV G++Y            FW ++ P+G    DA +FFE YL+ PILI
Sbjct: 493 ISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILI 552

Query: 544 GLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFW 603
             Y+G+KL+ R  R++I   ++DLVS RK+ D E+ + E   EKEQL   S+  R    W
Sbjct: 553 VCYVGHKLYIRKKRLLIDVADMDLVSDRKVVDVEVCREEMRIEKEQLAKRSFFARFLHLW 612

Query: 604 C 604
           C
Sbjct: 613 C 613

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  378 bits (971), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/558 (39%), Positives = 307/558 (55%), Gaps = 6/558 (1%)

Query: 52  EEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTL----KQNIKPRHVLMISLATGIGT 107
           E++    D I    +R         +  D  +   L     +++  RH+L +++   IGT
Sbjct: 102 EDKLPFSDDIRDVKDRSDFSSSFVSSARDKDEETLLATDMNKDLSVRHLLTLAVGGAIGT 161

Query: 108 GMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDK 167
           G+ V +G SL+ GGPASL+IG+ IVST L+ VI S  ELA  +  + GGF+ Y    VD 
Sbjct: 162 GLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGELAAAF-PVVGGFSVYMDKFVDP 220

Query: 168 AFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXX 227
           +FAF+V+  Y LQWL +LPLELV AS+TI+YWN SIN DA                    
Sbjct: 221 SFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINSDAWVSIFYVAIGLANMLDVKSF 280

Query: 228 XXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLV 287
                  +  K+L           ++CGG  +  Y+G  YWHDPGAF G    ++FKGL 
Sbjct: 281 GETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGKYWHDPGAFVGTTSGSKFKGLC 340

Query: 288 AVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNS 347
           +V V AAF++ G E + ++AAE +NP+++I  A+K+  + I G Y+    L+G LVPYN 
Sbjct: 341 SVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYND 400

Query: 348 PELL-GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 406
           P L+ GS S    +SP VIAI +  +  +P                              
Sbjct: 401 PRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMS 460

Query: 407 EQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWF 466
           +    PK+F  VDRRGRP+  +     FGLL FVAAS K+  VFTWL A+SGLS +F W 
Sbjct: 461 KIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWM 520

Query: 467 SISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNK 526
            I+L H+RFR+ M VQ  SLDEL + S TG+WG+ Y            FW ++ PVGS+K
Sbjct: 521 GINLCHIRFRQGMHVQQISLDELPFLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSK 580

Query: 527 LDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEE 586
            +A +FFE YL+ PIL+G Y+ +K+++++WR  IPA+++DL S RK  D E+++ E   E
Sbjct: 581 ANATSFFEGYLSFPILLGCYIAHKVYFKNWRWYIPASKMDLHSGRKQVDLEVVREELRLE 640

Query: 587 KEQLRHASWTKRAAEFWC 604
           KE L   S+  R    WC
Sbjct: 641 KEHLAQRSFFYRFLHVWC 658

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  375 bits (962), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 214/549 (38%), Positives = 305/549 (55%), Gaps = 5/549 (0%)

Query: 60  GIHSTHERVSGEDFERLAPDDSSK---HKTLKQNIKPRHVLMISLATGIGTGMLVGNGKS 116
           GI+ T   ++  D  R   D   +   +  L +++  RH+L +++   IGTG+ V  G +
Sbjct: 56  GINQTTNDITSSDRFRRNEDTEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAA 115

Query: 117 LHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWV 176
           L  GGPASL+I + I+ST L+ VI S  EL+  +  + GGFN Y    ++ +FAF+V+  
Sbjct: 116 LSTGGPASLVIDWVIISTCLFTVINSLGELSAAF-PVVGGFNVYSMRFIEPSFAFAVNLN 174

Query: 177 YCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNT 236
           Y  QWL +LPLELV AS+TIKYWND IN DA                           + 
Sbjct: 175 YLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSM 234

Query: 237 CKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFA 296
            K+L           ++CGG  + GY+G  YWHDPGAF G++   +FKGL +V V AAF+
Sbjct: 235 IKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFS 294

Query: 297 YGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGS 355
           Y G E + ++AAE +NP+++I  A+K+  + I   Y+    L+G LVP N P LL GS S
Sbjct: 295 YSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSS 354

Query: 356 AATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLF 415
               +SP VIAI + G+K +P                                G  PK  
Sbjct: 355 VDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFL 414

Query: 416 NYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRF 475
           N VD+RGRP+  +L++  FGLL FVAAS K+  VFTWL A+SGLS +F W +I+LSH+RF
Sbjct: 415 NRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRF 474

Query: 476 RRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFEN 535
           R++M VQ RSLDEL + S TGV G++Y            FW ++ P+G +   A +FFE 
Sbjct: 475 RQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEG 534

Query: 536 YLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASW 595
           YL+ PILI  Y+G+KL+ R+W +++   ++DL + RK  D  + + E   E+E L   S+
Sbjct: 535 YLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVDLTLRREEMRIERETLAKRSF 594

Query: 596 TKRAAEFWC 604
             R   FWC
Sbjct: 595 VTRFLHFWC 603

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  374 bits (961), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/596 (34%), Positives = 320/596 (53%), Gaps = 15/596 (2%)

Query: 10  KSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVS 69
           K  ++ VVE+     V  + S  S       + RF +SFKR EE     D   +  ER++
Sbjct: 14  KGGDNVVVENISQEPVSYDQSQGSSTEAHSRWGRFKESFKRAEEMEL--DPNLTEAERIA 71

Query: 70  GEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGY 129
                       +    LK ++K RH+ MI++   IGTG+ VG+G +L   GPA +LIG+
Sbjct: 72  ----------IKTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGW 121

Query: 130 AIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLEL 189
            +  TM+Y ++ +  ELA+++  ++GGF  Y    VD++F F+ +++Y LQWL +LPLE+
Sbjct: 122 GLTGTMIYSMVMAVGELAVVF-PVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEI 180

Query: 190 VTASMTIKYW-NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXX 248
           V AS+T+ YW  D    D                            +  KV+        
Sbjct: 181 VAASITVNYWGTDPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIM 240

Query: 249 XXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAA 308
              + CGG  +  Y+G+ YW++PGAF G+    +F+G   V V AAF++ G+E   L  +
Sbjct: 241 AIVLICGGGKDHKYIGAQYWYNPGAFVGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGS 300

Query: 309 EQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIA 368
           E + P+KS+  A+K++ +RI   Y++   L+G LVP +SP L+G+ S    ASPFVIAI 
Sbjct: 301 EAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIV 360

Query: 369 SHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCL 428
           +HG+K +P                              +QGF P +  Y+DR GRP+  +
Sbjct: 361 NHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGI 420

Query: 429 LVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDE 488
            +S  FGL+ FVA S KE  VF WL+A+SGLS LFTW  I L H+R+R ++  QGRS DE
Sbjct: 421 AISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDE 480

Query: 489 LGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLG 548
           L +Q+  GVWG+Y+           QF+V + P G+ K +A +FF  YL+  I I LY  
Sbjct: 481 LPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGT-KPNAYDFFLAYLSFCIFIALYAF 539

Query: 549 YKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           +K+W R+W++ IP  ++D+ + R+  D ++++ E  EE+  L    +  R+ +FWC
Sbjct: 540 HKIWKRNWKLFIPLKDLDIDTGRREVDLDVLREELAEERAALAARPFWYRSWKFWC 595

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  372 bits (955), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/524 (39%), Positives = 302/524 (57%), Gaps = 4/524 (0%)

Query: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
            +  L +N+  RH++ +++   IGTG+ V +G +L +GGPASL++G+ I+ST L+ VI S
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
             ELA  +  + GGFN Y    VD +  F+V+  Y  QWL +LPLELV AS+TIKYWND 
Sbjct: 99  LGELAAAF-PIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           IN DA                           +  K+L           +  GG  + GY
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 263 LGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 322
           LG  YW++PGAF G    ++FKGL +V V AAF++ G E   ++AAE +NP+K I  A+K
Sbjct: 218 LGFKYWNNPGAFVGGTNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIPKAAK 277

Query: 323 KLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAA-THASPFVIAIASHGVKVVPHXXXX 381
           +  + +   Y++   L+G LVPYN   LL + ++    ASP VIAI + G+K +P     
Sbjct: 278 RTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLPSLMNA 337

Query: 382 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVA 441
                                      G  PK+ + VD++GRP+  L+V+ +FGLL F+A
Sbjct: 338 IILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFIA 397

Query: 442 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAY 501
           AS K+  VFTWL A+SGLS +F W +I+ S +RFRR+M VQ RSLDEL Y S TG+WGA+
Sbjct: 398 ASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGIWGAW 457

Query: 502 YAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWY-RDWRVII 560
           Y            FW ++ P+GS   DA +FFE++L++PIL+  Y G+KL++ R+WR+ I
Sbjct: 458 YGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARNWRLQI 517

Query: 561 PANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            A E+D+ S RKI D E ++ E+ EE+E+  ++S+  +    WC
Sbjct: 518 GAEEMDIDSGRKIIDEEGLKQER-EEEEKAMNSSFLIKFWHVWC 560

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  372 bits (954), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 211/595 (35%), Positives = 321/595 (53%), Gaps = 17/595 (2%)

Query: 11  SPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSG 70
           S +D V ES +S +   +    +  S    +  F+DSFKR E E              + 
Sbjct: 26  SGQDIVSESLESFD--NQIDSSNYASHRSAWGNFLDSFKRVEVE----------EVDPNL 73

Query: 71  EDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYA 130
            D E++A    +    L+  +K RH+ MI++   IGTG+ VG+G++L   GPA +LIG++
Sbjct: 74  TDLEKIAIK--TARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWS 131

Query: 131 IVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELV 190
           I  TM++ ++ +  ELA+++  +SGGF  Y    +D++F F+ ++ Y LQWL +LPLE+V
Sbjct: 132 ITGTMIFTMVMALGELAVMF-PVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIV 190

Query: 191 TASMTIKYWNDSIN-PDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXX 249
            AS+T+ YW   +   D                            +  KV          
Sbjct: 191 AASITVAYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILG 250

Query: 250 XXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309
             + CGG    GY+G+ YWH+PGAF G+    +F G  +V V AAF++ G+E   L  +E
Sbjct: 251 IVLVCGGGPVGGYVGARYWHNPGAFVGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSE 310

Query: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIAS 369
            +NP+K++ SA+K++ +RI+  Y++   L+GFLVPYN P L+ S S    ASPFVIAI +
Sbjct: 311 AKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVT 370

Query: 370 HGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLL 429
           HG+  +P                              EQGF PK+ +Y+DR+GRP+  + 
Sbjct: 371 HGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIA 430

Query: 430 VSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDEL 489
           +S  FGL+ FVAAS K+  +F WLLAISGLS  FTW +I + H+RFR ++  QGR  DEL
Sbjct: 431 ISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDEL 490

Query: 490 GYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGY 549
            + S  GV G+Y+           QF++A+ P+G +   A  FF  YLA P+++  Y+ +
Sbjct: 491 PFVSPAGVIGSYWGLFLNILMLIAQFYIALFPIGGSP-SAYEFFSAYLAAPVILAFYIAH 549

Query: 550 KLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           KLW ++W+ +IP  +VD+ + R+  D  +++ E  EEK  L    W  R   FWC
Sbjct: 550 KLWKKNWKFLIPLEDVDIDTGRRDTDVNLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  371 bits (953), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 204/524 (38%), Positives = 305/524 (58%), Gaps = 3/524 (0%)

Query: 82  SKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQ 141
           +    LK ++K RH+ MI++   IGTG+LVG+G +L  GGPASLLIG+    TM+Y ++ 
Sbjct: 81  TAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVM 140

Query: 142 SASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW-N 200
           +  ELA+I+  +SGGF  Y    +D++F ++ ++ Y LQWL +LPLE+V+AS+T+ +W  
Sbjct: 141 ALGELAVIF-PISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT 199

Query: 201 DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND 260
           D    D                            +  KV+           +NCGG    
Sbjct: 200 DPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTG 259

Query: 261 GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 320
           GY+G  YWHDPGAF G+    +FKG+ +V V AAF++ G+E   L A+E   P+KS+  A
Sbjct: 260 GYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKA 319

Query: 321 SKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXX 380
           +K++ +RI   Y+++  ++G LVPYN   L+G+ S    ASPFVIAI +HG+K +P    
Sbjct: 320 AKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSVVN 379

Query: 381 XXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFV 440
                                     EQ F P++F+YVDR+GRP+  + V+  FGL+ FV
Sbjct: 380 VVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFV 439

Query: 441 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGA 500
           AAS KE  VF WLLA+SGLS LFTW  I + H+RFR+++  QGR LDEL ++S TGVWG+
Sbjct: 440 AASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGS 499

Query: 501 YYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVII 560
           Y+           QF+VA+ PVG +   A  FFE YL+ P+++ +Y+G+K++ R+W++ I
Sbjct: 500 YWGLFMVIIMFIAQFYVAVFPVGDSP-SAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFI 558

Query: 561 PANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           PA ++D+ + R+  D ++++ E  EEK  +       R   FWC
Sbjct: 559 PAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWNFWC 602

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  371 bits (952), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/599 (34%), Positives = 326/599 (54%), Gaps = 18/599 (3%)

Query: 7   KNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHE 66
           KN  S ++ VVES  S E    +S    GS+   +  F DSFKR          + S   
Sbjct: 19  KNYISNQENVVESGASQEDYSNSSYPKSGSK---WKDFKDSFKR----------MDSVDL 65

Query: 67  RVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLL 126
             +  D +++A   S     L++ +K RH+ MI++   IGTG+ +G+ K+L   GPA +L
Sbjct: 66  DPNLTDAQKIAILTS--QSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGIL 123

Query: 127 IGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILP 186
           IG+ +++TM+ C+  S  E+A+ +  +SGG+  Y    +D+++ F+ +  Y +Q L +LP
Sbjct: 124 IGWGLMATMILCMCLSLGEMAVTF-PVSGGYTTYATRFIDESYGFANNINYMMQALVVLP 182

Query: 187 LELVTASMTIKYWN-DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXX 245
           LE+V AS+T+ YW   S    A                           +  KV+     
Sbjct: 183 LEIVAASITVDYWGPKSQYRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGF 242

Query: 246 XXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVL 305
                 + CGG     Y+GS +W +PGAF G+    +FKG+ +V V AAF++   E   L
Sbjct: 243 IILGVILVCGGGPTHEYIGSKFWSNPGAFVGDTAGQKFKGICSVFVTAAFSFANTELVGL 302

Query: 306 TAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVI 365
            AAE ++P+KS+  A+K++ +RI   Y+++  ++G LVPY  P LLGS      ASPFV+
Sbjct: 303 AAAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVL 362

Query: 366 AIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPV 425
           A+ +HG+K +P                              EQGF P +F Y+DR+GRP+
Sbjct: 363 ALKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPL 422

Query: 426 RCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRS 485
             ++ S  FGLLCF+A S + + +F W+L++SGLS LF W +ISL H+RFR+++  Q RS
Sbjct: 423 VSIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRS 482

Query: 486 LDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGL 545
           +DEL + S  G+WG+YY+          QFW+A+ P G  K  A+NFF+ YL+MPI + +
Sbjct: 483 IDELAFASPIGIWGSYYSVFLIIVVLILQFWIALFP-GHQKPSASNFFKAYLSMPIAVAM 541

Query: 546 YLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           YLG+K++ ++W+++I    +D+ + R+  D E+ + E LE+   +    +  R   FWC
Sbjct: 542 YLGHKIYTKNWKLLIDPKYMDIDTGRRELDIELFKQELLEQNAIMAKKPFIYRVYNFWC 600

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  371 bits (953), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/577 (37%), Positives = 313/577 (54%), Gaps = 12/577 (2%)

Query: 29  TSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLK 88
           +SP  E S D +     DS  +      GG       E    E F  +A +D +++  L 
Sbjct: 44  SSPIPEKSSDNMTTYVTDSKTK-----EGGS--EKNIETTPSEQFS-IAKEDINEN--LN 93

Query: 89  QNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAI 148
           +++  RH++ +++   IG G+ V +G +L +GGPASL+I + I+ST L+ VI +  ELA 
Sbjct: 94  KDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAA 153

Query: 149 IYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAX 208
            Y  + GGFN Y    VD + AF+++  Y  QWL +LPLELV AS+TIKYWND+IN DA 
Sbjct: 154 AY-PVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTINSDAW 212

Query: 209 XXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYW 268
                                     +  K+L           + CGG    G+LG  YW
Sbjct: 213 VAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYW 272

Query: 269 HDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRI 328
           HDPG+F G+    +FKGL +V V AAF+Y G E + ++AAE ++P+K+I  A+K+  + +
Sbjct: 273 HDPGSFVGDKPGTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLV 332

Query: 329 IGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXX 387
              Y+    ++G LVP++ P LL GS S    ASP VI+I + G+K +            
Sbjct: 333 TASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLMNAIILISI 392

Query: 388 XXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEE 447
                                G  PK+ + VD+RGRPV  +L +  FGLL F+AAS K+ 
Sbjct: 393 VSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQA 452

Query: 448 TVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXX 507
            VFTWL A+SGLS +F W +I+ SH+RFR +M VQ ++LDEL Y S  GV G++Y     
Sbjct: 453 EVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVL 512

Query: 508 XXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDL 567
                  FW ++ P+GS   D  +FFE YL++PILI  Y+G+KL+ R+ +V++   ++DL
Sbjct: 513 FLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDL 572

Query: 568 VSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            + RK  DA   ++E L EK  L   S+ KR    WC
Sbjct: 573 ETGRKHIDAHEHRAEILAEKAALSQKSFIKRFWHVWC 609

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  370 bits (950), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/579 (35%), Positives = 320/579 (55%), Gaps = 9/579 (1%)

Query: 34  EGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHE-RVSG------EDFERLAPDDSSKHKT 86
           E S    + +   SFKR EE         S ++ +V G      +D E+   + + +   
Sbjct: 11  ETSISKSWTKLFSSFKRMEEVEVVESLTKSNYDVQVMGKKYEDMDDVEKAIFNTTKRSLN 70

Query: 87  LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASEL 146
           L +++  RH+L +++   IGTG+ V +G +L+ GGPASL+I + I+ST L+ ++ +  EL
Sbjct: 71  LNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGEL 130

Query: 147 AIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPD 206
           A ++  + GGFN Y   LVD +  F+V+  Y  QW  +LPLELV AS+TI+YWN+S+N D
Sbjct: 131 AAVF-PVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYWNNSVNSD 189

Query: 207 AXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSV 266
           A                           +  K+L           + CGG   +GY+G+ 
Sbjct: 190 AWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGAK 249

Query: 267 YWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 326
           YW+DPG+F G +  ++FKGL +V V AAF+Y G E   ++AAE  NP+ ++  ASK+  +
Sbjct: 250 YWNDPGSFVGASPGSQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLPKASKRTFW 309

Query: 327 RIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXX 385
            I   YL+   ++G LV ++ P+LL  S S    ASP VIAI + G++ +P         
Sbjct: 310 LITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQGLPSLMNAIILI 369

Query: 386 XXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPK 445
                                E G  P++F Y+D RGRP+  ++ + VFGLL F+AAS K
Sbjct: 370 AIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAASNK 429

Query: 446 EETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXX 505
           +E +F WL A+SGLS LF W +I++SH+RFRR++  QG SLDEL Y S TGV G++Y   
Sbjct: 430 QEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSMTGVIGSWYGCV 489

Query: 506 XXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEV 565
                    FW ++ P GS+  D  +FF+ YL++PI +  ++G+KL+ R+W  +I +N++
Sbjct: 490 VIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYKRNWSWMIRSNKI 549

Query: 566 DLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           D+ + R++ D E ++ E+ E  E +   S+  +    WC
Sbjct: 550 DVNTGRRMIDKEELEKEKQEFNEYMARKSFIAKLWNLWC 588

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  369 bits (947), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 203/525 (38%), Positives = 294/525 (56%), Gaps = 2/525 (0%)

Query: 81  SSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140
           ++K   L +++  RH+L +++   IGTG+ V +G SL  GGPASL+I + I+ST L+ ++
Sbjct: 58  NTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIV 117

Query: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN 200
            S  EL+  +  + GGFN Y    V+ +F F+V++ Y  QW  +LPLEL  AS+TI+YWN
Sbjct: 118 NSLGELSATF-PVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWN 176

Query: 201 DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND 260
            SINPDA                           +  K+L           + CGG  + 
Sbjct: 177 KSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSG 236

Query: 261 GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 320
           G++G  YW+DPGAF G+    RFKGL AV + AAF+Y G E   ++AAE +NP+ ++  A
Sbjct: 237 GFIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKA 296

Query: 321 SKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGVKVVPHXX 379
           +K+  + I   YL+   L+G LVP N P LL G+ S    ASP VIAI + G+K +P   
Sbjct: 297 AKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLM 356

Query: 380 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCF 439
                                      E G  P+   +VD++GRP+  + ++ + GLL F
Sbjct: 357 NAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSF 416

Query: 440 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWG 499
           +AAS K + VFTWL A+SGLS LF WF+I+L+H+RFR +M  Q RSL+EL Y S TG WG
Sbjct: 417 IAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWG 476

Query: 500 AYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVI 559
           ++Y            FW ++ P G N  DA +FFE+YL++PI I  YLG+K+W R+ R+ 
Sbjct: 477 SWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKRNLRLY 536

Query: 560 IPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           I  +EVD+ S R   DA  ++ E+  E E ++   +  R   FWC
Sbjct: 537 IKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWNFWC 581

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  369 bits (947), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 218/578 (37%), Positives = 319/578 (55%), Gaps = 24/578 (4%)

Query: 28  ETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTL 87
           + SP  EG+R   + RF DSFKR + +              +  D E++A    + +  L
Sbjct: 33  DASP-VEGTR---WERFRDSFKRADTQ----------DLDPNLTDAEKMA--ILTANAPL 76

Query: 88  KQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELA 147
           K+ +K RH+ MI++   IGTG+ VG+GK+L   GPA +LIG+A+  TM+YC++ +  ELA
Sbjct: 77  KRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGELA 136

Query: 148 IIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSIN-PD 206
           + +  ++GGF  Y +  VD++F F+ + +Y LQWL +LPLE+V AS+T+ YW       D
Sbjct: 137 VTF-PIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 207 AXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSV 266
                                       +  KV+           + CGG    GY+G  
Sbjct: 196 GFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGR 255

Query: 267 YWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 326
            WH+PGAF      N FKG+ +V V AAF++ G+E   L AAE  NP+KS+ SA+K++ +
Sbjct: 256 LWHNPGAFA-----NGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFW 310

Query: 327 RIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXX 386
           RI   Y++   ++G LVPY S  L+G  S    ASPFVI+I + G+K +P          
Sbjct: 311 RITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIA 370

Query: 387 XXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKE 446
                                QG  PK+F Y+DR GRP+  ++V+CVFGLL F+AASPKE
Sbjct: 371 VLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKE 430

Query: 447 ETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXX 506
             VF WLLA+SGLS LFTW  I L H+R RR++  Q R+  EL + + TGVWG+ Y    
Sbjct: 431 GEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVL 490

Query: 507 XXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVD 566
                  QFW+A+ P+G +K  A+ FFE YL+ PILI  Y+G+K+W ++W++ I A  +D
Sbjct: 491 IILILMAQFWIALFPIG-DKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNID 549

Query: 567 LVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           + + R+  D E ++ E  EEK  +    +  R  +FWC
Sbjct: 550 IDTGRRETDIEALKQEIAEEKAFIASKPFYYRMYKFWC 587

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  368 bits (944), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/581 (37%), Positives = 319/581 (54%), Gaps = 21/581 (3%)

Query: 29  TSPRSEGSRDG-LFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTL 87
           +S  SE  + G ++ RFVDSF+  E E    D   S  ++++            + +  L
Sbjct: 34  SSTGSEEHKKGKVWTRFVDSFR--ERERLEVDPNMSELDQIAFR----------TANSPL 81

Query: 88  KQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELA 147
           + ++K RH+ MI++   IGTG+ VG+G +L   GPA +LIG+ +  TM+Y ++ +  ELA
Sbjct: 82  QHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMALGELA 141

Query: 148 IIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINP-- 205
           +++  +SGGF  Y    +D+++ F+ +  Y LQWL +LPLE+V AS+T+ YW    NP  
Sbjct: 142 VLF-PVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGT--NPRY 198

Query: 206 -DAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLG 264
            D                            +  KV+           +NCGG    GY+G
Sbjct: 199 RDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYIG 258

Query: 265 SVYWHDP-GAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKK 323
             YWH P GAF G++   RFKG+ +V V AAF++ G+E   L +AE  NP+KS+  A+K+
Sbjct: 259 GRYWHHPYGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVPKAAKQ 318

Query: 324 LVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXX 383
           + +RI   YL+   ++G LVPY    L+G+ S    ASPFVIAI +HG++ +P       
Sbjct: 319 VFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFVIAITTHGIRGLPSVVNVVI 378

Query: 384 XXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAAS 443
                                  EQ F PK F Y+DR GRP+  +LV+  FGL+ FVA S
Sbjct: 379 LIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLVAFVAQS 438

Query: 444 PKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYA 503
            KE  VF WLLA+SGLS LFTW  I L H+RFR+++  QGR  DEL + S  GV+G+Y+ 
Sbjct: 439 KKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGVYGSYWG 498

Query: 504 XXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPAN 563
                     QF+VA+ P G+ K +A  FFE YL+ PI+I  YLG+K++ ++W++ I A 
Sbjct: 499 LFMIILMFIAQFYVALFPPGA-KPNAKAFFEAYLSFPIVIACYLGHKIYKKNWKIFIKAE 557

Query: 564 EVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           ++D+ + RK  D ++++ E  EE+  L    W  R   FWC
Sbjct: 558 DMDIDTGRKDDDLDLLRQEVAEERAVLATKPWWYRWWVFWC 598

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  367 bits (942), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 210/564 (37%), Positives = 313/564 (55%), Gaps = 15/564 (2%)

Query: 42  HRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISL 101
            +F DSFK+ E+               +  + ER+A   ++    L+  +K R   MI++
Sbjct: 70  QKFKDSFKKAED----------VELDPNLTEAERIA--QATAKAPLQHTLKGRQQTMIAI 117

Query: 102 ATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYP 161
              IG+G+ VG+  +L  GGPA L+IG+ + STM+Y ++ +  ELA+++  ++GGF  Y 
Sbjct: 118 GGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGELAVVF-PVAGGFTTYA 176

Query: 162 ALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSIN-PDAXXXXXXXXXXXXX 220
              VD++F ++ ++ Y LQWL +LPLE+V+AS+T+ YW       D              
Sbjct: 177 TRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRDGFVALFWLVIVIIN 236

Query: 221 XXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGI 280
                         +  KV            + CGG    G++G+ YWHDPGAF G+   
Sbjct: 237 MFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHGSG 296

Query: 281 NRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLG 340
            +FKG+ +V V AAF++ G+E   +TAAE  NP+KSI  A+K++V+RI+  Y+ T  ++G
Sbjct: 297 AQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIG 356

Query: 341 FLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXX 400
            LVPYN   L+G+ S    ASPFVIAI +HG+K +P                        
Sbjct: 357 LLVPYNDKRLIGASSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSR 416

Query: 401 XXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLS 460
                 +QGF PK+F Y+DR GRP+  + ++  FGLL FVAAS KE  VF WLLA+SGLS
Sbjct: 417 TIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLS 476

Query: 461 ELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAIS 520
            LFTW  I L H+RFR ++  QGR  +EL + S  GV G+Y+           QF+VA+ 
Sbjct: 477 SLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALF 536

Query: 521 PVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQ 580
           P G  K DA  FF++YL+ PI++  Y G+K++ R+W++ IP  ++D+ + R+  D E+++
Sbjct: 537 PPG-GKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLK 595

Query: 581 SEQLEEKEQLRHASWTKRAAEFWC 604
            E +EEK  L    W  RA  FWC
Sbjct: 596 QEIMEEKAILASKPWYIRAYAFWC 619

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  365 bits (937), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/564 (36%), Positives = 311/564 (55%), Gaps = 15/564 (2%)

Query: 42  HRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISL 101
            +F DSFK  +E     D            D E++A    + H  LK ++K RH+ MI++
Sbjct: 48  RKFKDSFKPLDEAVVTDDM----------SDIEKIA--HRTAHAPLKHHLKNRHLQMIAI 95

Query: 102 ATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYP 161
              IGTG+ VG+G +L   GPA +LIG+ +  TM+YC++ +  EL++++  +SGGF  Y 
Sbjct: 96  GGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVF-PISGGFTTYA 154

Query: 162 ALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW-NDSINPDAXXXXXXXXXXXXX 220
              +D++F F+ ++ Y LQWLC+LPLE+V AS+T+ YW  D    D              
Sbjct: 155 TRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIIN 214

Query: 221 XXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGI 280
                         +  KVL           +NCGG    GY+G  Y+HDPGAF G+   
Sbjct: 215 LFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAG 274

Query: 281 NRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLG 340
            RF+G+ +V V AAF++ G+E   + AAE   P+KS+  A+K++ +RI   Y+++  ++G
Sbjct: 275 ARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVG 334

Query: 341 FLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXX 400
            LVPY    L+G+ S    ASPFVIAI SHG++ +P                        
Sbjct: 335 LLVPYTDERLIGASSVDAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSR 394

Query: 401 XXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLS 460
                 +Q F PK+F Y+DR GRP+  +  +  FGL+ FVA S KE  VF WLLA+SGLS
Sbjct: 395 TLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLS 454

Query: 461 ELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAIS 520
            LFTW  I   H+RFR ++  QGRS DEL +++  G++G+ +           QF+VA+ 
Sbjct: 455 SLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALF 514

Query: 521 PVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQ 580
           P G  K  A  FF++YL+ P+++  Y G+KL+ R+W+++IP +++D+ + R+  D ++++
Sbjct: 515 PPG-GKPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLR 573

Query: 581 SEQLEEKEQLRHASWTKRAAEFWC 604
            E  EEK+ +    W  R   FWC
Sbjct: 574 QEIAEEKQMMSTRPWWYRWYSFWC 597

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  360 bits (923), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 214/600 (35%), Positives = 323/600 (53%), Gaps = 17/600 (2%)

Query: 6   MKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTH 65
           ++N    +D + E+  S + +  T+P S   +   +  F+DSFKR E E           
Sbjct: 21  IENCYLGQDVISETL-SYKDLSNTTPESTIDKS-RWRNFLDSFKRIEVE----------E 68

Query: 66  ERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASL 125
              +  D E++A    +    L+  +K RH+ MI++   IGTG+ VG+GK+L   GPA +
Sbjct: 69  VDPNLTDIEKIA--IKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGI 126

Query: 126 LIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCIL 185
           LIG+ I  TM++ ++ +  ELA+++  +SGGF  Y    +D++F F+ ++ Y  QWL  L
Sbjct: 127 LIGWGITGTMIFTMVMALGELAVVF-PVSGGFLTYATRFIDESFGFANNFNYMFQWLVAL 185

Query: 186 PLELVTASMTIKYWNDSIN-PDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXX 244
           PLE+V AS+T+ YW   +   D                            +  KV+    
Sbjct: 186 PLEIVAASITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIG 245

Query: 245 XXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSV 304
                  + CGG    GY+G  YWHDPGAF G++   RFKG  +V V AAF++ G+E   
Sbjct: 246 FIILGIILVCGGGPVGGYVGGRYWHDPGAFAGHSPGRRFKGFCSVFVTAAFSFAGSELVG 305

Query: 305 LTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFV 364
           + +AE +NP+KS+  A+K++ +RI+  Y++   L+G LVPY  P LLGS      ASPFV
Sbjct: 306 IASAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFV 365

Query: 365 IAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRP 424
           IAI +HG+  +P                              EQGF PK   Y+DR+GRP
Sbjct: 366 IAIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRP 425

Query: 425 VRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGR 484
           +  + +   FGL+ FVAAS K+E +F WLLAISG+S   TW SI   H+RFR ++ V GR
Sbjct: 426 LVGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGR 485

Query: 485 SLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIG 544
           S DEL ++S  G+ G+Y+           QF+ A+ P+GS+  +A +FF  YLA PI++ 
Sbjct: 486 SDDELPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSP-NAYDFFSAYLAAPIVLA 544

Query: 545 LYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            Y+ +KLW R+W+++IP  ++D+ + R+  D  +++ E  EEK  L    W  R   FWC
Sbjct: 545 FYIAHKLWKRNWKLLIPLKDIDIDTGRRETDINLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  358 bits (919), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/545 (37%), Positives = 294/545 (53%), Gaps = 15/545 (2%)

Query: 38  DGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKH---------KTLK 88
           DGL  + V     P   ++ G     +  ++S       A D  S H         + L 
Sbjct: 24  DGLVEKAVVDIPDPGSSHDLGQSSKDSGYKISTGS----AIDSDSLHGNNVAFEYGENLN 79

Query: 89  QNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAI 148
           +++  RH+L +++   IGTG+ V +G SL+ GGPASL+IG+ I+S+ L+ VI +  ELA 
Sbjct: 80  KDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGELAA 139

Query: 149 IYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAX 208
            +  + GGFN Y    VD +FAF+V+  Y + W+  LPLELV AS+TI+YWN  IN DA 
Sbjct: 140 TF-PIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINSDAW 198

Query: 209 XXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYW 268
                                     +  K+L           +  GG    GY+G  YW
Sbjct: 199 VTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYW 258

Query: 269 HDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRI 328
           +DPGAF G++  +RFKGL +V V AAF+Y G E + ++AAE +NP+K+I  A+K+  + I
Sbjct: 259 NDPGAFHGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVI 318

Query: 329 IGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXX 387
              Y+    L+G LVPYN   LL GS S    ASP VIAI + G+K +P           
Sbjct: 319 TFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNAIILIAL 378

Query: 388 XXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEE 447
                                   PK+F+ VD+RGRP+  +  +   GLL F+AAS K+E
Sbjct: 379 LSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQE 438

Query: 448 TVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXX 507
            VFTWL AI GLS +F W  I+L+H+RFR ++  Q RSLDEL Y S +G+WG++Y     
Sbjct: 439 EVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIIL 498

Query: 508 XXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDL 567
                  FWV++ PVG +  DA  FFE YL+ PILI  Y+G+K++ ++W+ +IP  E+D+
Sbjct: 499 VLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLEEIDI 558

Query: 568 VSHRK 572
              +K
Sbjct: 559 DLGKK 563

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  359 bits (921), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/565 (35%), Positives = 309/565 (54%), Gaps = 21/565 (3%)

Query: 42  HRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISL 101
           H FVD F+  E + +  D   S+ ER +           ++    LK+++K RH+ MI++
Sbjct: 51  HNFVDGFR--EYKLDDVDPNLSSTERAA----------IATARSPLKRHLKNRHLQMIAI 98

Query: 102 ATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYP 161
              IGTG+ VG+GK+L  GGPA++++ + +  +M+Y V+Q+  EL +    +SG + +Y 
Sbjct: 99  GGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGELCVA-LPVSGSYLSYV 157

Query: 162 ALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN-DSINPDAXXXXXXXXXXXXX 220
           +  +D +F F++++ Y +  L  +PLE+V AS+T+ YWN D    D              
Sbjct: 158 SRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYADGFVALFYVTVLLIN 217

Query: 221 XXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND-GYLGSVYWHDPGAFRGNNG 279
                         +  KVL           + CGG  N+ GY+G+ YWH+PG F     
Sbjct: 218 FLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFA---- 273

Query: 280 INRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALL 339
            + FKG  A+ V +AF++ G+E   L AAE +NP++ +  A+K++ +RI   YL++  L+
Sbjct: 274 -HGFKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLI 332

Query: 340 GFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXX 399
           G LVPY +  L  S S    ASPFVIAI   G+  +P                       
Sbjct: 333 GCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASS 392

Query: 400 XXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGL 459
                    G+ PK F YVDR+GRP+  L++S VFGLL F+++S  +  VF W+LA+SGL
Sbjct: 393 RATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGL 452

Query: 460 SELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAI 519
              FTW SI + H+RFR+ +  QGRS DEL +++ TG+WG+ Y           QFWVA+
Sbjct: 453 CSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVAL 512

Query: 520 SPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIM 579
            P+ S    A +FFE YL++P++I  Y+G+K++ R+WR++IPA E+DL + R+  D E++
Sbjct: 513 FPL-SKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIPAKELDLDTGRREVDLELL 571

Query: 580 QSEQLEEKEQLRHASWTKRAAEFWC 604
           + E  EE E +R      R   FWC
Sbjct: 572 KQEIKEENESIRSRPIWYRIYRFWC 596

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  354 bits (909), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/543 (36%), Positives = 300/543 (55%), Gaps = 4/543 (0%)

Query: 65  HERV-SGEDFER-LAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGP 122
           HE++ +  DF   ++ +D   +  L +N+  RH+L +++   IG G+ V +G +L +GGP
Sbjct: 51  HEKIQTTTDFASVISHEDDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGP 110

Query: 123 ASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWL 182
           ASL+I + I+ST L+ VI +  E+A  +  + GGFN Y    +D +  F+V+  Y  QWL
Sbjct: 111 ASLVIDWIIISTCLFTVINALGEMAAAF-PVVGGFNVYITRFIDPSVGFAVNINYLAQWL 169

Query: 183 CILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMX 242
            +LPLELV ASMTIKYWN++IN DA                           +  K+L  
Sbjct: 170 VLLPLELVAASMTIKYWNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAI 229

Query: 243 XXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEF 302
                    + CGG  + G++G  YW+ PG+F G+N   +FKGL +V V AAF+Y G E 
Sbjct: 230 IGFTILGIVLACGGGPHGGFIGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYSGIEM 289

Query: 303 SVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHAS 361
           + ++AAE ++P+ +I  A+K+  + I   Y+    L+G LVPY+ P LL G+ S    +S
Sbjct: 290 TAVSAAESKDPRTTIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASS 349

Query: 362 PFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRR 421
           P VIAI + G+K +P                                G  P++ N VD +
Sbjct: 350 PLVIAIENDGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTK 409

Query: 422 GRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIV 481
           GRP+  ++ +  FGLL FVAAS ++  VFTWL A+SGLS +F W +I+LSH+RFR+SM  
Sbjct: 410 GRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAK 469

Query: 482 QGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPI 541
           Q RSLDEL + S TGVWG++Y            FW ++ P+G    DA +FFE YL+ PI
Sbjct: 470 QNRSLDELPFLSQTGVWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPI 529

Query: 542 LIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAE 601
           L+  Y G+KL+ R    ++   ++DL + R+  D ++ + E   E+E+L   S+ K    
Sbjct: 530 LLACYFGHKLYVRKREFMVGLADMDLDTGRRQVDLDVRREELRREREELAKQSFFKSFLH 589

Query: 602 FWC 604
            WC
Sbjct: 590 VWC 592

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  346 bits (888), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 187/520 (35%), Positives = 293/520 (56%), Gaps = 9/520 (1%)

Query: 87  LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASEL 146
           LK+++K RH+ MI++   IGTG+ VG+GK+L  GGPA+++I + +  +M+Y V+Q+  EL
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 147 AIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN-DSINP 205
           A+    +SG + +Y +  ++ +F F++++ Y +  L  +PLEL+ AS+T+ YW+ DS   
Sbjct: 149 AVA-LPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYA 207

Query: 206 DAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND-GYLG 264
           DA                           +  KV            + CGG  +D GY+G
Sbjct: 208 DAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIG 267

Query: 265 SVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKL 324
           + YW++PG F      + FKG  A+ V +AF++ G+E   L AAE +NP+K +  A+K++
Sbjct: 268 ARYWYNPGGFA-----HGFKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRAAKQV 322

Query: 325 VYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXX 384
            +RI   Y+++  L+G LVPY    L  + S    ASPFVIAIA  G+K +P        
Sbjct: 323 FWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVNVVIL 382

Query: 385 XXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASP 444
                                   GF P+ F YVDR+GRP+  +L+  +FGLL F++AS 
Sbjct: 383 IAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFLSASS 442

Query: 445 KEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAX 504
               VF W+LAISGL+  F W SI + H+RFRR++ VQGRS DEL Y++ TG+WG+ Y  
Sbjct: 443 NYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGSLYGI 502

Query: 505 XXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANE 564
                    QFWVA+ P+G +  +AN+FF  YL++P++I  Y  +KL+ R W  +I +++
Sbjct: 503 GLIFIVLCFQFWVALFPIGGSP-NANHFFSAYLSLPVVIFFYTCHKLYTRSWTFLIKSSD 561

Query: 565 VDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           +D+ + R+  D E+++ E  EE++ +R      R   FWC
Sbjct: 562 IDIDTGRREMDLELLKQEIQEEQQYIRSKPIWYRIYRFWC 601

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  345 bits (884), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/604 (34%), Positives = 323/604 (53%), Gaps = 18/604 (2%)

Query: 5   EMKNIKSPE---DGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGI 61
            +K+I+S     D +V    S          S GS    + RFVDSFKR E E       
Sbjct: 14  NVKDIESTTFGMDDIVHEPCSTLSSNNNDNESRGSIRCKWTRFVDSFKRIELE------- 66

Query: 62  HSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGG 121
                  +  D E++A   ++    LK  +K RH+ MI++   IGTG+ VG+GK+L   G
Sbjct: 67  ---ELDPNLTDAEKIAI--ATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAG 121

Query: 122 PASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQW 181
           PA +LIG+ +  TM+Y ++ +  ELA+++  +SGGF  Y    +D++F F++++ Y LQW
Sbjct: 122 PAGILIGWTVTGTMIYSMVMAVGELAVVF-PVSGGFTTYATRFIDESFGFAINFNYMLQW 180

Query: 182 LCILPLELVTASMTIKYWN-DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVL 240
           L  LPLE+V+AS+T+ YW  D+   D                               KV+
Sbjct: 181 LITLPLEIVSASITVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVV 240

Query: 241 MXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGA 300
                      + CGG    GY+G+ YWH PGAF G+    +FKG   V + A+F++GG+
Sbjct: 241 TIIGFIIMAVILICGGGPVGGYIGAKYWHHPGAFVGDTAGQKFKGFCTVFITASFSFGGS 300

Query: 301 EFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHA 360
           E   +  +E +NP+KS+  A+K++ +RI   Y++   L+G LVPYN   L+G+ S    A
Sbjct: 301 EVVGVAGSESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAA 360

Query: 361 SPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDR 420
           SPFVIA+ + G++ +P                              EQGF PK+  Y+DR
Sbjct: 361 SPFVIAVVNQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDR 420

Query: 421 RGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMI 480
            GRP+  + ++  FGL+ FVA S  E  VF WLLA+SGLS LF+W +I + H+RFRR+++
Sbjct: 421 NGRPLVAIGIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALV 480

Query: 481 VQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMP 540
            QGRS DEL + S  G+ G+Y+           QF+V + P G++  +A +FF  YL+ P
Sbjct: 481 AQGRSTDELPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFPAGASP-NAKDFFMAYLSFP 539

Query: 541 ILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAA 600
           I++  Y+ +K+W ++W++ I A ++D+ + R+  D ++++ E   E+  L       R  
Sbjct: 540 IVLAFYIFHKIWKKNWKLYIKAEDMDIDTGRREVDRDLLKQEVAAERADLAARPIWYRCW 599

Query: 601 EFWC 604
           +FWC
Sbjct: 600 KFWC 603

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  343 bits (879), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 220/593 (37%), Positives = 320/593 (53%), Gaps = 24/593 (4%)

Query: 13  EDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGED 72
           E G  +  +S     +TS R  G+R   + RF DSF+  E E    D   +  E+++   
Sbjct: 18  EPGEFDELNSYVSQSDTS-RVGGTR---WERFKDSFR--EAETVDLDPSLTPAEKMA--- 68

Query: 73  FERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIV 132
                    + +  LK+ +K RH+ MI +   IGTG+ VG+GKSL   GPA +LIG+A+ 
Sbjct: 69  -------ILTANAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALT 121

Query: 133 STMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTA 192
            TM+YC++ +  ELA+ +  ++GG+  Y +  VD++F F+ + VY + WL  LPLE+V A
Sbjct: 122 GTMIYCMVMAMGELAVTF-PVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAA 180

Query: 193 SMTIKYWNDSIN-PDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXX 251
           S+T+ YW       DA                           +  KV+           
Sbjct: 181 SITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVI 240

Query: 252 VNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQ 311
           + CGG    GY+G   WH+PGAF      N FKG+ +V V AAF++ G+E   L AAE  
Sbjct: 241 LVCGGGPQGGYIGGRLWHNPGAFA-----NGFKGVCSVFVTAAFSFAGSELVGLAAAETA 295

Query: 312 NPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHG 371
           NP+KSI SA+K++ +RI   Y++   ++G LVPY S  L+G  S    ASPFVI+I + G
Sbjct: 296 NPRKSIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAG 355

Query: 372 VKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVS 431
           +K +P                               QG  PK+F Y+DR GRP+  ++V+
Sbjct: 356 IKGLPSVINVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVT 415

Query: 432 CVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGY 491
           CVFGLL F+AASPKE  VF WLLA+SGLS LFTW  I L H+R RR++  Q R+  EL +
Sbjct: 416 CVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSF 475

Query: 492 QSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKL 551
            + T VWG+ Y+          QFW+A+ P+G  K  A  FFE YL+ PI I  Y+G+K+
Sbjct: 476 TAPTDVWGSVYSLILIILILIAQFWIALFPIG-GKPSAAAFFEAYLSFPIYIVFYIGHKI 534

Query: 552 WYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           W ++W++ I A+++D+ S R+  D E ++ E  EEK  +    +  R  +FWC
Sbjct: 535 WKKNWKLFIKASDIDIDSGRRETDIEALKQEIAEEKAFIASKPFYYRMYKFWC 587

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  343 bits (880), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/606 (32%), Positives = 310/606 (51%), Gaps = 39/606 (6%)

Query: 28  ETSPRSEGSRD-GLFHRFVDSFKRP----------------EEEYNG---GDGIHSTHER 67
           +TS   EG+R     + F+D  K+P                 +EY     G+G +     
Sbjct: 4   QTSFTDEGARRRSEINEFIDFEKKPVDIKKTSSVVATTKHAHDEYEDNFPGNGFYQPPRN 63

Query: 68  VSGEDFERLAP--DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASL 125
           +     +   P  D S     LK+++K RH++MI++   IGTG+ VG+G+++  GGP ++
Sbjct: 64  IFQRCIDSFKPPLDGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAV 123

Query: 126 LIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCIL 185
           +IG+AI  + +   I    E+ + +  + G F  Y    +D + +F +S +Y +QW  +L
Sbjct: 124 VIGWAIAGSQIIGTIHGLGEITVRF-PVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVL 182

Query: 186 PLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXX 245
           PLE+++++MT++YWN SI+P                             ++ KVL     
Sbjct: 183 PLEIISSAMTVQYWNQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGF 242

Query: 246 XXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVL 305
                 + CGG  +  ++G+ YWHDPG        + F G+++VLV A+++ GG E   L
Sbjct: 243 IILCIVLICGGGPDHDFVGAKYWHDPGCLA-----HGFPGVLSVLVVASYSLGGTEMVCL 297

Query: 306 TAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVI 365
            + E     K + SA K+  +RI+  +L++  L+GFLVPY +  LLG  S   + SPFVI
Sbjct: 298 ASGETD--PKELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS--VNNSPFVI 353

Query: 366 AIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPV 425
           AI  H +KV+P                               QG  P+ F Y+DR GRP+
Sbjct: 354 AIKLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPL 413

Query: 426 RCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRS 485
             ++ + +FGLL F+  S     VF WL+AI+GL+    W SI++SH+RFR +M  QGRS
Sbjct: 414 TGIITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRS 473

Query: 486 LDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVG---SNKLDANNFFENYLAMPIL 542
           LDEL + S  G+WG+ Y+          QF+ A+ P+G   ++ + A  FF++YL   I+
Sbjct: 474 LDELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIM 533

Query: 543 IGLYLGYKLWYR----DWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKR 598
           I L++G+K++YR     W  ++P N++DL + RK  D EI++ E  E    LR + W  R
Sbjct: 534 IVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDIEILKQEIAERNRHLRASPWYVR 593

Query: 599 AAEFWC 604
              FWC
Sbjct: 594 WYHFWC 599

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  343 bits (880), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/566 (33%), Positives = 300/566 (53%), Gaps = 18/566 (3%)

Query: 44  FVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLAT 103
           FVD+F+R E        +      +S  + E+LA   ++    L + +K RH+ MI++  
Sbjct: 52  FVDTFRRAE--------MPVIDPNLS--EAEKLAIRTAAA--PLSRRLKNRHLQMIAIGG 99

Query: 104 GIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPAL 163
            IG G+ VG+GK+L   GPA +LIG+ + +TM+  +  S  ELA+ +  +SGG+  Y A 
Sbjct: 100 AIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGELAVTF-PVSGGYITYAAR 158

Query: 164 LVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN-DSINPDAXXXXXXXXXXXXXXX 222
            +D+++ F+ ++ Y +Q + ++PLE+V AS+T+ YW+ D     A               
Sbjct: 159 FIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIVSINLF 218

Query: 223 XXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINR 282
                       +  KV+           +  GG  +   +G  YW+DPG F GN   ++
Sbjct: 219 GVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPSDK 278

Query: 283 FKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFL 342
           FKG+ +V V AAF++ G+E   L AAE + P+KSI  A+K++ +RI   Y+++  ++G L
Sbjct: 279 FKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLL 338

Query: 343 VPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXX 402
           VP N+  LL         SPFVIA+  H ++V+P                          
Sbjct: 339 VPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTM 398

Query: 403 XXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSEL 462
               E GF PK+F Y+DR+GRP+  +  + +FGLLCFVA + +E  +F WLLAISGLS  
Sbjct: 399 CALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSF 458

Query: 463 FTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPV 522
           FTW +I+L+H+RFR ++  QGR+ +EL + S TG  G+ YA          QFWVA+ P 
Sbjct: 459 FTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPP 518

Query: 523 GSNKLDANN----FFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEI 578
             +   A      FF+ YL+  + I +YL +K+W R+W+  I A E+D+ + R+  D E+
Sbjct: 519 SPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELDLEL 578

Query: 579 MQSEQLEEKEQLRHASWTKRAAEFWC 604
            + E  +E+  L    +  R   FWC
Sbjct: 579 FKEELAQERALLAQKPFIIRVFNFWC 604

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  338 bits (866), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/515 (38%), Positives = 290/515 (56%), Gaps = 15/515 (2%)

Query: 42  HRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISL 101
             F DSFKR E      D   +  E+V+            +    LK ++K RH+ MI++
Sbjct: 53  QDFKDSFKRVEPI--AVDPNLTEAEKVA----------IVTAQTPLKHHLKNRHLQMIAI 100

Query: 102 ATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYP 161
              IGTG+LVG+G +L  GGPASLLIG+    TM+Y ++ +  ELA+I+  +SGGF  Y 
Sbjct: 101 GGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIF-PISGGFTTYA 159

Query: 162 ALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW-NDSINPDAXXXXXXXXXXXXX 220
              +D++F ++ ++ Y LQWL +LPLE+V+AS+T+ +W  D    D              
Sbjct: 160 TRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWVVIVIIN 219

Query: 221 XXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGI 280
                         +  KV+           +NCGG    GY+G  YWHDPGAF G+   
Sbjct: 220 MFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAFAGDTPG 279

Query: 281 NRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLG 340
            +FKG+ +V V +AF++ G+E   L A+E   P+KS+  A+K++ +RI   Y+++  ++G
Sbjct: 280 AKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIG 339

Query: 341 FLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXX 400
            LVPYN   L+G+ S    ASPFVIAI +HG+K +P                        
Sbjct: 340 LLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSR 399

Query: 401 XXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLS 460
                 EQ F P++F YVDR+GRP+  + V+  FGL+ FVAAS KE  VF WLLA+SGLS
Sbjct: 400 TMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLS 459

Query: 461 ELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAIS 520
            LFTW  I + H+RFR+++  QGR LDEL ++S TGVWG+Y+           QF+VA+ 
Sbjct: 460 SLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALF 519

Query: 521 PVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRD 555
           PVG +   A  FFE YL+ P+++ +Y+G+K++ R+
Sbjct: 520 PVGGSP-SAEGFFEAYLSFPLVMAMYIGHKIYKRN 553

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  332 bits (851), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/603 (31%), Positives = 305/603 (50%), Gaps = 45/603 (7%)

Query: 9   IKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERV 68
           I+S    + ++F   + +   S + +  +  ++ R +DSFK PE                
Sbjct: 28  IESDNKNIDDNFIPHDTLSTISRKEK--KPPIYRRIIDSFKPPE---------------- 69

Query: 69  SGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIG 128
                     D S     LK+++K RH++MI++   IGTG+ +G+G++L  GGP +++IG
Sbjct: 70  ----------DGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIG 119

Query: 129 YAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLE 188
           +A+  + +   I    E+ + +  + G F +Y    +D + +F VS +Y LQW  +LPLE
Sbjct: 120 WAVAGSQIVGTIHGLGEITVRF-PVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLE 178

Query: 189 LVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXX 248
           ++ +++T++YWNDSI+P                             +T K++        
Sbjct: 179 IIASAITVQYWNDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIIL 238

Query: 249 XXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAA 308
              +  GG  +  Y+G+ YWH+PG+       + FKG+++VLV A+++ GG E + L + 
Sbjct: 239 CIVLIAGGGPDHEYIGAKYWHNPGSLA-----HGFKGVLSVLVVASYSLGGTEMTCLASG 293

Query: 309 EQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIA 368
           E     K + SA K++ +RI+  +L++  L+GFLVPY +P LLG  S     SPFVIAI 
Sbjct: 294 ETD--PKELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSSVDN--SPFVIAIK 349

Query: 369 SHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCL 428
            H +KV+P                               Q   P  F Y+DR GRP+  +
Sbjct: 350 IHNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGI 409

Query: 429 LVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDE 488
           +++ +FGLL F+  S     VF WL+AI+GL+    W SI++ HVRFR +M  Q R+LDE
Sbjct: 410 IINSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDE 469

Query: 489 LGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVG---SNKLDANNFFENYLAMPILIGL 545
           L + S  G+WG+ Y+          QF++A+ P+G    +   A  FF+NYL   ILI L
Sbjct: 470 LEFVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVL 529

Query: 546 YLGYKLWYR----DWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAE 601
           ++G+K++YR     W   I   ++DL + RK  D EI++ E  E+K  L    W  R   
Sbjct: 530 FIGHKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQEIHEKKMYLASKPWYVRQFH 589

Query: 602 FWC 604
            WC
Sbjct: 590 VWC 592

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  331 bits (848), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/613 (31%), Positives = 307/613 (50%), Gaps = 50/613 (8%)

Query: 4   FEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRD-----GLFHRFVDSFKRPEEEYNGG 58
           FE K + S +     +F      K+    +EG         +F R +DSFK P       
Sbjct: 25  FEPKALDSYKSSSFRTFTKQS--KDDDDIAEGHSSYQPPRNIFQRCIDSFKPPL------ 76

Query: 59  DGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLH 118
           DG   TH                     LK+ +K RH++MI++   IGTG+ +G+G++L 
Sbjct: 77  DGSFHTHN--------------------LKRTLKARHLIMIAIGGSIGTGLFIGSGQALA 116

Query: 119 NGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYC 178
           +GGP +L+IG++I  T +   I    E+ + +  + G F  Y    +D + +F +S +Y 
Sbjct: 117 SGGPLALIIGWSIAGTQIVGTIHGLGEITVRF-PVVGAFANYSTRFLDPSISFVISTIYV 175

Query: 179 LQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCK 238
           +QW  +LPLE++ ++MTI+YWN SI+P                             ++ K
Sbjct: 176 IQWFFVLPLEIIASAMTIQYWNQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIK 235

Query: 239 VLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYG 298
           V+           + CGG  +  ++G+ YWHDPG        + F G+++VLV A+++ G
Sbjct: 236 VITIIGFIILCIVLICGGGPDHDFVGARYWHDPGCLS-----HGFPGVLSVLVVASYSLG 290

Query: 299 GAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAAT 358
           G E   L + E  NP++ + SA K+  +RI+  +L++  L+GFLVPY +P LLG  S   
Sbjct: 291 GTEMVCLASGET-NPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS--V 346

Query: 359 HASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYV 418
           + SPFVIAI  H +K +P                               QG  PK F Y+
Sbjct: 347 NNSPFVIAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYI 406

Query: 419 DRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRS 478
           DR GRP+  +L + +FGLL F+  S     VF WL+AI+GL+    W SI++SH+RFR +
Sbjct: 407 DRAGRPLTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLA 466

Query: 479 MIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLD---ANNFFEN 535
           M  QG+SLDEL + S  G+WG+ Y+          QF+ A+ P+G  K     A  FF++
Sbjct: 467 MKAQGKSLDELEFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQS 526

Query: 536 YLAMPILIGLYLGYKLWYR----DWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLR 591
           YL   I+  L++ +K++YR     W  I+  +++DL + RK  D ++++ E  E    L+
Sbjct: 527 YLCALIMAFLFVCHKVFYRYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQEIAERNRHLQ 586

Query: 592 HASWTKRAAEFWC 604
            + W  R   FWC
Sbjct: 587 ASPWYVRWYHFWC 599

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  329 bits (844), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/579 (32%), Positives = 296/579 (51%), Gaps = 43/579 (7%)

Query: 33  SEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIK 92
           S  ++ GL  R +DSFK P       DG                 PD+      LK+ +K
Sbjct: 40  SRTNKRGLVRRCIDSFKPPV------DG--------------SFDPDN------LKRTLK 73

Query: 93  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTS 152
            RH++MI++   IGTG+ +G+GK+L  GGP ++LIG+ +  T +   I    E+ + +  
Sbjct: 74  SRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVRF-P 132

Query: 153 LSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXX 212
           + G F  Y    +D + +F VS +Y LQW  +LPLE++ +++T+++W  S++P       
Sbjct: 133 VVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSVDPVVWVAVF 192

Query: 213 XXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPG 272
                                 +  K++           +  GG     ++G+ YWHDPG
Sbjct: 193 YTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGARYWHDPG 252

Query: 273 AFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIY 332
           A       N FKG+ AV+V A+++ GG+E + L + E     K I  A K++ +RII  +
Sbjct: 253 ALA-----NGFKGVAAVMVTASYSLGGSEMTCLASGETD--PKEIPHAIKQIFWRIIFFF 305

Query: 333 LMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXX 392
           L++  L+GFLVPY + +LLG  +   + SPFVIAI  H ++V+PH               
Sbjct: 306 LVSLTLVGFLVPYTNDQLLGGSN--VNNSPFVIAIKMHNIRVLPHIINGVILVSILSVGN 363

Query: 393 XXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTW 452
                          QG  P++F YVDR GRP+  +L + +FGLL F+  S    TVFTW
Sbjct: 364 SCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVKSSSTGTVFTW 423

Query: 453 LLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXX 512
           L+A++GL+    W SI++SH+RFR +M  QG+SLDEL + S  G+WG+ Y+         
Sbjct: 424 LMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSVYSGVMNVVVLV 483

Query: 513 GQFWVAISPV---GSNKLDANNFFENYLAMPILIGLYLGYKLWYR----DWRVIIPANEV 565
            QF+V++ P+      +     FF+NYL   IL+ +++ +K++YR     W  I+P  E+
Sbjct: 484 AQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYRSTTGQWWKILPLAEI 543

Query: 566 DLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           DL S RK  D E+++ E    K+ +    W  R   +WC
Sbjct: 544 DLESGRKNIDIEVVKHEVAARKKYISEQRWYIRYYHYWC 582

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/578 (33%), Positives = 289/578 (50%), Gaps = 44/578 (7%)

Query: 34  EGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKP 93
            G R+ +F R VDSFK P                           D S     LK+ +KP
Sbjct: 52  HGKRN-IFQRCVDSFKSPL--------------------------DGSFDTSNLKRTLKP 84

Query: 94  RHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSL 153
           RH++MI++   IGTG+ VG+GK++  GGP  ++IG+AI  + +   I    E+ + +  +
Sbjct: 85  RHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHGLGEITVRF-PV 143

Query: 154 SGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXX 213
            G F  Y    +D + +F VS +Y LQW  +LPLE++ A+MT++YWN SI+P        
Sbjct: 144 VGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFY 203

Query: 214 XXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGA 273
                                +T K +           + CGG  +  ++G+ YWHDPG 
Sbjct: 204 AVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFIGAKYWHDPGC 263

Query: 274 FRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYL 333
                  N F G+++VLV A+++ GG E + L + E     K + SA K++ +RI+  +L
Sbjct: 264 LA-----NGFPGVLSVLVVASYSLGGIEMTCLASGETD--PKGLPSAIKQVFWRILFFFL 316

Query: 334 MTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXX 393
           ++  L+GFLVPY +  LLG  S     SPFVIAI  H +K +P                 
Sbjct: 317 ISLTLVGFLVPYTNQNLLGGSSVDN--SPFVIAIKLHHIKALPSIVNAVILISVLSVGNS 374

Query: 394 XXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWL 453
                         QG  P  F Y+DR GRP+  ++ + +FGLL F+  S     VF WL
Sbjct: 375 CIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWL 434

Query: 454 LAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXG 513
           +AI+GL+    W SI+LSH+RFR +M  QG+SLDEL + S  G+WG+ Y+          
Sbjct: 435 MAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIA 494

Query: 514 QFWVAISPVG---SNKLDANNFFENYLAMPILIGLYLGYKLWYR----DWRVIIPANEVD 566
           QF+ ++ P+G   S K  A  FF+NYL   I++ +++ +K++Y+     W  +    ++D
Sbjct: 495 QFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDID 554

Query: 567 LVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           L + RK  D EI++ E  E+K  L    W  R   FWC
Sbjct: 555 LETDRKDIDIEIVKQEIAEKKMYLDSRPWYVRQFHFWC 592

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/611 (31%), Positives = 304/611 (49%), Gaps = 47/611 (7%)

Query: 5   EMKNIKSPEDGVVE-SFDSVEVVKETS---PRSEGSRDGLFHRFVDSFKRPEEEYNGGDG 60
           +M N+ SP  G +E  F    + KET     + E     +  R +DSFK P         
Sbjct: 10  KMDNLLSPSSGDLEMKFSDGIMSKETEIDLDKKEDKNKNIVRRMIDSFKPPL-------- 61

Query: 61  IHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNG 120
                             D S     LK+ +K RH++MI++   IGTG+ VG+GK+L  G
Sbjct: 62  ------------------DGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATG 103

Query: 121 GPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQ 180
           GP +++IG++I  + +   I    E+ + +  + G F  Y   L+D + +F VS +Y  Q
Sbjct: 104 GPLAMIIGWSIAGSQMVGTIHGLGEITMRF-PVVGAFANYSTRLLDPSISFMVSSIYICQ 162

Query: 181 WLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVL 240
           W  +LP+EL+ ++MT+++W   ++P                             +  KV+
Sbjct: 163 WYFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVI 222

Query: 241 MXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGA 300
                      + CGG  +  ++G+ YWH PGA       N FKG+ +V V A+++ GG+
Sbjct: 223 TIIGFIILSIILICGGGPDHRFIGTEYWHHPGALA-----NGFKGVASVFVTASYSLGGS 277

Query: 301 EFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHA 360
           E   L +AE     K +  A K++ +RI+  +L++  L+GFLVPY +  LLG  S   + 
Sbjct: 278 EMVCLCSAETD--PKELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS--VNN 333

Query: 361 SPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDR 420
           SPFVIAI   G++V+P                               QG  P++F YVDR
Sbjct: 334 SPFVIAIKLSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDR 393

Query: 421 RGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMI 480
            GRP+  ++V+ +FGLL F+  S     VF WL+AI+GL+    W SI++SH+RFR +M 
Sbjct: 394 AGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMK 453

Query: 481 VQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVG---SNKLDANNFFENYL 537
            Q RSLDEL ++S  GV+G+ Y+          QF++++ PVG   S++    +FF+NYL
Sbjct: 454 AQNRSLDELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYL 513

Query: 538 AMPILIGLYLGYKLWYR----DWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHA 593
              +L+ +++ +K++++     W    P  E+DL + RK  D EI++ E  E +  L   
Sbjct: 514 CALVLVFVFVTHKIYFKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEVREREMYLASK 573

Query: 594 SWTKRAAEFWC 604
            W  R   FWC
Sbjct: 574 PWYIRFYNFWC 584

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/572 (33%), Positives = 288/572 (50%), Gaps = 43/572 (7%)

Query: 40  LFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMI 99
           +F R VDSFK P                           D S     LK+ +KPRH++MI
Sbjct: 57  IFQRCVDSFKPPL--------------------------DGSFDTSNLKRTLKPRHLIMI 90

Query: 100 SLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNA 159
           ++   IGTG+ VG+GK++  GGP  +++G+ I  + +   +    E+ + +  + G F  
Sbjct: 91  AIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTVHGLGEITVRF-PVVGAFAN 149

Query: 160 YPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXX 219
           Y    +D + +F VS +Y LQW  +LPLE++ A+MT++YWN SI+P              
Sbjct: 150 YGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSI 209

Query: 220 XXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNG 279
                          +T K +           + CGG  +  ++G+ YWHDPG       
Sbjct: 210 NLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDHEFIGAKYWHDPGCLA---- 265

Query: 280 INRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALL 339
            + F G+++VLV A+++ GG E + L + E     K + SA K++ +RII  +L++  L+
Sbjct: 266 -HGFPGVLSVLVVASYSLGGIEMTCLASGETD--PKGLPSAIKQVFWRIIFFFLVSLTLV 322

Query: 340 GFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXX 399
           GFLVPY +  LLG  S     SPFVIAI  H +KV+P                       
Sbjct: 323 GFLVPYTNQNLLGGSSVDN--SPFVIAIKLHHIKVLPSIVNAVILISVLSVGNSCIFASS 380

Query: 400 XXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGL 459
                   QG  P  F Y+DR GRP+  ++ + +FGLL F+  S     VF WL+AI+GL
Sbjct: 381 RTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGL 440

Query: 460 SELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAI 519
           +    W SI+LSHVRFR +M  QG+SLDEL + S  G+WG+ Y+          QF+ ++
Sbjct: 441 ATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVGIWGSVYSALINCLILIAQFYCSL 500

Query: 520 SPVG---SNKLDANNFFENYLAMPILIGLYLGYKLWYR----DWRVIIPANEVDLVSHRK 572
            P+G   S+K  A  FF+NYL   I++ +++ +K++YR     W  +    ++DL + RK
Sbjct: 501 WPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIYYRCQMGKWWGVKELKDIDLETDRK 560

Query: 573 IFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
             D EI++ E  E+K+ L    W  R   FWC
Sbjct: 561 DIDIEIVKQEIAEKKKYLDSRPWYVRQFHFWC 592

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  327 bits (838), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/578 (32%), Positives = 286/578 (49%), Gaps = 43/578 (7%)

Query: 34  EGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKP 93
           E S   +F R VDSFK P                           D S     LK+ +KP
Sbjct: 52  EHSNRNIFQRCVDSFKPPL--------------------------DGSFDTSNLKRTLKP 85

Query: 94  RHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSL 153
           RH++MI++   IGTG+ VG+GK++  GGP  +++G+ I  + +   I    E+ + +  +
Sbjct: 86  RHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRF-PV 144

Query: 154 SGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXX 213
            G F  Y    +D + +F VS +Y LQW  +LPLE++ A+MT++YWN SI+P        
Sbjct: 145 VGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFY 204

Query: 214 XXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGA 273
                                +T K +           + CGG  +  ++G+ YWHDPG 
Sbjct: 205 AVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFIGAKYWHDPGC 264

Query: 274 FRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYL 333
                  N F G++AVLV A+++ GG E + L + E     K +  A K++ +RI+  +L
Sbjct: 265 LA-----NGFPGVLAVLVVASYSLGGIEMTCLASGETD--PKGLPGAIKQVFWRILFFFL 317

Query: 334 MTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXX 393
            +  L+GFLVPY +  LLG  S     SPFVIA+  H +KV+P                 
Sbjct: 318 ASLTLVGFLVPYTNQNLLGGSSVDN--SPFVIAMKLHHIKVLPTIVNAVILISVLSVGNS 375

Query: 394 XXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWL 453
                         QG  P  F Y+DR GRP+  ++ + +FGLL F+  S     VF WL
Sbjct: 376 CIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMADVFNWL 435

Query: 454 LAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXG 513
           +AI+GL+    W SI+LSH+RFR +M  QG+SLDEL + S  G+WG+ Y+          
Sbjct: 436 MAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIA 495

Query: 514 QFWVAISPVG---SNKLDANNFFENYLAMPILIGLYLGYKLWYR----DWRVIIPANEVD 566
           QF+ ++ P+G   S K  A  FF+NYL   I++ +++ +K++Y+     W  +    ++D
Sbjct: 496 QFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYYKCQTGKWWGVKSLKDID 555

Query: 567 LVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           L + RK  D EI++ E +E K  L    W  R   FWC
Sbjct: 556 LETDRKDIDIEIIKQEIMERKMHLDSRPWYVRQFHFWC 593

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  326 bits (835), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/579 (32%), Positives = 288/579 (49%), Gaps = 43/579 (7%)

Query: 33  SEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIK 92
           +E  +  +  R +DSFK P                           D S     +K+ +K
Sbjct: 50  TEERKRNVVQRVIDSFKPP--------------------------VDGSFDPSNMKRALK 83

Query: 93  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTS 152
            RH++MI++ + IGTG+ VG+GK+L  GGP +L+IG+ +  T +   I    EL +    
Sbjct: 84  SRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLGELTV-RLP 142

Query: 153 LSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXX 212
           + G F  Y    +D + +F +S +Y +QW  +LPLE++ + +T+++W  S++P       
Sbjct: 143 VVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQSVDPIIWVALF 202

Query: 213 XXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPG 272
                                 ++ KV+           +  GG     Y+GS YWHDPG
Sbjct: 203 YTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVGSRYWHDPG 262

Query: 273 AFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIY 332
                   N FKG+ AV+V A+++ GG+E + L + E     K +  A K++ +RI+  +
Sbjct: 263 PLA-----NGFKGVAAVMVTASYSLGGSEMTCLASGETD--PKELPHAIKQIFWRILFFF 315

Query: 333 LMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXX 392
           L++  L+GFLVPY +  LLG  SA    SPFV+A+  H VKVVPH               
Sbjct: 316 LVSLTLVGFLVPYTNENLLGGSSAEN--SPFVLALYLHHVKVVPHIVNGVILVSILSVGN 373

Query: 393 XXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTW 452
                          QG  P +F YVDR GRP+  +L + +FGLL F+        VF+W
Sbjct: 374 SCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLVKFSSISNVFSW 433

Query: 453 LLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXX 512
           L+AI+GL+    W SI++SHVRFR +M  Q +SLDEL + S  GVWG+ YA         
Sbjct: 434 LMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSVYAGVLNFLTLV 493

Query: 513 GQFWVAISPV---GSNKLDANNFFENYLAMPILIGLYLGYKLWYR----DWRVIIPANEV 565
            QF++A+ PV     +K  A  FF+NYL   ILI ++  +K ++R     W  I   +EV
Sbjct: 494 AQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFRITTGKWWGIKKLSEV 553

Query: 566 DLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           DL + R   D EI++ E  E K+ LR+ +W  R   +WC
Sbjct: 554 DLDTGRVNIDIEIIKEEVAERKKFLRNKAWYTRYYYYWC 592

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  322 bits (826), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/582 (31%), Positives = 290/582 (49%), Gaps = 43/582 (7%)

Query: 30  SPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQ 89
           SP    ++  +F R VDSFK P                           D S     LK+
Sbjct: 32  SPEPVVTKRNIFQRCVDSFKPPV--------------------------DGSFDTSNLKR 65

Query: 90  NIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAII 149
            +K RH++MI++   IGTG+ +G+G++L  GGP +++IG+ I  + +   I    E+ + 
Sbjct: 66  TLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHGLGEITVR 125

Query: 150 YTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXX 209
           +  + G F  Y    +D + +F VS +Y +QW  +LPLE++ +++TI+YWN SI+P    
Sbjct: 126 F-PVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSIDPVVWV 184

Query: 210 XXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWH 269
                                    +T K +           + CGG  +  ++G+ YWH
Sbjct: 185 AIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFIGAKYWH 244

Query: 270 DPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRII 329
           DPGA       + F G+++VLV A+++ GG E + L + E     K + SA K++ +RI+
Sbjct: 245 DPGALA-----HGFPGVLSVLVVASYSLGGTEMTCLASGETD--PKELPSAIKQVFWRIL 297

Query: 330 GIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXX 389
             +L +  L+GFLVPY +  LLG  S     SPFVIAI  H +K +P             
Sbjct: 298 FFFLASLTLVGFLVPYTNENLLGGSSVDN--SPFVIAIKLHHIKALPSIVNAVILISILS 355

Query: 390 XXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETV 449
                             QG  P+ F Y+DR GRP+  ++ + +FGLL F+  S     V
Sbjct: 356 VGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKSSSVSEV 415

Query: 450 FTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXX 509
           F WL+AI+GL+    W SI+LSH+RFR +M  Q ++LDEL + S  G+WG+ Y+      
Sbjct: 416 FDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYSALINVL 475

Query: 510 XXXGQFWVAISPVG---SNKLDANNFFENYLAMPILIGLYLGYKLWYR----DWRVIIPA 562
               QF++++ P+G    +   A  FF++YL   I++ ++  +K++YR     W  + P 
Sbjct: 476 ILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSFGKWWDVKPL 535

Query: 563 NEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            ++DL + RK  D +++++E  E K  L+   W  R   FWC
Sbjct: 536 KDIDLETGRKNVDIDVIKAEIAERKMYLKKKPWIVRWYHFWC 577

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/588 (31%), Positives = 297/588 (50%), Gaps = 49/588 (8%)

Query: 28  ETSPRSEGSRD--GLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHK 85
           E  P ++G++    +F R +DSFK PE                          D S    
Sbjct: 51  EGPPVAKGTKPPRNIFQRAIDSFKPPE--------------------------DGSFDTS 84

Query: 86  TLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASE 145
            LK+ +K RH++MI++   IGTG+ +G+G++L  GGP +++IG+AI  + +   I    E
Sbjct: 85  NLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIGTIHGLGE 144

Query: 146 LAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINP 205
           + + +  + G F  Y    +D + +F VS +Y +QW  +LPLE+++++MT++YWN+SI+P
Sbjct: 145 ITVRF-PVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYWNESIDP 203

Query: 206 DAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGS 265
                                        +T KV+           +  GG  +  Y+GS
Sbjct: 204 VVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGGPDHVYVGS 263

Query: 266 VYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLV 325
            YWH+PG        N F G+++V+V A+++ GG E + L + E     K + SA K++ 
Sbjct: 264 RYWHNPGCLA-----NGFPGVLSVMVVASYSLGGTEMTCLASGETD--PKELPSAIKQVF 316

Query: 326 YRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXX 385
           +RI+  +L++  L+GFLVPY +  LLG  S     SPFVIAI  H +KV+P         
Sbjct: 317 WRILFFFLVSLTLVGFLVPYTNENLLGGSSVDN--SPFVIAIKIHHIKVLPSIVNAVILI 374

Query: 386 XXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPK 445
                                 Q   P  F Y+DR GRP+  ++ + +FGLL F+  S  
Sbjct: 375 SILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLFGLLAFLVKSGS 434

Query: 446 EETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXX 505
              VF WL+AI+GL+    W SI++SH+RFR +M  QGRSL+EL + S  G+WG+ Y+  
Sbjct: 435 MSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSAVGIWGSVYSAI 494

Query: 506 XXXXXXXGQFWVAISPVG--SNKLD-ANNFFENYLAMPILIGLYLGYKLWYRDWR----- 557
                   QF++++ P+G   N  D A  FF++YL   I++ +++G+K++Y  WR     
Sbjct: 495 INCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCIWIGHKIYY--WRQTGKI 552

Query: 558 -VIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
               P  E+DL   RK  D ++++ E  E K  L+   W  R   +WC
Sbjct: 553 WAFTPLAEIDLDEGRKNIDLDVLKQEIHERKMYLKSRPWYIRFYHYWC 600

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  321 bits (823), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 200/581 (34%), Positives = 297/581 (51%), Gaps = 21/581 (3%)

Query: 29  TSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLK 88
           T P          +R   SF+R        D +      +S  D E+   +    ++ L+
Sbjct: 35  TRPFQRKQMSSRMNRITQSFRRQ-------DAVEYADVDLSMMD-EQQRRNYVLANQPLQ 86

Query: 89  QNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAI 148
           + +  RH++MI++   +GTG+ +G G SL +G P SLLIG+ IV  M++CV+QSA+ELA 
Sbjct: 87  KTLSQRHLMMIAIGGTLGTGLFIGIGYSLSSG-PGSLLIGFLIVGLMMFCVVQSAAELAC 145

Query: 149 IYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAX 208
            Y  +SG +  + +  ++ +  F+V+  Y L WL   P EL+  +MT++YWN S+NP   
Sbjct: 146 QY-PVSGSYAVHVSRFMEPSIGFTVATNYALAWLISFPSELIGCAMTLQYWNKSVNPAVW 204

Query: 209 XXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND-GYLGSVY 267
                                     +  KV+           + CGG  N  GY+G+ Y
Sbjct: 205 VAIFYVFIMSLNMFGVRSYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPNSTGYIGTKY 264

Query: 268 WHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYR 327
           WHDPG+F        FKGL    V+AAF++GGAE  VLTA+E +  + S+  A+K   +R
Sbjct: 265 WHDPGSF----AKPVFKGLCNTFVSAAFSFGGAELVVLTASESRKVE-SVSRAAKGTFWR 319

Query: 328 IIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGV--KVVPHXXXXXXX 384
           I   Y+ T  ++G LVPY + +LL G       ASPFVIA++  G       H       
Sbjct: 320 IAIFYITTVIVIGCLVPYTNEQLLGGDNDEDITASPFVIALSGQGSMGTKASHFMNTVIL 379

Query: 385 XXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASP 444
                                   G  PK+  YVD++GRP+  + +  VFGLL F+ AS 
Sbjct: 380 IAVLSVCNSAVYASSRIIQALGVCGQLPKICGYVDQKGRPLVGIAICGVFGLLGFLVASD 439

Query: 445 KEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAX 504
            E  VFTWL A+  +S  FTWF I  S VRFR ++  QGRS DE+ ++S  G++G +   
Sbjct: 440 NEGDVFTWLFALCSISSFFTWFCICASQVRFRFALRAQGRSSDEIAHKSMLGIYGGFLGC 499

Query: 505 XXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWY-RDWRVIIPAN 563
                   G+ +V+I P+G +   A  FF+  L++PI+I +Y+G+KL+  +  RV+IPA 
Sbjct: 500 LLNALLIAGEIYVSIFPLGGDP-SAKQFFQYCLSIPIMIAVYIGHKLFANKSKRVLIPAQ 558

Query: 564 EVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           E+DL + RKI D E  + E LE+KE+L       R   FWC
Sbjct: 559 EIDLETGRKIKDLEQFKHEVLEDKEKLASKPLYYRIYRFWC 599

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/591 (31%), Positives = 300/591 (50%), Gaps = 43/591 (7%)

Query: 21  DSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDD 80
           D  E  +  +  ++     +F R +DSFK P    NG    H+++               
Sbjct: 36  DKYEHAESLTDYTKTENRNIFQRVIDSFKPPA---NG--SFHTSN--------------- 75

Query: 81  SSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140
                 LK+++K RH++MI++   IGTG+ +G+G++L NGGP +L++G++I  + +   I
Sbjct: 76  ------LKRSLKSRHLIMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQIVGTI 129

Query: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN 200
               E+ + +  + G F  Y    +D + +F +S +Y LQW  +LPLE++++++T++YWN
Sbjct: 130 HGLGEITVRF-PVVGAFANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILSSAITVQYWN 188

Query: 201 DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND 260
           D+I+P                             +T KV+           + CGG    
Sbjct: 189 DTIDPVVFVAIFYCAIVSINLFGVRGFGEAEFVFSTIKVITVTGFIILCIILICGGGPTH 248

Query: 261 GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 320
            ++G+ YWHDPG        N F+G ++VL+ A+++ GG E + L + E     K + SA
Sbjct: 249 EFIGAKYWHDPGCLA-----NGFRGFLSVLITASYSLGGTEMTCLASGETD--PKELPSA 301

Query: 321 SKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXX 380
            K++ +RI+  +L++  L+GFLVPY +  LLG  S     SPFVIAI  H +KV+P    
Sbjct: 302 IKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDN--SPFVIAIKLHNIKVLPSIVN 359

Query: 381 XXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFV 440
                                      QG  P  F Y+DR GRP+  ++++ +FGLL F+
Sbjct: 360 AVILISILSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLFGLLAFL 419

Query: 441 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGA 500
             S     VF WL+AI+GL+    W SI++ H+RFR +M  Q +++DEL + S  GVWG+
Sbjct: 420 VKSSSVSEVFDWLMAIAGLATCIVWLSINICHIRFRLAMKAQNKTIDELEFVSAVGVWGS 479

Query: 501 YYAXXXXXXXXXGQFWVAISPVG---SNKLDANNFFENYLAMPILIGLYLGYKLWYR--- 554
            Y+          QF+V++ P+G    +K  A  FF+NYL   + +  ++ +KL++R   
Sbjct: 480 VYSAIINSLILIVQFYVSLWPIGGWTDSKDRAGKFFQNYLCAIVSLIFFICHKLYFRYKT 539

Query: 555 -DWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
             W  IIP  ++DL + RK  D +I++ E  E K+ L    W  R    WC
Sbjct: 540 KKWWEIIPLKDIDLDTGRKNIDIDIVKEEIKERKQYLATKPWYIRLMHHWC 590

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  315 bits (808), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 186/576 (32%), Positives = 285/576 (49%), Gaps = 43/576 (7%)

Query: 36  SRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRH 95
           S   +F R VDSFK P                           D S     LK+ +KPRH
Sbjct: 53  SNRNIFQRCVDSFKPPL--------------------------DGSFDTSNLKRTLKPRH 86

Query: 96  VLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSG 155
           ++MI++   IGTG+ VG+GK++  GGP  +++G+ I  + +   I    E+ + +  + G
Sbjct: 87  LIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRF-PVVG 145

Query: 156 GFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXX 215
            F  Y    +D + +F VS +Y LQW  +LPLE++ A+MT++YWN SI+P          
Sbjct: 146 AFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVVWVAIFYVI 205

Query: 216 XXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFR 275
                              +T K +           +  GG  +  Y+G+ YW+DPG   
Sbjct: 206 IVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDHEYVGAKYWYDPGCLA 265

Query: 276 GNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMT 335
                N F G+++VLV A+++ GG E + L + E     K + SA K++ +RI+  +L++
Sbjct: 266 -----NGFPGILSVLVVASYSLGGIEMTCLASGETD--PKGLPSAIKQVFWRILFFFLVS 318

Query: 336 AALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXX 395
             L+GFLVPY +  LLG  S     SPFVIAI  H +KV+P                   
Sbjct: 319 LTLVGFLVPYTNQNLLGGSSVDN--SPFVIAIKLHHIKVLPSIVNVVILISVLSVGNSCI 376

Query: 396 XXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLA 455
                       QG  P  F Y+DR GRP+  ++ + +FGLL F+  S     VF WL+A
Sbjct: 377 FASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMGDVFNWLMA 436

Query: 456 ISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQF 515
           I+GL+    W SI++SH+RFR +M  QG+ LDEL + S  G+WG+ Y+          QF
Sbjct: 437 IAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAVGIWGSAYSALINCLILLAQF 496

Query: 516 WVAISPVG--SNKLD-ANNFFENYLAMPILIGLYLGYKLWYR----DWRVIIPANEVDLV 568
           + ++ P+G   N  D A  FF+NYL   I++ +++ +K++Y+     W  I    ++DL 
Sbjct: 497 YCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIYYKCQTGQWWGIKALKDIDLE 556

Query: 569 SHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           + RK  D EI++ E  E+K  L    W  R   +WC
Sbjct: 557 TDRKNIDIEIVKQEIAEKKMYLDSCPWYVRHFHYWC 592

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  312 bits (799), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 188/589 (31%), Positives = 289/589 (49%), Gaps = 47/589 (7%)

Query: 27  KETSPRS----EGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSS 82
           K ++P +     G++  +  R VDSFK P                           D S 
Sbjct: 35  KTSTPSTVVNHRGTKRNIIQRMVDSFKPPL--------------------------DGSF 68

Query: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
               LK+++K RH++MI++   IGTG+ +G+GK+L  GGP +L+IG+ +  T +   I  
Sbjct: 69  HSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGTIHG 128

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
             E+ + +  + G F  Y    ++ + +F V  +Y LQW  +LPLE++ A+MT++YW  S
Sbjct: 129 LGEITVRF-PVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWGSS 187

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           + P A                           +  KVL           + CGG     +
Sbjct: 188 VPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKHEF 247

Query: 263 LGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 322
           +G+ YW DPG        N FKG+ AV V A+++ GG E + L + E     K + SA K
Sbjct: 248 VGAKYWSDPGPLA-----NGFKGVAAVFVIASYSLGGTEMACLASGETD--PKELPSAIK 300

Query: 323 KLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXX 382
           ++ +RI+  +L++  L+GFLVPY +  L+G  S     SPFVIAI  HG+K +P      
Sbjct: 301 QVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSSVDN--SPFVIAIRLHGIKALPSVVNAV 358

Query: 383 XXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAA 442
                                    QG  P++F Y+DR GRP+  +L +  FGLL F+  
Sbjct: 359 ILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGLLAFLVK 418

Query: 443 SPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYY 502
           S   + VFTWL+AI+GL+    W SI++SH+RFR +M  QG SLDEL + S  GV+G+ Y
Sbjct: 419 SSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVGVYGSVY 478

Query: 503 AXXXXXXXXXGQFWVAISPVG---SNKLDANNFFENYLAMPILIGLYLGYKLWYR----D 555
           +          QF+V++ PVG   S      NFF+NYL   IL+ L+ G+K++YR     
Sbjct: 479 SATINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGHKIYYRISTGK 538

Query: 556 WRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           W       ++DL++  ++ D E+ + E  E++ +L       R    WC
Sbjct: 539 WWGFKALRDIDLLTDMRVTDTELSKHELHEKRVKLAQKPLIVRLYHQWC 587

>SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 586

 Score =  306 bits (784), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 194/567 (34%), Positives = 284/567 (50%), Gaps = 21/567 (3%)

Query: 43  RFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLA 102
           RF DSFK+ E        +    +    ED+ER   +    H+  K+ +  RH+ MIS+ 
Sbjct: 36  RFRDSFKKHEPI------LPENVDLSQMEDYER--TNYLLAHQPYKRTLSQRHLTMISIG 87

Query: 103 TGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPA 162
             +GTG+ +G G SL   GP +LLIG+ I+   ++CV+Q A+EL+  Y  +SG F  + +
Sbjct: 88  GTLGTGLFIGLGYSL-TSGPGNLLIGFTIIGISIFCVVQCAAELSCQY-PVSGSFATHVS 145

Query: 163 LLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXX 222
             +D +  F+VS  Y L WL   P EL+  ++T++YWNDS+NP                 
Sbjct: 146 RFIDSSVGFTVSTNYALAWLISFPSELIGCAITLRYWNDSVNPAVWIAIFYVFIMCLNLF 205

Query: 223 XXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGA-GNDGYLGSVYWHDPGAFRGNNGIN 281
                       +  K+            + CGG   ++GY+G+ YWHDPGAF       
Sbjct: 206 GVRGFAETEFWLSLIKIAAIVIFIIIGIVLICGGGPHSNGYIGAKYWHDPGAFVK----P 261

Query: 282 RFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGF 341
            FKGL    V+AAF++GGAE  VLTA E +  + SI  A+K   +RI   Y+ T  ++G 
Sbjct: 262 VFKGLCNTFVSAAFSFGGAELVVLTANESRKIE-SISRAAKGTFWRIAVFYITTVVIIGC 320

Query: 342 LVPYNSPELLGSGS-AATHASPFVIAIASHGV--KVVPHXXXXXXXXXXXXXXXXXXXXX 398
           LVP     LLG+ S     ASPFVIA+++ G     V H                     
Sbjct: 321 LVPSTDERLLGAASDVDVTASPFVIALSNTGSFGDKVSHFMNAVILIAVLSVCNSCVYAA 380

Query: 399 XXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISG 458
                        P    Y+DR+GRP+  + +  VFGLL F+ AS KE  VFTWL A+  
Sbjct: 381 SRVIQSLGASRQLPSFCGYIDRKGRPLVGIGICGVFGLLGFLVASSKEGEVFTWLFALCS 440

Query: 459 LSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVA 518
           +S  FTWF I  S VRFR ++  QGRS DE+ Y+S  G WG             G+ +V+
Sbjct: 441 ISSFFTWFCICFSQVRFRLALRAQGRSSDEIAYKSMLGFWGGVLGCVLNILLIAGEIYVS 500

Query: 519 ISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRV-IIPANEVDLVSHRKIFDAE 577
           + P+G +  +A  FF+  L++PI+I +Y  ++++  +W   II   ++DL + RK  D E
Sbjct: 501 LFPLGGSP-NAEGFFQYCLSIPIMIFVYFCHRIYRNNWTDWIISTKKIDLDTGRKAEDLE 559

Query: 578 IMQSEQLEEKEQLRHASWTKRAAEFWC 604
           +M+ E L EK ++       R   FWC
Sbjct: 560 LMKHEILTEKARIASKPLYYRIYRFWC 586

>KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  306 bits (783), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 194/588 (32%), Positives = 301/588 (51%), Gaps = 31/588 (5%)

Query: 22  SVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDS 81
           S+  +K+TS         L   F +SFKR +++ N  D      E+ +  D  +    D 
Sbjct: 19  SISSIKDTS---------LLRNFKNSFKRVDQDQNKFD-----DEKYNSVDEGQKRLVDQ 64

Query: 82  SKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQ 141
              KTL+Q    RH+ MI++   +GTG+ +G G+SL +G P SLLIGY IV   ++CV+Q
Sbjct: 65  PLRKTLQQ----RHLTMIAIGGTLGTGLFIGLGESLASG-PGSLLIGYIIVGIAVFCVVQ 119

Query: 142 SASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWND 201
           SA+EL+  Y  +SG +       ++++F F+V+  YCL WL   P ELV ++M I+YWND
Sbjct: 120 SAAELSCQY-PVSGSYATLVTRFMNESFGFTVATNYCLAWLVCFPSELVGSAMVIRYWND 178

Query: 202 SINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND- 260
           S+N                              +  K++           + CGG  N  
Sbjct: 179 SVNSCVWIAIFWVFVMCLNLFGVEGYAETEFWLSIIKIIAIIIFIIIGIVLICGGGPNST 238

Query: 261 GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 320
           GY+G+ YWHDPG+F        FK L    V+AA+++GG E  VLT+AE +    SI  A
Sbjct: 239 GYIGTKYWHDPGSFAH----PVFKSLCNTFVSAAYSFGGCEIVVLTSAESRKIS-SIARA 293

Query: 321 SKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAA-THASPFVIAIASHGV--KVVPH 377
           +K   +RI   YL+T  ++G LVPY   +L+ + S+    ASPFVIA+++ G     V H
Sbjct: 294 AKGTFWRITIFYLVTIVIIGCLVPYTDNKLISATSSEDVTASPFVIALSNCGAMGTRVSH 353

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437
                                             P +  Y+DRRGRP+  + +  +FGLL
Sbjct: 354 FMNTVILVSTISVSNSCVYASSRIIQALGAMNQLPSICGYIDRRGRPLVGIAICGLFGLL 413

Query: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497
            F+ A+  E  +FTWL +++ ++   TWFSI    VRFR ++  QGRS DE+ Y+S  G+
Sbjct: 414 GFLVAAENEAAIFTWLYSLTSVAYFVTWFSICWCQVRFRMALKRQGRSNDEIAYKSMLGI 473

Query: 498 WGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWR 557
           +G Y           G+ +++I P+  +   AN FF+N L++PI++  + G+K++ + W+
Sbjct: 474 YGGYVGAILNIVLIIGEVYISIFPLNESP-SANIFFQNCLSIPIMLVSFFGHKIYCKGWK 532

Query: 558 V-IIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
              + A ++DL +   I D EI ++E  EEKE++  +    R   FWC
Sbjct: 533 DWFVRAKDIDLDTGNSITDFEIFKAEIEEEKERIASSPLYYRIYRFWC 580

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  304 bits (779), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 204/589 (34%), Positives = 291/589 (49%), Gaps = 26/589 (4%)

Query: 24  EVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGD-GIHSTHERVSGEDFE-RLAPDDS 81
           E +  ++ + +G+       + DSFK  E      D   H   ER   E  + RLA  + 
Sbjct: 14  EALSVSASKVQGAYSSAVRSWKDSFKPSELSQIPEDLDYHDLTER---EKIQLRLA--NQ 68

Query: 82  SKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQ 141
              K L Q    RH+ MI++   +GTG+ +G G +L   GPA+LLIGY +V T ++CVIQ
Sbjct: 69  PYQKVLHQ----RHLSMIAIGGTLGTGLFIGLGAAL-TSGPAALLIGYLLVGTSMFCVIQ 123

Query: 142 SASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWND 201
           SA+ELA  +  +SG + ++ +  VD++  F+V+  Y L WL + P EL+  S+TI YWN 
Sbjct: 124 SAAELACQF-PVSGSYASHVSRFVDESLGFTVATNYTLAWLVLFPSELIGCSLTISYWNS 182

Query: 202 SINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGN-D 260
           SINP                             +  KVL           +  GG  +  
Sbjct: 183 SINPAVWVSIFLVFVLWINLFGVRIFAETEFILSIIKVLAIIIFIIIGIVLIAGGGPDPG 242

Query: 261 GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 320
           GY+G+ YWHDPG F        FK L    V AAF++GG E  +LT  E +N   SI  A
Sbjct: 243 GYIGTKYWHDPGPFAK----PVFKNLCQTFVAAAFSFGGTEMVLLTGTESKN-VSSIARA 297

Query: 321 SKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIA---SHGVKVVP 376
           +K   YRI   Y+ T  ++G LVPYN P LL  S S    ASPFVIA++   S G K V 
Sbjct: 298 AKGTFYRIAIFYVTTVVVIGCLVPYNDPRLLSASSSEDISASPFVIALSNTGSMGAK-VS 356

Query: 377 HXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGL 436
           H                               G  PK+F Y+DR+GRP+  + VS  FGL
Sbjct: 357 HFMNAVILVAVVSVCNSTVYASSRLIQALGTAGQLPKIFGYMDRKGRPLVGIAVSATFGL 416

Query: 437 LCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTG 496
           L F+ A+ K+  VFTWL A+  ++   TWFSI L+ VR+R +M  + RSLD + Y+S  G
Sbjct: 417 LGFLVATKKQSEVFTWLFALCSVAAFVTWFSICLAQVRYRMAMRARKRSLDSIAYKSILG 476

Query: 497 VWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDW 556
           +WG             G+ +V+  P  + K  A  FF+  L++PI+I ++LG+K+   DW
Sbjct: 477 IWGGVVGCIVNFLLVAGEVYVSAFPANA-KSSAEGFFKYTLSIPIMIVVFLGHKIHRNDW 535

Query: 557 -RVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
               +   ++DL +   I D E+ Q+++  EK  L       R   FWC
Sbjct: 536 GNWYVKRKDMDLDTGCSIEDFELFQAQKEAEKRALASRPLYYRVYRFWC 584

>KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 588

 Score =  303 bits (777), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 196/577 (33%), Positives = 298/577 (51%), Gaps = 22/577 (3%)

Query: 34  EGSRDGLFHRFVDSFKRPE-EEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIK 92
           +GSR  LF R  DSFKR E  E  G D      +  S  D++R   +     +  ++N+ 
Sbjct: 28  DGSRS-LFTRVKDSFKRQELVETEGID-----LDTYSMTDYQR--TNYLLAKQPYQKNLS 79

Query: 93  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTS 152
            RH+ MI++   +GTG+ +G G SL +G P +LLIG+ +    ++CV+Q A+EL+  Y  
Sbjct: 80  QRHLTMIAIGGTLGTGLFIGIGWSLASG-PGNLLIGFLLTGLAIFCVVQCAAELSCQY-P 137

Query: 153 LSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXX 212
           +SG F ++ +  VD ++ F+V+  YCL W    P EL+  +MTI YW+ S+NP       
Sbjct: 138 VSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTIGYWDSSVNPVVWVIIF 197

Query: 213 XXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGN-DGYLGSVYWHDP 271
                                 +  K+L           + CGG  N +GY+G+ YWHDP
Sbjct: 198 WLFIMALNLFGVRGFAETEYVLSIFKILAIIIFLIIGVVLICGGGPNSNGYIGTKYWHDP 257

Query: 272 GAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGI 331
           G+F+       FK L    V+AAF++GG E  VLTAAE +  + SI  A+K   +R+I  
Sbjct: 258 GSFKA----PVFKSLCNTFVSAAFSFGGTELVVLTAAESRKVE-SISRAAKGTFWRVIVF 312

Query: 332 YLMTAALLGFLVPYNSPELLGSGSAA-THASPFVIAIASHGV--KVVPHXXXXXXXXXXX 388
           Y+ T  ++G LVPY    LLG  ++    ASPFVIA+A+ G   + V +           
Sbjct: 313 YVSTVVVIGCLVPYTDERLLGGDTSEDIAASPFVIALANTGKFGERVSNFMNAVILIAVL 372

Query: 389 XXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEET 448
                               G  P +  YVDR+GRP+  +LV  +FG L F+ AS K   
Sbjct: 373 SVCNSCVYAASRVIQSLGASGQLPSICGYVDRKGRPLFGILVVGLFGFLPFIVASNKVSE 432

Query: 449 VFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXX 508
           VF WL A+  +S +F WFSI  S++R+R ++  Q RS DE+ Y+S  G+WGAY       
Sbjct: 433 VFDWLFALCSISSMFIWFSICYSYLRYRWALKKQNRSADEIAYKSMLGIWGAYLGLLLSA 492

Query: 509 XXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWR-VIIPANEVDL 567
               G+ +V++ P+G +   A  FF+  L++PI+I +Y+G+K +  +W+  +IP + +DL
Sbjct: 493 LLIVGEIYVSLFPLGESP-SAEAFFKYCLSIPIMIAVYIGHKSYTGNWKSFVIPLSGIDL 551

Query: 568 VSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            +     D EIM+ E   ++ +L       R   FWC
Sbjct: 552 DTGLSHSDVEIMKHELEIQRVKLASKPLYYRIFRFWC 588

>YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}
           SAM3High-affinity S-adenosylmethionine permease,
           required for utilization of S-adenosylmethionine as a
           sulfur source; has similarity to S-methylmethionine
           permease Mmp1p
          Length = 587

 Score =  302 bits (773), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 193/599 (32%), Positives = 299/599 (49%), Gaps = 34/599 (5%)

Query: 18  ESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLA 77
           + F  +E    T P        L  R  DSFK+             ++  V  ED E   
Sbjct: 11  DKFTKIETESTTIPNDSDRSGSLIRRMKDSFKQ-------------SNLHVIPEDLENSE 57

Query: 78  PDDSSK------HKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAI 131
             +  K       +  ++ +  RH+ MI++   +GTG+ +G G SL +G PA+LLIG+ +
Sbjct: 58  QTEQEKIQWKLASQPYQKVLSQRHLTMIAIGGTLGTGLFIGLGYSLASG-PAALLIGFLL 116

Query: 132 VSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVT 191
           V T ++CV+QSA+EL+  +  +SG +  + +  +D++  F+V+  Y L WL   P EL+ 
Sbjct: 117 VGTSMFCVVQSAAELSCQF-PVSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIG 175

Query: 192 ASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXX 251
            ++TI YWN ++NP                             +  KV+           
Sbjct: 176 CALTISYWNQTVNPAVWVAIFYVFIMVLNLFGVRGFAETEFALSIIKVIAIFIFIIIGIV 235

Query: 252 VNCGGAGND-GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQ 310
           +  GG  N  GY+G+ YWHDPGAF        FK L    V+AAF++GG+E  +LT+ E 
Sbjct: 236 LIAGGGPNSTGYIGAKYWHDPGAFAK----PVFKNLCNTFVSAAFSFGGSELVLLTSTES 291

Query: 311 QNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIA- 368
           +N   +I  A+K   +RI   Y+ T  ++G LVPYN P LL GS S    ASPFVIA++ 
Sbjct: 292 KNIS-AISRAAKGTFWRIAIFYITTVVIIGCLVPYNDPRLLSGSNSEDVSASPFVIALSN 350

Query: 369 --SHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVR 426
             S G K V +                               G  P + +Y+DR+GRP+ 
Sbjct: 351 TGSMGAK-VSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLV 409

Query: 427 CLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSL 486
            + +S  FGLL F+ AS KE+ VFTWL A+  +S  FTWF I +S +RFR ++  QGRS 
Sbjct: 410 GIGISGAFGLLGFLVASKKEDEVFTWLFALCSISSFFTWFCICMSQIRFRMALKAQGRSN 469

Query: 487 DELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLY 546
           DE+ Y+S  GV+G             G+ +V+ +PVGS    A  FFE  L++PI+I +Y
Sbjct: 470 DEIAYKSILGVYGGILGCVLNALLIAGEIYVSAAPVGSPS-SAEAFFEYCLSIPIMIVVY 528

Query: 547 LGYKLWYRDWR-VIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
             ++ + RDW+   I  +E+DL +   + + E+ ++++  E++ +    +  +   FWC
Sbjct: 529 FAHRFYRRDWKHFYIKRSEIDLDTGCSVENLELFKAQKEAEEQLIASKPFYYKIYRFWC 587

>KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score =  301 bits (770), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 192/591 (32%), Positives = 302/591 (51%), Gaps = 28/591 (4%)

Query: 21  DSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEE--YNGGDGIHSTHERVSGEDFERLAP 78
           DSV+   E S   +G+     +RF DSFKR + +   +  D  ++  E+V      RLA 
Sbjct: 16  DSVKTGSEFSSSEKGT---FLYRFRDSFKRVDLDATIDEDDSKYTAEEKVQ----LRLA- 67

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
                 + LK+ +  RH+ MI++   +GTG+ +G G SL +G P  LLIG+ +V   ++C
Sbjct: 68  -----KQPLKKALMQRHLTMIAIGGTLGTGLFIGLGYSLASG-PGCLLIGFILVGLSMFC 121

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
           V+QSA+EL+  Y  +SG +  +    +D++  F+VS  Y L WL   P EL+ ++M I+Y
Sbjct: 122 VVQSAAELSCQY-PVSGSYATHVTRFIDESIGFTVSTNYALAWLISFPSELMGSAMVIQY 180

Query: 199 WNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGA- 257
           WNDS++P                             +  K+L           + CGG  
Sbjct: 181 WNDSVDPAVWIAIFYLFVMFLNLFGVEGFAETEFWLSIIKILAIIIFIIIGIVLICGGGP 240

Query: 258 GNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317
           G+ GY+G+ YWH+PG+F        FK L    V+AAF++GGAE  +LTAAE +    +I
Sbjct: 241 GSSGYIGTKYWHNPGSFAH----PVFKSLCNTFVSAAFSFGGAELVLLTAAESKKIS-AI 295

Query: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGS-AATHASPFVIAIASHGV--KV 374
             A+K   +RI   Y+ T  ++G LVPY    LLG+ S     ASPFVIA+ + G     
Sbjct: 296 SRAAKGTFWRIAVFYITTVVIIGCLVPYTDERLLGASSDEDVTASPFVIALTNAGSMGSS 355

Query: 375 VPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVF 434
           V +                               G  P++  Y+D++GRP+  +++  +F
Sbjct: 356 VANFMNVIILVAVISVCNSCVYASSRVIQALGSAGQLPRICGYIDKKGRPLVGIVICGIF 415

Query: 435 GLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSW 494
           GLL F+    +E TVFTWL A+  +S  FTWF I  S VR+R ++  Q RS DE+ Y+S 
Sbjct: 416 GLLAFLIDCSEEGTVFTWLFALCSISSFFTWFCICFSQVRYRIALKKQNRSNDEIAYKSM 475

Query: 495 TGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYR 554
            G++G             G+ +V+ISP+  +   A+ FFEN L++PI+I +Y+ +K + +
Sbjct: 476 LGIYGGILGSLLNILLIMGELYVSISPLDESP-SASAFFENCLSIPIMIVVYIFHKTYKK 534

Query: 555 DWR-VIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            WR + IP   +DL + R + +  + + ++ E+K  +    +  R   FWC
Sbjct: 535 GWRSLFIPLKHIDLDTGRAVENLALFKQQREEQKIIIASKPFYYRVYRFWC 585

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  299 bits (765), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 199/608 (32%), Positives = 306/608 (50%), Gaps = 31/608 (5%)

Query: 8   NIKSPEDGVV----ESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPE--EEYNGGDGI 61
           NI+S     V    E+F        T   SEG+    F RF DSF R +  E Y+  DG 
Sbjct: 17  NIRSSSKEFVKVEEEAFTEESSASYTRNYSEGT---FFERFKDSFTRVDNIEPYSELDGD 73

Query: 62  HSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGG 121
             T +       E++    +++    K+++  RH+ MI++   +GTG+ +G G SL +G 
Sbjct: 74  KYTKD-------EQIQMTLAAQ--PYKKSLHQRHLTMIAIGGTLGTGLFIGLGYSLASG- 123

Query: 122 PASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQW 181
           PASLLIG+ IV T ++CV+QSA+EL+  Y  +SG +  + +  +D++  F+VS  Y L W
Sbjct: 124 PASLLIGFLIVGTSMFCVVQSAAELSCQYP-VSGSYATHVSRFLDESLGFTVSTNYALAW 182

Query: 182 LCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLM 241
           L   P EL+  SMTI YWNDSINP                             +  KV+ 
Sbjct: 183 LISFPSELIGISMTISYWNDSINPCVWIAIFYVFIMILNLFGVKGFAETEFWLSLIKVIA 242

Query: 242 XXXXXXXXXXVNCGGA-GNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGA 300
                     + CGG   + GY+G+ YWHDPG+F        FKGL    V+AAF++GG+
Sbjct: 243 IIIFIIVGIVLICGGGPESSGYIGTKYWHDPGSF----APPVFKGLCNTFVSAAFSFGGS 298

Query: 301 EFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGS-AATH 359
           E  +LTAAE +N   +I  A+K   +RI   Y+ T  ++G LVPYN   LLG  S     
Sbjct: 299 ELVLLTAAESKNIS-AISRAAKGTFWRIAVFYIATVVIIGCLVPYNDRRLLGGASDEDVS 357

Query: 360 ASPFVIAIASHGV--KVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNY 417
           ASPFV+A+ S     + + +                               G  P +  Y
Sbjct: 358 ASPFVLALGSSTDLGRKLSNFMNFVILIAVVSVANSCVYASSRVIQALGSSGQLPSICGY 417

Query: 418 VDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRR 477
           +D+ GRP+  + +  VFGLL F+ AS  E TVFTWL A+  +S  FTWF I  S VRFR 
Sbjct: 418 IDKSGRPLVGIAICGVFGLLGFLVASSNERTVFTWLFALCSISSFFTWFCICFSQVRFRL 477

Query: 478 SMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYL 537
           ++  Q RS D++ ++S  G++G             G+ +V+ SP+G     A  FFEN L
Sbjct: 478 ALKKQNRSTDDIAFKSMLGIYGGILGSILNILLIMGEIYVSASPLGEPS-SAEAFFENCL 536

Query: 538 AMPILIGLYLGYKLWYRDWRVIIPA-NEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWT 596
           ++P+++ +++ ++ + ++WR    + +E+DL +     D E+ + ++ + K +++     
Sbjct: 537 SIPLMLLVFIAHRFYRKNWRDWYKSLDEIDLDTGCSYDDIELFKHQREQIKHKIQSKPLY 596

Query: 597 KRAAEFWC 604
            +   FWC
Sbjct: 597 YKIYRFWC 604

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  298 bits (763), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 191/581 (32%), Positives = 293/581 (50%), Gaps = 22/581 (3%)

Query: 29  TSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLK 88
           ++P +EG  + L HRF +SFKR     N    I          + E++  D +  ++  K
Sbjct: 20  STPSNEG--NNLIHRFKNSFKR-----NDSPAIQEGLLYSELSEEEKIQWDLA--NQPYK 70

Query: 89  QNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAI 148
           + +  RH+ MI++   +GTG+ +G G+SL +G PASLLIG+ +V   + CV+Q  +EL+ 
Sbjct: 71  KVLDQRHLTMIAIGGTLGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAELSC 129

Query: 149 IYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAX 208
            Y  +SG +  + +  +D +  FS+   Y L WL   P ELV  S+TI YW  S+NP A 
Sbjct: 130 QY-PVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAW 188

Query: 209 XXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND-GYLGSVY 267
                                     +  K++           +  GG  +  GY+G+ Y
Sbjct: 189 VAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGYIGTKY 248

Query: 268 WHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYR 327
           WHDPG+F     +  FK L    V+AA+++ G E  VLT+ E ++   S+  A+K   +R
Sbjct: 249 WHDPGSF----AVPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARS-VSSVSRAAKGTFWR 303

Query: 328 IIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGV--KVVPHXXXXXXX 384
           II  Y++T  ++G LVPYN P L+ GS S    ASPFVIA+++ G     V H       
Sbjct: 304 IIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVIALSNTGAMGTRVSHFMNAVIL 363

Query: 385 XXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASP 444
                                   G  PK+  Y+DR GRP+  + +   FGLL F+  S 
Sbjct: 364 IAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVSK 423

Query: 445 KEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAX 504
            + TVFTWL A+  +S   TWF I    VRFR +M  QGRS D++ Y+S  G++G  +  
Sbjct: 424 NQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGIFGC 483

Query: 505 XXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRV-IIPAN 563
                   G+ +V+ +PVGS    A NFFE  +++PI+I +Y+G++++ RDWR   I   
Sbjct: 484 ILNVLLVIGEIYVSAAPVGSPS-SAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKRM 542

Query: 564 EVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           ++DL S   + D E  + E+ E+K+ +       R   F+C
Sbjct: 543 DIDLDSGHSLEDFEATKLERDEDKKYVSSKPLYYRIYRFFC 583

>TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  294 bits (753), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 195/592 (32%), Positives = 289/592 (48%), Gaps = 24/592 (4%)

Query: 20  FDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPD 79
           F   E +  +   +    + L  R  +SFKR E        I    E     + ER+   
Sbjct: 10  FAKTEALSSSVSLNTSESNSLMGRIKNSFKRHELTL-----ISEDQEINDVPEQERIQRR 64

Query: 80  DSSK--HKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLY 137
            +S+   K L Q    RH+ MI++   +GTG+ +G G SL +G P +LLIG+ +V T ++
Sbjct: 65  LASQPYQKVLDQ----RHLTMIAIGGTLGTGLFIGLGYSLASG-PGALLIGFLLVGTSMF 119

Query: 138 CVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIK 197
           CV+QSA+EL+  Y  +SG +  + +  VD++  F+VS  Y L WL   P EL+  S+TI 
Sbjct: 120 CVVQSAAELSCQYP-VSGSYATHVSRFVDESVGFTVSTNYALAWLISFPSELIGCSITIT 178

Query: 198 YWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGA 257
           YWN S+NP                             +  KVL           +  GG 
Sbjct: 179 YWNQSVNPAVWVAIFYIFIMGLNLFGVRGFAETEFFLSIIKVLAIIIFIIIGIVLIAGGG 238

Query: 258 -GNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 316
             + GY+G+ YWH PG+F        FK L    V+AAF++GG+E  +LT+ E +N   S
Sbjct: 239 PDSSGYIGTKYWHQPGSF----AQPVFKNLCNTFVSAAFSFGGSELVLLTSTEARNV-SS 293

Query: 317 IRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGVK-- 373
           I  A+K   +RI   Y+ T  ++G LVPY    LL GS S    ASPFVIA+++ G    
Sbjct: 294 IARAAKGTFWRIAVFYITTVVIIGCLVPYTDERLLNGSSSEDVSASPFVIALSNSGSMGG 353

Query: 374 VVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCV 433
            V +                               G  PK  +++D++GRP+  + +S V
Sbjct: 354 KVANFMNVIILIAVLSVCNSCVYASSRIIQALGAAGQLPKACSFIDKKGRPLVGIAISGV 413

Query: 434 FGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQS 493
           FGLL F+ A  KE  VFTWL A+  +S  FTWF I LS VRFR ++  QGR   ++ Y+S
Sbjct: 414 FGLLGFLVACDKEGEVFTWLFALCSISSFFTWFCICLSQVRFRMALRAQGRPKSDIAYKS 473

Query: 494 WTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWY 553
             GV+G             G+ +VA SPVG     A  FFE  L++PI+I +Y G++ + 
Sbjct: 474 MLGVYGGIVGCVLNFLLIAGEIYVASSPVGGES-SARGFFEYCLSIPIMIVVYFGHRFYR 532

Query: 554 RDW-RVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
            DW    I    +DL +   I + E+ + ++ +E+E++    +  R   FWC
Sbjct: 533 NDWGNWYIKRRNIDLDTGCSIENVELFRQQREQEQEKISSRPFYYRIYRFWC 584

>Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W
           (REAL)
          Length = 586

 Score =  292 bits (748), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 188/582 (32%), Positives = 291/582 (50%), Gaps = 32/582 (5%)

Query: 18  ESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLA 77
           + F  +E    T P        L  R  DSFK+             ++  V  ED E   
Sbjct: 11  DKFTKIETESATIPGGSDHSGSLMRRMKDSFKQ-------------SNLNVITEDLENSE 57

Query: 78  PDDSSK------HKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAI 131
             +  K       +  ++ +K RH+ MI++   +GTG+ +G G SL +G PA+LLIG+ +
Sbjct: 58  QSEQEKIQWKLASQPYQKVLKQRHLTMIAIGGTLGTGLFIGLGYSLASG-PAALLIGFLL 116

Query: 132 VSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVT 191
           V T ++CV+QSA+EL+  +  +SG +  + +  +D++  F+V+  Y L WL   P EL+ 
Sbjct: 117 VGTSMFCVVQSAAELSCQF-PVSGSYATHVSRFIDQSIGFTVATNYALSWLISFPSELIG 175

Query: 192 ASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXX 251
            S+TI YWN ++NP                             +  KV+           
Sbjct: 176 CSLTISYWNQTVNPAVWVAIFYVFIMCLNLFGVKGFAETEFALSIIKVISIFIFIIIGIV 235

Query: 252 VNCGGAGND-GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQ 310
           +  GG  N  GY+G+ YWH+PG+F        FK L    V+AAF++GG+E  +LT+ E 
Sbjct: 236 LIAGGGPNSTGYIGTRYWHNPGSFAK----PVFKNLCNTFVSAAFSFGGSELVLLTSTES 291

Query: 311 QNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIAS 369
           +N   SI  A+K   +RI   Y+ T  ++G LVPYN P LL GS S    ASPFVIA+++
Sbjct: 292 KNI-SSISRAAKGTFWRIAIFYITTVVIIGCLVPYNDPRLLNGSTSEDISASPFVIALSN 350

Query: 370 HGV--KVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRC 427
            G     V +                               G  P++  Y+DR+GRP+  
Sbjct: 351 TGSMGTRVSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPEICAYMDRKGRPLVG 410

Query: 428 LLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLD 487
           + +S +FGLL F+ AS KE  VFTWL A+  +S  FTWF I +S VRFR ++  QGRS +
Sbjct: 411 IGISGIFGLLGFLVASNKEGEVFTWLFALCSISSFFTWFCICMSQVRFRMALKAQGRSKN 470

Query: 488 ELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYL 547
           E+ Y+S  GV+G             G+ +V+ +PVG     A  FFE  L++PI+I +Y+
Sbjct: 471 EIAYKSMLGVYGGVLGCVLNALLIAGEIYVSAAPVGGTS-TAKGFFEYCLSIPIMIVVYI 529

Query: 548 GYKLWYRDWRV-IIPANEVDLVSHRKIFDAEIMQSEQLEEKE 588
            ++++  DW+   I  +++DL +   + + E+   ++  EKE
Sbjct: 530 SHRIYRGDWKNWYIKKSKIDLDTGCSVENLELFNEQKQAEKE 571

>TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  292 bits (747), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 198/610 (32%), Positives = 293/610 (48%), Gaps = 44/610 (7%)

Query: 7   KNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEE-------EYNGGD 59
           K IK+  D +     SV   KE    S   RD     + DSFKR +        EYN   
Sbjct: 7   KFIKNDTDTL-----SVSASKEHGAYSSAVRD-----WRDSFKRQDLLEMPDALEYNDLT 56

Query: 60  GIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHN 119
               T  +++ + ++++              +  RH+ MIS+   +GTG+ +G G +L  
Sbjct: 57  EREKTQLKLASQPYKKV--------------LSQRHLTMISIGGTLGTGLFIGLGAAL-T 101

Query: 120 GGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCL 179
            GPA+LLIGY +V   ++CVIQSASELA  +  ++G ++++    VD++  F+V   Y L
Sbjct: 102 SGPAALLIGYLLVGASMFCVIQSASELACQF-PVTGSYSSHVTRFVDESVGFTVGTNYTL 160

Query: 180 QWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKV 239
            WL + P EL+  S+TI YWN +INP                             +  KV
Sbjct: 161 AWLVLFPSELIGCSLTISYWNSTINPAVWVAIFLVFVLWINLFGVRLFAETEFVLSIIKV 220

Query: 240 LMXXXXXXXXXXVNCGGAGND-GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYG 298
           L           +  GG  +  GY+G+ YWHDPG F        FK L    V+AAF+YG
Sbjct: 221 LAIVIFIIIGIVLIAGGGQDSGGYIGTRYWHDPGPFAK----PVFKNLCNTFVSAAFSYG 276

Query: 299 GAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAA 357
           G+E  +LT  E +N   SI  A+K   YRI   Y+ T  ++G LVPYN P LL  S S  
Sbjct: 277 GSEMVLLTGTESKNIS-SIARAAKGTFYRIAIFYITTVVVIGCLVPYNDPRLLNASSSED 335

Query: 358 THASPFVIAIASHGV--KVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLF 415
             ASPFVIA+ + G     V +                               G  P + 
Sbjct: 336 ISASPFVIALGNTGSMGSKVSNFMNAIILVSVVSVCNSTVYASSRLIQALGAAGHLPGIC 395

Query: 416 NYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRF 475
            Y+D +GRP+  + ++  FGLL F+ A+ K+  VFTWL A+  ++   TWF I L+ VRF
Sbjct: 396 GYMDMKGRPLVGIAITGAFGLLGFLVATNKQSEVFTWLFALCSIASFVTWFCICLAQVRF 455

Query: 476 RRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFEN 535
           R +M  + RS + + Y+S  G++G             G+ +V+  PV   K  A  FFE 
Sbjct: 456 RLAMKARKRSKEHIAYRSMLGIYGGIAGCIVNFLLIAGEIYVSAWPV-DGKSSAEGFFEY 514

Query: 536 YLAMPILIGLYLGYKLWYRDWRV-IIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHAS 594
            L++PI+I ++LG+K++  DW+   +   ++DL +   I + E+ QS++  EKE L    
Sbjct: 515 DLSIPIMIIVFLGHKIYRNDWKNWYVKRRDMDLDTGCSIENLELFQSQKESEKEDLACKP 574

Query: 595 WTKRAAEFWC 604
              R   FWC
Sbjct: 575 LYYRIYRFWC 584

>Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W
           (REAL)
          Length = 590

 Score =  291 bits (744), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 196/603 (32%), Positives = 302/603 (50%), Gaps = 39/603 (6%)

Query: 18  ESFDSVEVVKETSP----RSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDF 73
           + F  +E      P    RS+ S + L  R  DSFK+             ++  V  ED 
Sbjct: 11  DKFTKIETESTMIPTGLERSDKS-ESLIRRMKDSFKQ-------------SNLHVIPEDL 56

Query: 74  ERLAPDDSSK------HKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLI 127
           E     +  K       +  ++ +  RH+ MI++   +GTG+ +G G SL +G PA+LLI
Sbjct: 57  ENSEQTEQEKIQWKLASQPYQKVLSQRHLTMIAIGGTLGTGLFIGLGYSLASG-PAALLI 115

Query: 128 GYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPL 187
           G+ IV T ++CV+QSA+EL+  +  +SG +  + +  +D++  F+V+  Y L WL   P 
Sbjct: 116 GFLIVGTSMFCVVQSAAELSCQF-PVSGSYATHVSRFIDESVGFTVATNYALAWLISFPS 174

Query: 188 ELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXX 247
           EL+  S+TI YWN ++NP                             +  KV+       
Sbjct: 175 ELIGCSLTISYWNQTVNPAVWVAIFYTFIMVLNLFGVKGFAETEFALSIIKVVAIIIFII 234

Query: 248 XXXXVNCGGAGND-GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLT 306
               +  GG  N  GY+G+ YWH+PGAF        FK L    V+AAF++GG+E  +LT
Sbjct: 235 IGIVLIAGGGPNSTGYIGTKYWHNPGAF----AKPVFKNLCNTFVSAAFSFGGSELVLLT 290

Query: 307 AAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVI 365
           + E ++   +I  A+K   +RI   Y+ T  ++G LVPYN   LL GS S    ASPFVI
Sbjct: 291 STESKDIS-AISRAAKGTFWRIAIFYITTVVIIGCLVPYNDSRLLSGSTSEDISASPFVI 349

Query: 366 AI---ASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRG 422
           A+    S G K V +                               G  P + +Y+DR+G
Sbjct: 350 ALRNTGSMGAK-VSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKG 408

Query: 423 RPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQ 482
           RP+  + +S  FGLL F+ AS KE+ VFTWL A+  +S  FTWF I LS VRFR ++  Q
Sbjct: 409 RPLVGIGISGAFGLLGFLVASNKEDEVFTWLFALCSISSFFTWFCICLSQVRFRMALKTQ 468

Query: 483 GRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPIL 542
           GRS DE+ Y+S  GV+G             G+ +V+ +PVGS    A  FFE  L++PI+
Sbjct: 469 GRSKDEIAYKSILGVYGGVLGCVLNALLIAGEVYVSAAPVGSPS-SAKAFFEYCLSIPIM 527

Query: 543 IGLYLGYKLWYRDWRV-IIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAE 601
           I +Y+ ++++ +D R   I  +E+DL +   + + E+ ++++  EK+ +    +  +   
Sbjct: 528 IVVYIAHRIYRKDRRRWYIKRSEIDLDTGCSVENLELFKAQKEAEKQLIASKPFYYKIYR 587

Query: 602 FWC 604
           FWC
Sbjct: 588 FWC 590

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score =  286 bits (731), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 179/512 (34%), Positives = 263/512 (51%), Gaps = 20/512 (3%)

Query: 98  MISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGF 157
           MIS+   +GTG+ +G G+SL +G P +LLIG+ IV   ++CVIQSA+EL+  Y  +SG F
Sbjct: 1   MISIGGTLGTGLFIGIGQSLQSG-PGTLLIGFLIVGVSIFCVIQSAAELSCQY-PVSGSF 58

Query: 158 NAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXX 217
           +++ +  ++ +  F+VS  Y L WL   P ELV  +MTI YWN+ I P            
Sbjct: 59  SSHVSRFIEPSLGFTVSCAYALSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVI 118

Query: 218 XXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGN--DGYLGSVYWHDPGAFR 275
                            +  KVL           + CGG  N  +GYLG  YWHDPGAFR
Sbjct: 119 GLNLFAVRGFAESEFWLSIIKVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFR 178

Query: 276 GNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMT 335
                  F  L    V+AAF +GGAE  +LTA E +  + SI  A+K   +RI   Y+ T
Sbjct: 179 P----PFFSSLCQTFVSAAFTFGGAELVLLTANESRKIE-SISRAAKGTFWRIAIFYIST 233

Query: 336 AALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGV--KVVPHXXXXXXXXXXXXXXXX 393
             ++G LVPY SP L G    +  ASPFVIA+++ G     V H                
Sbjct: 234 VIVIGCLVPYTSPALDGE---SIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNS 290

Query: 394 XXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWL 453
                          G  P++F Y+D++GRP+  + V  VFGLL F+  + K + VF WL
Sbjct: 291 CVYAASRVIQSLGACGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWL 350

Query: 454 LAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXG 513
            A+  ++  F WF I +S +R+RR++ VQG   +E+ YQS  G W              G
Sbjct: 351 FALCSIAAFFVWFCICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICG 410

Query: 514 QFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRV-IIPANEVDLVSHRK 572
           + +V++        D   FF+N +++P+LI  Y  ++L+ RDW+  +IPA ++DL + RK
Sbjct: 411 EIYVSV-----KDGDVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRK 465

Query: 573 IFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
             D E+M+ E +  + ++  + W  RA  FWC
Sbjct: 466 PEDLEMMKHELIVSRARIASSPWYYRAYRFWC 497

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  286 bits (731), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 164/496 (33%), Positives = 253/496 (51%), Gaps = 36/496 (7%)

Query: 28  ETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTL 87
           +  P  +  +  LFHR +DSFK PE   NG                    PD      +L
Sbjct: 44  QVQPNKKAYKRNLFHRCIDSFKPPE---NG-----------------SFDPD------SL 77

Query: 88  KQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELA 147
           K+++K RH++MI++   IGTG+ VG+GK+L  GGP +++IG+ I  T +   I    E+ 
Sbjct: 78  KRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHGLGEIT 137

Query: 148 IIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDA 207
           + +  + G F  Y    +D + +F VS +Y LQW  +LPLE++ ++MTI++WN SI+P  
Sbjct: 138 VRF-PVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTSIDPVV 196

Query: 208 XXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVY 267
                                      ++ KV+           +  GG     Y+G+ Y
Sbjct: 197 WVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEYVGARY 256

Query: 268 WHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYR 327
           WHDPGA       + FKG+ +V V A+++ GG+E + L + E     K + SA K++ +R
Sbjct: 257 WHDPGALA-----HGFKGVASVFVTASYSLGGSEMACLASGETD--PKELPSAIKQVFWR 309

Query: 328 IIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXX 387
           II  +L++  L+GFLVPY +  LLG  S   + SPFVIA   + +KV+P           
Sbjct: 310 IIFFFLVSLTLVGFLVPYTNQNLLGGSS--VNNSPFVIACNLYHIKVLPSIINAVILVSI 367

Query: 388 XXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEE 447
                               QG  P++F YVDR GRP+  ++ + +FGLL F+  S    
Sbjct: 368 MSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAFLVKSSSMS 427

Query: 448 TVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXX 507
            VF WL+AI+GL+    W SI++SH+RFR +M  Q ++LDEL + S  G+WG+ Y+    
Sbjct: 428 EVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAVGIWGSVYSAVVN 487

Query: 508 XXXXXGQFWVAISPVG 523
                 QF++++ PVG
Sbjct: 488 VLILIAQFYISLWPVG 503

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  284 bits (726), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 191/584 (32%), Positives = 288/584 (49%), Gaps = 22/584 (3%)

Query: 28  ETSPRSEGSRDG--LFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHK 85
            TS  S  S DG  L HRF +SFKR     N    I          + E++  D +  ++
Sbjct: 15  STSVISTTSNDGNNLIHRFKNSFKR-----NDSSAIQDGLLYSELTEEEKIQWDLA--NQ 67

Query: 86  TLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASE 145
             K+ +  RH+ MI++   +GTG+ +G G+SL +G PASLLIG+ +V   + CV+Q  +E
Sbjct: 68  PYKKVLSQRHLTMIAIGGTLGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAE 126

Query: 146 LAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINP 205
           L+  Y  +SG +  + +  +D +  FS+   Y L WL   P ELV  S+TI YW  S+NP
Sbjct: 127 LSCQY-PVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNP 185

Query: 206 DAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND-GYLG 264
            A                           +  K++           +  GG  +  GY+G
Sbjct: 186 AAWVAIAFVLSMLLNMFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPDSTGYIG 245

Query: 265 SVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKL 324
           + YWHDPG+F        FK L    V+AA+++ G E  VLT+ E +N   S+  A+K  
Sbjct: 246 TKYWHDPGSF----APPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARN-VSSVSRAAKGT 300

Query: 325 VYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGV--KVVPHXXXX 381
            +RI+  Y++T  ++G LVPYN   L+ GS S    ASPFVIA+++ G   K V H    
Sbjct: 301 FWRIVIFYIVTVIIIGCLVPYNDSRLINGSSSEDITASPFVIALSNTGTMGKRVSHFMNA 360

Query: 382 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVA 441
                                      G  P++  Y+DR GRP+  + +   FGLL F+ 
Sbjct: 361 VILIAVFSVCNSCVYASSRLIQGLATAGQLPRICAYMDRNGRPLVGMAICGAFGLLGFLV 420

Query: 442 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAY 501
            S  + TVFTWL A+  +S   TWF I    VRFR +M  QGRS D++ Y+S  G++G  
Sbjct: 421 VSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSSLGIYGGI 480

Query: 502 YAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRV-II 560
                      G+ +V+ +PVGS    A NFFE  +++PI+I +Y+G++++ +DWR   I
Sbjct: 481 VGCILNVLLVIGEIYVSAAPVGSPS-SAANFFEYCMSIPIMIAVYIGHRIYRKDWRHWYI 539

Query: 561 PANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
              ++DL S   + D E  + E+  +K  +       R   F+C
Sbjct: 540 KRRDIDLDSGHSLEDFEATKLERDHDKRYVASRPLYYRIYRFFC 583

>Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {ON}
           YPL274W (SAM3) - High affinity S-adenosylMethionine
           Permease [contig 184] FULL
          Length = 596

 Score =  279 bits (714), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 195/607 (32%), Positives = 305/607 (50%), Gaps = 34/607 (5%)

Query: 14  DGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVS---- 69
           +GV ++  SVE  +  +  + GS   L +RF    +R        D  HS   + +    
Sbjct: 8   EGVEQAVSSVES-RTWNGETSGS---LINRFKQKSRRQIH-----DIAHSFQRQEAPNSE 58

Query: 70  GEDFERLAPDDSSKHKTLKQ----NIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASL 125
           G D   L+ +    ++   Q    ++  RH++MIS+   +GTG+ +G G SL +G P SL
Sbjct: 59  GVDLSLLSEEQRRNYELANQPYEKSLSQRHLMMISIGGTLGTGLFIGLGFSLASG-PGSL 117

Query: 126 LIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCIL 185
           LIG+ IV  M++CV+QSA+E+A  Y  +SG F+ + +  ++ +  F+VS  Y L WL   
Sbjct: 118 LIGFLIVGLMMFCVVQSAAEMACQY-PVSGSFSTHVSRFMEPSIGFTVSTNYALAWLISF 176

Query: 186 PLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXX 245
           P EL+  ++T++YW+ S+N                              +  KV+     
Sbjct: 177 PSELIGCAITLRYWS-SVNGAVWVAIFYVFIMQLNLFGVRGYGEAEFWMSLFKVVAIVIF 235

Query: 246 XXXXXXVNCGGA-GNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSV 304
                 + CGG   + GY+G+ YWH+PG+F        FKGL    ++AAF++GGAE  V
Sbjct: 236 IIIGIVLICGGGPHSSGYIGTKYWHNPGSF----AKPVFKGLCNTFISAAFSFGGAELVV 291

Query: 305 LTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAA-THASPF 363
           LTA+E +  + S+  A+K   +RI   Y+ T  ++G LVPY    LLG  +     ASPF
Sbjct: 292 LTASESKKVE-SVSRAAKGTFWRIAIFYITTVVVIGCLVPYTDDRLLGGDTGEDITASPF 350

Query: 364 VIAIASHGV--KVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRR 421
           VIA++  G     V H                               G  P+   Y+D++
Sbjct: 351 VIALSGQGSMGTKVSHFMNAVILIAVLSVCNSCVYASSRVIQALGACGQLPRACGYIDKK 410

Query: 422 GRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIV 481
           GRP+  + +  VFGLL F+ A  K++ VFTWL A+  +S  FTWF I +S VRFR ++  
Sbjct: 411 GRPLVGIAICGVFGLLGFLVACDKQDDVFTWLFALCSISSFFTWFCICVSQVRFRLALRA 470

Query: 482 QGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPI 541
           QGRS DE+ ++S  G++G             G+ +V+I P+G +   A  FF+  +++PI
Sbjct: 471 QGRSTDEIAHKSMLGIYGGILGGVLNILLIAGEIYVSIFPLGGSP-SAEQFFQYCMSIPI 529

Query: 542 LI---GLYLGYKLWYRDW-RVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTK 597
           +I    L+  YK   RD  R+++P +E+DL S R+I D E+ + E  E+K ++       
Sbjct: 530 MIVVYALHKTYKATRRDAKRILVPLSEIDLDSGRRIQDIELFKHELEEDKARIAAKPLYY 589

Query: 598 RAAEFWC 604
           R   FWC
Sbjct: 590 RIYRFWC 596

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  271 bits (692), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 156/491 (31%), Positives = 243/491 (49%), Gaps = 41/491 (8%)

Query: 18  ESFDSVEVVKETSPRSEGSRD-----GLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGED 72
           +   S +  ++T+P ++G R       +  R VDSFK PE                    
Sbjct: 25  QEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPE-------------------- 64

Query: 73  FERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIV 132
                 D S     LK+++K RH++MI++   IGTG+ +G+GK+L  GGP +L+IG+ I 
Sbjct: 65  ------DGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIA 118

Query: 133 STMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTA 192
            T +   I    E+ + +  + G F  Y    ++ + +F V  +Y LQW  +LPLE++ A
Sbjct: 119 GTQMVGTIHGLGEITVRF-PVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAA 177

Query: 193 SMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXV 252
           +MT++YW+ S++P                             +  KV+           +
Sbjct: 178 AMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVL 237

Query: 253 NCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQN 312
            CGG     ++G+ YWHDPG        N FKG+  VLV A+++ GG E + L + E   
Sbjct: 238 ICGGGPKKEFVGAKYWHDPGPLA-----NGFKGVAGVLVIASYSLGGTEMACLASGETD- 291

Query: 313 PQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGV 372
             K + SA K++ +RI+  +L++  L+GFLVPY +  L+G  S     SPFVIAI  HG+
Sbjct: 292 -PKELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS--VDNSPFVIAIRLHGI 348

Query: 373 KVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSC 432
             +P                               QG  P++F Y+DR GRP+  +L + 
Sbjct: 349 NALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNL 408

Query: 433 VFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQ 492
           +FGLL F+  S     VFTWL+AI+GL+    W SI++SH+RFR +M  QG  L+EL + 
Sbjct: 409 LFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFV 468

Query: 493 SWTGVWGAYYA 503
           S  G++G+ Y+
Sbjct: 469 SGVGIYGSVYS 479

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  271 bits (692), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 156/491 (31%), Positives = 243/491 (49%), Gaps = 41/491 (8%)

Query: 18  ESFDSVEVVKETSPRSEGSRD-----GLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGED 72
           +   S +  ++T+P ++G R       +  R VDSFK PE                    
Sbjct: 25  QEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPE-------------------- 64

Query: 73  FERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIV 132
                 D S     LK+++K RH++MI++   IGTG+ +G+GK+L  GGP +L+IG+ I 
Sbjct: 65  ------DGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIA 118

Query: 133 STMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTA 192
            T +   I    E+ + +  + G F  Y    ++ + +F V  +Y LQW  +LPLE++ A
Sbjct: 119 GTQMVGTIHGLGEITVRF-PVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAA 177

Query: 193 SMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXV 252
           +MT++YW+ S++P                             +  KV+           +
Sbjct: 178 AMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVL 237

Query: 253 NCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQN 312
            CGG     ++G+ YWHDPG        N FKG+  VLV A+++ GG E + L + E   
Sbjct: 238 ICGGGPKKEFVGAKYWHDPGPLA-----NGFKGVAGVLVIASYSLGGTEMACLASGETD- 291

Query: 313 PQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGV 372
             K + SA K++ +RI+  +L++  L+GFLVPY +  L+G  S     SPFVIAI  HG+
Sbjct: 292 -PKELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS--VDNSPFVIAIRLHGI 348

Query: 373 KVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSC 432
             +P                               QG  P++F Y+DR GRP+  +L + 
Sbjct: 349 NALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNL 408

Query: 433 VFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQ 492
           +FGLL F+  S     VFTWL+AI+GL+    W SI++SH+RFR +M  QG  L+EL + 
Sbjct: 409 LFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFV 468

Query: 493 SWTGVWGAYYA 503
           S  G++G+ Y+
Sbjct: 469 SGVGIYGSVYS 479

>TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON} 
          Length = 587

 Score =  269 bits (687), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 181/587 (30%), Positives = 288/587 (49%), Gaps = 23/587 (3%)

Query: 23  VEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSS 82
           VE++   S  + GSR   F  F++SFKR     +G   + S  E     + E++  D ++
Sbjct: 19  VELIASAS--ATGSRSH-FREFMESFKR-----DGAVTVPSDLEYDELTEEEKVQWDLAT 70

Query: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
           +    K+ +  RH+ MI++   +GTG+ +G G SL +G P SLLIG+ +V   + CV+Q 
Sbjct: 71  Q--PYKKVLDQRHLTMIAIGGTLGTGLFIGLGLSLASG-PGSLLIGFMLVGISMLCVVQC 127

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
            +EL+  Y  +SG +  + +  +D +  FSV   Y L WL   P ELV  S+T+ YWN+S
Sbjct: 128 GAELSCQY-PVSGSYALHASRFIDPSVGFSVGMNYLLMWLVSFPSELVGCSLTLSYWNNS 186

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVL-MXXXXXXXXXXVNCGGAGNDG 261
           +NP                             +  KV+ +          +  GG GN G
Sbjct: 187 VNPAVWVAIFFVFVMLLNLFGVRGFAETEFYMSIFKVISLFVFIIIGIVLITGGGPGNTG 246

Query: 262 YLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSAS 321
           Y+G+ YW DPG+F        FK      V+AA+++ G E  VLT+ E ++   SI  A+
Sbjct: 247 YIGTKYWQDPGSF----ATPAFKNFCNTFVSAAYSFSGTEMVVLTSTEVRDIS-SISRAA 301

Query: 322 KKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGV--KVVPHX 378
           K   +RI   Y++T  ++G LVPYN   LL G+ S    ASPFVIA+++ G       + 
Sbjct: 302 KGTFWRIALFYIVTVVIIGCLVPYNDERLLSGATSEDISASPFVIALSNTGSMGSKAANF 361

Query: 379 XXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLC 438
                                         G  P +  Y+DR GRP+  + ++ VFGLL 
Sbjct: 362 MNVVILVAVVSVCNWCVYASSRLIQGLATAGQLPSICGYMDRNGRPLVGIAITGVFGLLG 421

Query: 439 FVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVW 498
           F+ AS  + TVFTWL A+  +S   TWF I    +RFR +M  Q RS D++ Y S  G++
Sbjct: 422 FLVASKDQSTVFTWLFALCSISFFTTWFCICFCQIRFRMAMKAQKRSADDIVYISPLGIY 481

Query: 499 GAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDW-R 557
           G             G+ +V+  PVG     A NFF+  +++PI+I +YLG++++ +DW  
Sbjct: 482 GGVLGCVLNVLLVAGEIYVSAFPVGQPS-SAENFFQYCMSIPIMIVVYLGHRIYRKDWSH 540

Query: 558 VIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
             I A ++D  S   + + + ++  + ++K  +    +  +   F+C
Sbjct: 541 WYIKAKDIDRDSGYTLAELDNIKMRKEKDKAHIASRPFYYKVYRFFC 587

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  266 bits (680), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 180/570 (31%), Positives = 277/570 (48%), Gaps = 20/570 (3%)

Query: 40  LFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMI 99
           L  RF +SFKR +        ++S    +S E+  +    +    K L Q    RH+ MI
Sbjct: 29  LVRRFKNSFKRKDASVIQEGLLYS---ELSEEEKVQWDLANQPYKKVLDQ----RHLTMI 81

Query: 100 SLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNA 159
           ++   +GTG+ +G G+SL +G PASLLIG+ +V   + CV+Q  +EL+  Y  +SG +  
Sbjct: 82  AIGGTLGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAELSCQY-PVSGSYAL 139

Query: 160 YPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXX 219
           + +  +D +  FSV   Y L WL   P ELV  S+T+ YW  S+NP              
Sbjct: 140 HASRFIDPSAGFSVGINYLLMWLISFPSELVGCSLTMTYWAPSVNPAVWVAIAFTLSMLL 199

Query: 220 XXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAG-NDGYLGSVYWHDPGAFRGNN 278
                          +  K++           +  GG   + GY+G+ YW+DPG+F    
Sbjct: 200 NLFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPESTGYIGTKYWYDPGSF---- 255

Query: 279 GINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAAL 338
               FK      V+AA+++ G E  VLT+AE ++   S+  A+K   +RI   Y++T  +
Sbjct: 256 APPAFKNFCNTFVSAAYSFSGTEMVVLTSAEARD-VSSVSRAAKGTFWRIAVFYIVTVII 314

Query: 339 LGFLVPYNSPELL-GSGSAATHASPFVIAIASHGV--KVVPHXXXXXXXXXXXXXXXXXX 395
           +G LVPYN P L+ GS S    ASPFVIA+++ G     V                    
Sbjct: 315 IGCLVPYNDPRLINGSSSEDITASPFVIALSNTGAMGTRVSQFMNAVILIAVFSVCNSCV 374

Query: 396 XXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLA 455
                        G  PK+  Y+DR GRP+  + +   FGLL F+  S  + TVFTWL A
Sbjct: 375 YASSRLIQGLATAGQLPKICGYMDRNGRPLVGMAICGAFGLLGFLVVSKDQGTVFTWLFA 434

Query: 456 ISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQF 515
           +  +S   TWF I    +RFR +M  QG+  D++ Y+S  G++G             G+ 
Sbjct: 435 LCSISFFTTWFCICFCQIRFRMAMKAQGKPDDDIIYKSPLGIYGGVVGCTLNVLLVIGEI 494

Query: 516 WVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRV-IIPANEVDLVSHRKIF 574
           +V+ +PVG     A NFFE  +++PI+I +Y+G++++ RDWR   I   ++DL S   + 
Sbjct: 495 YVSAAPVGMPS-SAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKREDIDLDSGHSLE 553

Query: 575 DAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           D E  +  + +EKE +       R   F+C
Sbjct: 554 DLEATKLRRDQEKEYVASRPLYYRLYRFFC 583

>Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar to
           Ashbya gossypii AER405C
          Length = 587

 Score =  256 bits (653), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 176/589 (29%), Positives = 286/589 (48%), Gaps = 34/589 (5%)

Query: 27  KETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSK--- 83
           +E      G     F +F+ SF+R              HE +  ED +    +D  +   
Sbjct: 22  QEYDSEKGGKAGKRFDKFIGSFQR--------------HEAIIPEDVDLSLLNDYERSNF 67

Query: 84  ---HKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140
              H+  ++ +  RH+ MIS+   +GTG+ +G G SL +G  A LL    +  + ++CVI
Sbjct: 68  ILAHQPYQKTLSQRHLTMISIGGTLGTGLFIGIGSSLASGPGALLLGFLLVGLS-IFCVI 126

Query: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN 200
           Q+A+EL+  Y  +SG F+ + +  ++ +  F VS  Y L WL   P ELV  ++TI YWN
Sbjct: 127 QAAAELSCQY-PVSGSFSTHVSRFIEPSVGFMVSTSYALSWLISFPSELVGLTLTIGYWN 185

Query: 201 DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND 260
           +S++P                             +  K++           V CGG  N+
Sbjct: 186 NSVSPGIWVAIFYLLIMAMNLFSVRGFAETEYWLSIIKIIAITIFIIIGIVVICGGGPNN 245

Query: 261 --GYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIR 318
             GYLG+ YWHDPGAF+       F G+    V+AAF++GGAE  +LTA E +  + SI 
Sbjct: 246 QAGYLGTKYWHDPGAFKKP----YFSGICNTFVSAAFSFGGAELVLLTANESRKVE-SIS 300

Query: 319 SASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGV--KVVP 376
            A+K   +RI   Y+ T A++  LVPY++  LLG+G    + SPFVI++A+ G   K V 
Sbjct: 301 RAAKGTFWRIAIFYISTVAVISCLVPYDNETLLGNGEGVAN-SPFVISLANTGQFGKNVS 359

Query: 377 HXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGL 436
           H                               G  P +  Y+D++GRP+  + +  VFGL
Sbjct: 360 HFMNAIILAAVLSVCNSSVYAASRVIQALGACGQLPSVCGYIDKKGRPLVGIAICGVFGL 419

Query: 437 LCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTG 496
           L F+        VF WL A+  ++   TW+SI LS +RFRR++ VQG   +E+ Y+S  G
Sbjct: 420 LAFLVEYDNVTEVFNWLFALCSIAAFVTWWSICLSQLRFRRALKVQGLGKEEIAYESMMG 479

Query: 497 VWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDW 556
           +W              G+ +VAI     ++  A  FF+  +++P++I +Y  ++++ ++W
Sbjct: 480 IWSGVVGIVLNTMLICGEIYVAIHA-SIDEHSAKTFFQYCMSIPVMITVYAAHRIYNKNW 538

Query: 557 RV-IIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
               + A ++DL + +K  D E+M+ E +  + ++  +    R   FWC
Sbjct: 539 HTWFVRAKDIDLSTGKKAEDIELMKHEIMVSRAKIAASPLYYRIYRFWC 587

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  252 bits (644), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 173/561 (30%), Positives = 262/561 (46%), Gaps = 31/561 (5%)

Query: 60  GIHSTHERVSGEDFERLAPDDSS---KHK--TLKQNIKPRHVLMISLATGIGTGMLVGNG 114
           GI S H    G D + +    S    KH    LK+ ++ RHV MI++   +GTG+L+G G
Sbjct: 51  GITSGH----GSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTG 106

Query: 115 KSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVS 174
            SL   GPA++LI YA V  +++ V+    E+A  Y  L G F +Y     D A  F+V 
Sbjct: 107 SSLALAGPAAILIAYAFVGLLVFFVMSCLGEMAA-YIPLDG-FTSYSTRYADPALGFAVG 164

Query: 175 WVYCLQWLCILPLELVTASMTIKYW--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXX 232
           + Y  ++  I+P +L   ++ I+YW   D +NP                           
Sbjct: 165 YAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEY 224

Query: 233 XXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFR-------GNNGINRFKG 285
             +  K+ +          + CGG  N   LG  YW +PGAF+       G  G  RF  
Sbjct: 225 YISAVKITVMLGLIILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKG--RFVS 282

Query: 286 LVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPY 345
             +V V A FAY G E   +  +E +NP+K++  A K  +YRII  YL++  LLG  VP+
Sbjct: 283 FASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPF 342

Query: 346 NSPELLGSGSAAT--HASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXX 403
           N P L+ + SA T   ASPFV+AI + G+ V+PH                          
Sbjct: 343 NDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLY 402

Query: 404 XXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELF 463
                  AP++F   +++G P   LLV  +F LL ++  S     VFT+ +    +  L 
Sbjct: 403 GLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLL 462

Query: 464 TWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVG 523
           +W SI ++++RF ++  VQG     L YQS    +GA+++          + + A     
Sbjct: 463 SWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL--- 519

Query: 524 SNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
            +  D  +F   Y+ +P  I  Y+GYKLWY+    IIP+ EVDLVS ++  D E  + + 
Sbjct: 520 GDTFDYKSFITGYIGIPTYIISYIGYKLWYK--TKIIPSEEVDLVSFKEAVDLEEEEGKM 577

Query: 584 LEEKEQLRHASWTKRAAEFWC 604
           L+E+     A+  K     WC
Sbjct: 578 LDEERAAHLAAHGKDLK--WC 596

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  247 bits (631), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 155/542 (28%), Positives = 248/542 (45%), Gaps = 13/542 (2%)

Query: 47  SFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIG 106
           S  +  E     DG H   +    ED   +    S K   +K+ +KPRH+ MI+L   IG
Sbjct: 2   SLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIG 61

Query: 107 TGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVD 166
           TG+ +     L N GP   LI Y  + T+ Y V QS  E+A  +  ++  F  +    + 
Sbjct: 62  TGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMAT-FIPVTSSFTVFTQRFLS 120

Query: 167 KAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXX 226
            A   +  ++Y L W     LEL      I++W D++   A                   
Sbjct: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180

Query: 227 XXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRG---NNGIN-- 281
                      KVL           + CG AG  G +G  YW +PG +     +  +N  
Sbjct: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEG 239

Query: 282 RFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGF 341
           RF G V+ L++AAF Y G E   +TA E  NP+K++  A  K+ +RI+  Y+++   +G 
Sbjct: 240 RFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGL 299

Query: 342 LVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXX 401
           LVP+N P+L  S  +   +SPFVIAI + G KV+PH                        
Sbjct: 300 LVPFNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRI 358

Query: 402 XXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSE 461
                  G APK   +  + G P   +L + V G L ++ +S     VF WLL I+ ++ 
Sbjct: 359 AYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAG 418

Query: 462 LFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISP 521
            FTW  IS+SH+RF +++  QG S D+L +++    WGAYYA          Q + A +P
Sbjct: 419 FFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAP 478

Query: 522 VGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQS 581
               K   ++FF  Y+++ +    ++G+++W+R   + I   ++DL + R+  D  + + 
Sbjct: 479 ----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEE 533

Query: 582 EQ 583
           ++
Sbjct: 534 QK 535

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  246 bits (627), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 169/598 (28%), Positives = 279/598 (46%), Gaps = 19/598 (3%)

Query: 5   EMKNIKSPEDGVVESFDS-VEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHS 63
           E+ NI   + G+  S D  ++ V +T+    G+ D +     D +++ + +    D I S
Sbjct: 16  EIDNIAVQQKGLDSSQDGGIKFVDQTNYNIYGNLDNMGDYSKDYYEKSQYQQQNLD-IES 74

Query: 64  THERVSGEDFERLAPDDSSKHKT-LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGP 122
               +S           S KH   LK+N++ RHV MI++   +GTG+L+G G SL   GP
Sbjct: 75  NISSLSSTTSITSTGGSSPKHTDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGP 134

Query: 123 ASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWL 182
           AS+ I Y+ V  +++  + +  E+A  Y  + G F +Y +  VD A  F+V + Y  ++L
Sbjct: 135 ASMFIAYSFVGILVFFTMAAIGEMAS-YIPMDG-FTSYASRYVDPALGFAVGYCYLFKYL 192

Query: 183 CILPLELVTASMTIKYW--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVL 240
            + P +L  AS+ I+YW   D++NP                             ++ KVL
Sbjct: 193 ILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVL 252

Query: 241 MXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRG-----NNGINRFKGLVAVLVNAAF 295
           +          +  GG  +   LG  YW  PGAF+      +  + +F   V+V V A F
Sbjct: 253 VMLGLILLMFILMLGGGPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALF 312

Query: 296 AYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGS 355
           AY G E + + AAE  NP+KS+  A K  V+RI+  YL+T  LLG  V YN P LL +  
Sbjct: 313 AYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKG 372

Query: 356 AATH--ASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPK 413
           A T   ASPFV+AI + G++V+PH                               G AP 
Sbjct: 373 AGTSAAASPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPA 432

Query: 414 LFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHV 473
           +F      G P   L V  +F LL ++  S     VF + + +  +  L +W  I ++++
Sbjct: 433 IFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYI 492

Query: 474 RFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFF 533
            F R++ VQG    +  Y +    +G Y++           F    +    +  D  NF 
Sbjct: 493 GFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIA---FIKNFTVFLGHSFDYKNFI 549

Query: 534 ENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLR 591
             Y+ +P+ +  Y GYK   +    I+ ++EVDL + +++FD + ++ + L++++Q+R
Sbjct: 550 TGYIGLPVFVIFYFGYKFIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  239 bits (610), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 153/507 (30%), Positives = 237/507 (46%), Gaps = 17/507 (3%)

Query: 71  EDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYA 130
           ED E     D+   + LKQ    RH+ MI+L   IGTG+ VG    L N GP   LI Y 
Sbjct: 55  EDAEEAGYHDTRVKRALKQ----RHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYL 110

Query: 131 IVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELV 190
            + +++Y + QS  E+A  +  ++     +    +  AF  +  ++Y   W     +E+ 
Sbjct: 111 FMGSIVYFITQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIS 169

Query: 191 TASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXX 250
                I++W  ++   A                            + KV+          
Sbjct: 170 VIGQVIQFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYAL 229

Query: 251 XVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVL 305
            + CGG+ + G +G  YW +PG +       +    RF G V+ L+NAAF Y G E   +
Sbjct: 230 VIVCGGS-SQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGI 288

Query: 306 TAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVI 365
           TA E  NP+KS+  A  K+V+RI+  Y+M+   +G LVP+N P L  S  A   +SPFVI
Sbjct: 289 TAGEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL-ASNVAVIASSPFVI 347

Query: 366 AIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPV 425
           +I + G +V+PH                             + G APK F YV R G P 
Sbjct: 348 SIQNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPY 407

Query: 426 RCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRS 485
             ++ + + GLL F+  +    T F WL+ IS L+ L  W  ISLSH+RF +++  +G S
Sbjct: 408 LGVIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGIS 467

Query: 486 LDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGL 545
            D+L +++    WGAYYA          Q + A SP    K D + FF  Y+++ IL+ L
Sbjct: 468 RDDLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAFSP----KFDVSGFFTAYISLIILVVL 523

Query: 546 YLGYKLWYRDWRVIIPANEVDLVSHRK 572
            +G +L+YR  R +    ++D+ + R+
Sbjct: 524 LIGCQLYYRC-RFLWKLEDIDIDTDRR 549

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  240 bits (612), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 167/592 (28%), Positives = 272/592 (45%), Gaps = 42/592 (7%)

Query: 30  SPRSEGS----RDGLFHR-FVDSFKRPEEEY-------NGGDGIHSTHERVSGEDFERLA 77
           SPR+  S    RD  + +   DSF   E+E        N      ST    S  D     
Sbjct: 12  SPRNSSSLDSDRDAYYSKQNPDSFPVKEQEIYNIDLEENNVSSRSSTFTSPSARDDSFAV 71

Query: 78  PDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLY 137
           PD   +   L++++K RH+ MI++   +GTG+L+G G +L  GGP ++LI YA V  +++
Sbjct: 72  PDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVF 131

Query: 138 CVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIK 197
             +    E+A  Y  L G F +Y +  VD A  F++ + Y  ++  + P +L  A++ I+
Sbjct: 132 FTMACLGEMAS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 189

Query: 198 YW--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCG 255
           YW   D +NP                             ++ KVL+          +  G
Sbjct: 190 YWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLG 249

Query: 256 GAGNDGYLGSVYWHDPGAFRG-----NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQ 310
           G  +   LG  YW DPGAF+        G  +F   +AV V + F+Y G E + +  +E 
Sbjct: 250 GGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEA 309

Query: 311 QNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAA--THASPFVIAIA 368
           QNP+KS+  A K  VYRII  YL T  LLG  V YN P L+ +   A    ASPFV+AI 
Sbjct: 310 QNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQ 369

Query: 369 SHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCL 428
           + G+KV+PH                               G APK+F+  ++ G P   L
Sbjct: 370 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNAL 429

Query: 429 LVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDE 488
           + S +F  L ++  S     +F + + +  +  + +W +I + ++ F ++   QG    +
Sbjct: 430 IFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 489

Query: 489 LGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGS------NKLDANNFFENYLAMPIL 542
             Y +    +GAY+A           F + I+ + +      +K D   F   Y+ +P+ 
Sbjct: 490 FAYVAPGQRYGAYFALV---------FCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVY 540

Query: 543 IGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQS--EQLEEKEQLRH 592
           +  ++GYKL Y+    +I + +VDL + ++I+D E  Q   E  E++E+L+ 
Sbjct: 541 VFSWVGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEQGKIEDQEKEERLKK 590

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  237 bits (604), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 153/556 (27%), Positives = 257/556 (46%), Gaps = 20/556 (3%)

Query: 53  EEYNGGDGIHSTHERVS----GEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTG 108
           ++++  +   ++ E VS     +D   L    S K   +K+ +KPRH+ MI+L   IGTG
Sbjct: 4   QQHHSSEKEKNSEELVSEFSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTG 63

Query: 109 MLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKA 168
           + +     L N GP   LI Y  + T+ Y V QS  E+A  +  ++  F  +    +  A
Sbjct: 64  LFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMAT-FIPVTSSFMVFTQRFLSPA 122

Query: 169 FAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXX 228
              +  ++Y L W     LEL      I++W D++   A                     
Sbjct: 123 LGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYG 182

Query: 229 XXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRG---NNGIN--RF 283
                    KVL           + CG AG  G +G  YW +PG +     +  +N  RF
Sbjct: 183 EVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRF 241

Query: 284 KGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLV 343
            G V+ L++AAF Y G E   +TA E  NP+K++  A  K+ +RI+  Y+++   +G LV
Sbjct: 242 LGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLV 301

Query: 344 PYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXX 403
           P+N P+L  S  +   +SPFVIAI + G KV+PH                          
Sbjct: 302 PFNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLY 360

Query: 404 XXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELF 463
                G APK   +  + G P   +L + + G L ++ +S     VF WLL I+ ++  F
Sbjct: 361 SMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFF 420

Query: 464 TWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVG 523
            W  IS++H+RF +++  QG S D+L +++    WGAYYA          Q + A +P  
Sbjct: 421 AWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAP-- 478

Query: 524 SNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
             K + ++FF  Y+++ +   +++G+++W+R   +     ++DL + R+  D ++ +   
Sbjct: 479 --KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEE-- 533

Query: 584 LEEKEQLRHASWTKRA 599
            +E + L    W+  A
Sbjct: 534 -DEPKNLWEKFWSAVA 548

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  237 bits (604), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 161/522 (30%), Positives = 245/522 (46%), Gaps = 17/522 (3%)

Query: 84  HKT-LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
           H T +K+ +K RH+ MI+L   IGTG+ VG    L N GP   LI Y  + T++Y V QS
Sbjct: 87  HDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQS 146

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
             E+A  +  ++     +    +  AF  +  ++Y   W     +E+      I+YW   
Sbjct: 147 LGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           +   A                            + KV+           + CGG+ + G 
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQGP 264

Query: 263 LGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317
           +G  YW +PGA        + G  RF G V+ L+NAAF Y G E   +TA E  NP+KS+
Sbjct: 265 IGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 324

Query: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377
             A  K+V+RI+  Y+M+   +G LVPYN P L  S SA   +SPFVI+I + G KV+P 
Sbjct: 325 PRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSAS-SAVIASSPFVISIQNAGTKVLPD 383

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437
                                        + G APK F YV R G P   ++ + + GLL
Sbjct: 384 IFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLL 443

Query: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497
            F+  +    T F WL+ IS L+ L  W  ISL+H+RF +++  +G S D+L +++    
Sbjct: 444 AFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMP 503

Query: 498 WGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWR 557
           WGAYYA          Q + A +P    K D + FF  Y+++ +L+ L+ G +L+YR  R
Sbjct: 504 WGAYYASFFVTVIIFIQGFQAFAP----KFDVSEFFTAYISLILLVVLFAGCQLYYRC-R 558

Query: 558 VIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRA 599
            +    ++D+ S R+  DA + +    +E + L    W   A
Sbjct: 559 FLWKLEDIDIDSDRREIDAIVWED---DEPQNLWEKFWAAVA 597

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  236 bits (602), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 151/560 (26%), Positives = 255/560 (45%), Gaps = 19/560 (3%)

Query: 49  KRPEEEYNGGDGIHSTHERV---SGEDFERLAPDDSSKHKT-LKQNIKPRHVLMISLATG 104
           +R  ++  G +G     E +   SG++F      +   H+T +K+ +K RH+ MI+L   
Sbjct: 18  ERYSKKAKGNNGSEIALESITPDSGDEFPEEHEQEGDYHETEVKRALKARHISMIALGGT 77

Query: 105 IGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALL 164
           IGTG+ +     L   GP   LI Y  + T++Y + QS  E+A  +  ++     +    
Sbjct: 78  IGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQSLGEMAT-FIPVTSSVTVFSKRF 136

Query: 165 VDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXX 224
           +  AF  +  ++Y   W     +EL      I YW   +   A                 
Sbjct: 137 LSPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTSVVPLGAWITIFWIIVTLLNFFPV 196

Query: 225 XXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPG-----AFRGNNG 279
                      + KV+           V CGG+ + G +G   W +PG         N  
Sbjct: 197 RFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS-SQGPIGFRNWRNPGPWGTGVISSNQT 255

Query: 280 INRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALL 339
             RF G V+ L+ AAF Y G E   +TA E +NP+K++  A  K+ +RI+  Y+++   +
Sbjct: 256 EARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFV 315

Query: 340 GFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXX 399
           G LVPYN P +  +     +ASPFVI+I + G K++P                       
Sbjct: 316 GLLVPYNDPRMDNTSDTDVNASPFVISIRNAGTKILPDIFNAVVLVTVVSAANSNVYIGS 375

Query: 400 XXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGL 459
                  + G APK F YV+R G PV  ++V+ + GL+ F+  +   +  F WL+ IS L
Sbjct: 376 RVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNISTL 435

Query: 460 SELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAI 519
           + L  W  ISL+H+RF + +  +G S D L +++    W AYYA          Q + A 
Sbjct: 436 AGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWAAYYAASFVFVIIFIQGYTAF 495

Query: 520 SPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIM 579
           SP    K D   FF  Y+++ +++ +++G +++Y+  R +    ++D+ ++R+  DA + 
Sbjct: 496 SP----KFDVTQFFTAYISLMLMLVVFIGCQIYYKC-RFLWKLEDIDIDTNRREIDAIVW 550

Query: 580 QSEQLEEKEQLRHASWTKRA 599
           +    +E + L    W+  A
Sbjct: 551 ED---DEPKNLWDKFWSTIA 567

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  236 bits (603), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 249/534 (46%), Gaps = 15/534 (2%)

Query: 56  NGGDGIHSTHERVSGEDFERLAPDDSSKHKT-LKQNIKPRHVLMISLATGIGTGMLVGNG 114
           + G  +H  H   S  D E    +++    T +K+ +K RH+ MI+L   IGTG+ VG  
Sbjct: 73  HSGSNLHQ-HGTTSLHDDEESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIA 131

Query: 115 KSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVS 174
             L N GP   LI Y  + +++Y V QS  E+A  +  ++     +    +  AF  +  
Sbjct: 132 TPLSNAGPVGSLIAYIFMGSVVYFVTQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVANG 190

Query: 175 WVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXX 234
           ++Y   W     +E+      I+YW  ++   A                           
Sbjct: 191 YMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWI 250

Query: 235 NTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAV 289
            + KVL           + CGG+ + G +G  YW +PG +         G  RF G V+ 
Sbjct: 251 ASIKVLAIMGYLIYALIIVCGGS-HQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSS 309

Query: 290 LVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPE 349
           L+NAAF Y G E   +TA E  NP+KS+  A  K+V+RI   Y+M+   +G LVP+N  +
Sbjct: 310 LINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFND-D 368

Query: 350 LLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQG 409
            L + SA   +SPFVI+I + G + +P                                G
Sbjct: 369 RLANDSAVIASSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTG 428

Query: 410 FAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSIS 469
            APK+F+YV + G P   ++ +   GLL F+  +    T F WL+ IS L+ L  W  IS
Sbjct: 429 NAPKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFIS 488

Query: 470 LSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDA 529
           LSH+RF +++  +G S D+L +++    WGAYYA          Q + A +P    K D 
Sbjct: 489 LSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFTP----KFDV 544

Query: 530 NNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
           + FF +Y+++ +L  L+ G +L+YR  R I    ++D+ S R+  +A I + ++
Sbjct: 545 STFFTSYISLILLAVLFSGCQLYYRC-RFIWKVEDIDIDSDRREIEAIIWEEDE 597

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  236 bits (601), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 167/607 (27%), Positives = 275/607 (45%), Gaps = 40/607 (6%)

Query: 24  EVVKETSPRSEGSRDGLFHRFV-----DSFKRPEEEY-------NGGDGIHSTHERVSGE 71
           ++   TSPR+  S D     +      D+F   E+E        N      ST    S  
Sbjct: 7   KMFTSTSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVSSRSSTSTSPSAR 66

Query: 72  DFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAI 131
           D     PD   ++  L++++K RH+ MI++   +GTG+L+G G +L  GGP ++LI YA 
Sbjct: 67  DDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAF 126

Query: 132 VSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVT 191
           V  +++  +    E+A  Y  L G F +Y +  VD A  F++ + Y  ++  + P +L  
Sbjct: 127 VGLLVFYTMACLGEMAS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTA 184

Query: 192 ASMTIKYW--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXX 249
           A++ I+YW   D +NP                             ++ KV++        
Sbjct: 185 AALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLL 244

Query: 250 XXVNCGGAGNDGYLGSVYWHDPGAFRG-----NNGINRFKGLVAVLVNAAFAYGGAEFSV 304
             +  GG  N   LG  YW DPGAF+        G  +F   VAV V + F+Y G E + 
Sbjct: 245 FIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTG 304

Query: 305 LTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGS--GSAATHASP 362
           +  +E +NP+KS+  A K  VYRII  YL T  LLG  V YN P LL +   S +  ASP
Sbjct: 305 IVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASP 364

Query: 363 FVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRG 422
           FV+AI + G++V+PH                               G APK+F    R G
Sbjct: 365 FVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWG 424

Query: 423 RPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQ 482
            P   L++S +F  L ++  S     +F + + +  +  + +W +I + ++ F ++   Q
Sbjct: 425 VPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 484

Query: 483 GRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGS------NKLDANNFFENY 536
           G    +  Y +    +GAY+A           F + I+ + +      +K D   F   Y
Sbjct: 485 GIDKSKFAYVAPGQRYGAYFALF---------FCILIALIKNFTVFLGHKFDYKTFITGY 535

Query: 537 LAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWT 596
           + +P+ I  + GYKL Y+    +I + +VDL + ++I+D E  +    +++++ R  S  
Sbjct: 536 IGLPVYIISWAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593

Query: 597 KRAAEFW 603
           K    F+
Sbjct: 594 KNMEWFY 600

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  234 bits (598), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 161/588 (27%), Positives = 269/588 (45%), Gaps = 29/588 (4%)

Query: 13  EDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGED 72
           E+  +E++ + +   + S  S  S D L HR        +E  N  +GI    E +S  +
Sbjct: 3   ENVELETYPAGKQHNDRSAESSESSDVLHHR--------KETKN--EGIFINQENMS--E 50

Query: 73  FERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIV 132
            E L  +D      +K+++KPRH+ MISL   IGTG+ +G    +   GP   L+ Y  +
Sbjct: 51  VESLYGNDDPD---VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFM 107

Query: 133 STMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTA 192
            T+ +CV QS  E+A  +  ++  F  Y    +  A   +  ++Y   W     LEL   
Sbjct: 108 GTIAFCVTQSLGEMAT-FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSII 166

Query: 193 SMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXV 252
              I+YW  ++                                  KVL           +
Sbjct: 167 GQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVM 226

Query: 253 NCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTA 307
            CGG+ ++G LG  YW +PG +       N    RF G V+ L+ AAF Y G E   +TA
Sbjct: 227 VCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITA 285

Query: 308 AEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAI 367
            E +NP+K++  A  K+ +RI+  Y+++   +G LVPY  P L  +  +  + SPFV+AI
Sbjct: 286 GESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAI 345

Query: 368 ASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRC 427
            + G KV+P                              + G AP LF   +++G P   
Sbjct: 346 QNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYA 405

Query: 428 LLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLD 487
           +L S +FG L ++  S   + VF WLL I+ ++  F W  ISLSH+RF + +  +G S +
Sbjct: 406 VLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRN 465

Query: 488 ELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYL 547
           +L +++    WGAYYA          Q + + +P    +   + F  +Y+++ + I  +L
Sbjct: 466 DLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWL 521

Query: 548 GYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASW 595
           G+++ ++  R+I+   +VD+ + R+  DA +   +  +E + L    W
Sbjct: 522 GFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDD--DEPKTLLQKLW 566

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  232 bits (591), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 158/557 (28%), Positives = 256/557 (45%), Gaps = 21/557 (3%)

Query: 42  HRFVDSFKRPEEEYNGGDGIHSTHERVSGEDF----ERLAPDDSS--KHKTLKQNIKPRH 95
           HR   S    +E+      +HS   RV GED     + +  +D    ++  +K+ +K RH
Sbjct: 33  HRRRGSLPLKDEKNKELYPLHSFSTRVDGEDTFSMGDVIRDEDQGEVRNAEVKRELKQRH 92

Query: 96  VLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSG 155
           + MI+L   IGTG+ +G  K L N GP   LI Y  + ++ Y V QS  E+A  +  ++ 
Sbjct: 93  IGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTS 151

Query: 156 GFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXX 215
            F  +    +  AF  +  ++Y   W     LEL      I++W + +   A        
Sbjct: 152 SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNKVPLAAWISIFWVI 211

Query: 216 XXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF- 274
                               + KVL           + CG AG  G +G  YW +PGA+ 
Sbjct: 212 ITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWG 270

Query: 275 ----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIG 330
                 +    RF G V+ L+NAAF + G E   +TA E  NP+K++  A KK+V+RI+ 
Sbjct: 271 PGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILT 330

Query: 331 IYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXX 390
            Y+ +   +G LVPYN P+L  + ++    SPF+IAI + G KV+PH             
Sbjct: 331 FYIGSLLFIGLLVPYNDPKLT-TATSYVSVSPFIIAIENSGTKVLPHIFNAVILTTIISA 389

Query: 391 XXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVF 450
                           +   APK  +   + G P   + ++ VFG L ++  S   + VF
Sbjct: 390 ANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMETSTGGDKVF 449

Query: 451 TWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXX 510
            WLL I+G++  F W  IS+SH+RF +++  +G S DEL +++      AY+A       
Sbjct: 450 EWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFAATFMIII 509

Query: 511 XXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSH 570
              Q + A +P    K D  +F   Y+++ + + +++ +++ +R  R I    +VD+ S 
Sbjct: 510 ILIQGFTAFAP----KFDGIDFLAAYISIFLFLAIWILFEIIFRC-RFIWKIEDVDIDSD 564

Query: 571 RKIFDAEIMQSEQLEEK 587
           R+  D E +  E  E K
Sbjct: 565 RR--DIEAIVWEDHEPK 579

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  232 bits (592), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 148/508 (29%), Positives = 240/508 (47%), Gaps = 18/508 (3%)

Query: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
           +   +K+ +K RH+ MI+L   IGTG+ VG    L N GP   LI Y  + +++Y + QS
Sbjct: 90  QDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQS 149

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
             E+A  +  ++     +    +  AF  +  ++Y   W     +E+      I+YW D+
Sbjct: 150 LGEMAT-FIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWTDA 208

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           +   A                            + KVL           + CGG+ + G 
Sbjct: 209 VPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGS-SQGP 267

Query: 263 LGSVYWHDPGAF-------RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 315
           +G  YW +PG +         N G  RF G V+ L+NAAF Y G E   +TA E  NP+K
Sbjct: 268 IGFRYWRNPGPWGPGIISKDVNEG--RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 325

Query: 316 SIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVV 375
           S+  A  K+V+RI   Y+M+   +G LVPYN    L SG +   +SPFVI+I + G   +
Sbjct: 326 SVPRAINKVVFRIALFYIMSLFFIGLLVPYND-HTLSSGDSYIASSPFVISIQNAGTYAL 384

Query: 376 PHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFG 435
           P                              + G APK F YV + G P   ++V+   G
Sbjct: 385 PDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLG 444

Query: 436 LLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWT 495
           LL F+  +    T F WL+ IS L+ L  WF I+LSH+RF +++  +G S D+L +++  
Sbjct: 445 LLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKL 504

Query: 496 GVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRD 555
             WGAYY+          Q + A +P      D   FF +Y+++ +L+ +++G +L+YR 
Sbjct: 505 MPWGAYYSAFFVFVIIFIQGFEAFTP-----WDTTTFFTSYISLILLVVVFIGCQLYYRC 559

Query: 556 WRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
            R ++   ++D+ + R+  +A I + ++
Sbjct: 560 -RFLLKVEDIDIDTDRREIEAIIWEDDE 586

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  232 bits (591), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 163/592 (27%), Positives = 263/592 (44%), Gaps = 34/592 (5%)

Query: 7   KNIKSPE--DGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHST 64
           +N  S E  D    S+D+ E+++    +   S+D    +     K P  E       +S 
Sbjct: 12  RNEDSTESNDDSTTSYDNFEIIE---IQHNDSKDNSIKK-----KIPNSELASLTHAYS- 62

Query: 65  HERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPAS 124
             RV  E  E  A +   + K +K+ +K RH+ MI+L   IGTG+ VG    L + GP  
Sbjct: 63  RSRVEPEHDED-AEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVG 121

Query: 125 LLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCI 184
            LI Y  + +++Y V Q+  E+A  +  ++     +    +  AF  +  ++Y   W   
Sbjct: 122 ALIAYIFMGSIVYFVTQALGEMAT-FIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAIT 180

Query: 185 LPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXX 244
             +E+      I+YW D++   A                              KV+    
Sbjct: 181 FAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVG 240

Query: 245 XXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRGNNGIN-------------RFKGLVAVLV 291
                  + CGG+   G +G  YW +PGA+   NG+              RF G VA L+
Sbjct: 241 YLLYALIIVCGGSKKQGPIGFRYWRNPGAW--GNGLTSDGEPIYSSKYEGRFLGWVASLI 298

Query: 292 NAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL 351
           NAAF Y G E   +TA E  NP+K++  A  K+V+RI+  Y+M+   +G LVP+    L 
Sbjct: 299 NAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL- 357

Query: 352 GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFA 411
              +    +SPFVI+I + G K++P                                  A
Sbjct: 358 SDDTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVA 417

Query: 412 PKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLS 471
           PK+F  V R+G P   ++ + + GLL F+       T F WL+ IS L+ L  W  ISL+
Sbjct: 418 PKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLA 477

Query: 472 HVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANN 531
           HVRF + +  +G S D+L +++    WG+YYA          Q + A SP      D   
Sbjct: 478 HVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSP----HFDVTT 533

Query: 532 FFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
           FF +Y+++ +L  +++G +L+YR  R +    +VD+ S R+  +  I + ++
Sbjct: 534 FFTDYISLILLAVVFIGAQLYYR-CRFLWKLEDVDIDSDRREIEDAIWEDDE 584

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  231 bits (588), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 145/510 (28%), Positives = 243/510 (47%), Gaps = 17/510 (3%)

Query: 81  SSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140
           SS+ + +++ +KPRHV MI+L   IGTG+ VG    L + GP   LI Y  + ++ + V 
Sbjct: 43  SSQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVT 102

Query: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN 200
           QS  E+A  +  ++  F  +    +  A   +  ++YC  W     LEL      I+YW 
Sbjct: 103 QSLGEMA-TFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWT 161

Query: 201 DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND 260
             +   A                              KV+           + C GAG  
Sbjct: 162 LGVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVC-GAGKT 220

Query: 261 GYLGSVYWHDPGAFRGNNGI-------NRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNP 313
           G +G  YW +PG +   +GI        RF G V+ LVNAAF Y G E   ++A E  NP
Sbjct: 221 GPVGFRYWRNPGPW--GDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANP 278

Query: 314 QKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVK 373
           +K++  A +K+  RI+  Y+ +   +G LVP+N P+ L S +  + +SPF+IAI + G +
Sbjct: 279 RKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPK-LDSTANYSASSPFIIAIQNSGTR 337

Query: 374 VVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCV 433
            +P                              ++G APK+   ++R G P  C+ +  +
Sbjct: 338 ALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSL 397

Query: 434 FGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQS 493
           FG L +++ S      F WLL I+ ++  F W  ISL H+RF +++  QG S D+L +++
Sbjct: 398 FGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKA 457

Query: 494 WTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWY 553
               WGAYYA          Q + A +P    K + +NFF  Y+++ + I +++ +++ +
Sbjct: 458 KLMPWGAYYAAFFILLIIIIQGFTAFAP----KFNVSNFFAAYVSVFLFIAVWVIFQVIF 513

Query: 554 RDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
           +  R+I    +VD+ S R+  +AE+ + ++
Sbjct: 514 KS-RLIHKVEDVDIDSDRREIEAEVWEDDE 542

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  232 bits (591), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 150/504 (29%), Positives = 237/504 (47%), Gaps = 14/504 (2%)

Query: 85  KTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSAS 144
           K +K+ +K RH+ MI+L   IGTG+ VG    L N GP   LI Y  + T++Y + QS  
Sbjct: 104 KHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLG 163

Query: 145 ELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSIN 204
           E+A  +  ++     +    +  AF  S  ++Y   W     +E+      I+YW D + 
Sbjct: 164 EMAT-FIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVP 222

Query: 205 PDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLG 264
             A                            + KVL           + CGG+ + G +G
Sbjct: 223 LAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIG 281

Query: 265 SVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 319
             YW +PGA+       N    RF G V+ L+NAAF Y G E   +TA E  NP+K++  
Sbjct: 282 FRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 320 ASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXX 379
           A  K+V+RI+  Y+M+   +G LVPYN P L  S SA   +SPFVI+I + G   +P   
Sbjct: 342 AINKVVFRIVIFYIMSLFFIGLLVPYNEPRLSPS-SAVIASSPFVISIQNAGTYALPDIF 400

Query: 380 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCF 439
                                      + G APK F YV ++G P   +L +   GLL F
Sbjct: 401 NAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAF 460

Query: 440 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWG 499
           +  +    T F WL++IS L+ L  W  ISL+H+RF +++  +G S D+L +++    +G
Sbjct: 461 LVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYG 520

Query: 500 AYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVI 559
           AYYA          Q + A  P        + FF +Y+++ +L  +++  +L+Y+  R I
Sbjct: 521 AYYASFFVTIIIFIQGFQAFCP-----FSVSEFFTSYISLILLAVVFISCQLYYKC-RFI 574

Query: 560 IPANEVDLVSHRKIFDAEIMQSEQ 583
               ++D+ S R+  +A I + ++
Sbjct: 575 WKLEDIDIDSDRREIEAIIWEDDE 598

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  231 bits (590), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 148/527 (28%), Positives = 244/527 (46%), Gaps = 15/527 (2%)

Query: 62  HSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGG 121
           H +  R+S ++++    +   K   +K+ +KPRH+ MI+L   IGTG+ +G    L   G
Sbjct: 79  HPSEARISSDEYDH--QEAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSG 136

Query: 122 PASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQW 181
           P   LI Y  + T++Y V Q+  E+A  +  ++     + +  +  AF  S  ++Y   W
Sbjct: 137 PVGSLIAYIFMGTVVYFVTQALGEMAT-FIPVTSSITVFSSRFLSPAFGVSNGYLYWFNW 195

Query: 182 LCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLM 241
                +E+      I++W   +   A                            + KVL 
Sbjct: 196 AITYAVEISVVGQVIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLA 255

Query: 242 XXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRG-----NNGINRFKGLVAVLVNAAFA 296
                     + CGG+   G +G  YW    A  G     +    RF G VA L+NAAF 
Sbjct: 256 IVGYLIYALVIVCGGS-KQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFT 314

Query: 297 YGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSA 356
           Y G E   +TA E  NP+KS+  A  K+V+RI+  Y+++   +G LVPYN P+ L S ++
Sbjct: 315 YQGTELVGITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPK-LNSATS 373

Query: 357 ATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFN 416
              +SPFVI+I + G + +PH                               G APK+F 
Sbjct: 374 YIASSPFVISIENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFA 433

Query: 417 YVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFR 476
            V  +G P   ++V+ + GLL F+  +      F WL+ IS L+ L  W  IS+SH+RF 
Sbjct: 434 RVTPQGVPFLGVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFM 493

Query: 477 RSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENY 536
            ++  +G S D+L +++    +G+YYA          Q + A SP    K D  +FF  Y
Sbjct: 494 EALKYRGISRDDLPFKARFMPYGSYYACFFITVIIFIQGFTAFSP----KFDVASFFTAY 549

Query: 537 LAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
           +++ +L  L++G +L+YR  R      ++D+ + R+  D  + + ++
Sbjct: 550 ISLILLAVLFIGCQLYYR-CRFFWKVEDIDIDTDRREIDEIVWEDDE 595

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  229 bits (585), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 159/561 (28%), Positives = 253/561 (45%), Gaps = 28/561 (4%)

Query: 29  TSPRSEG-SRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTL 87
           +SP ++G +R   F  +V S     E  NGG G +S+ E   G+           +   +
Sbjct: 9   SSPLTQGKTRSDEFQMYVYS----NETQNGGSGHNSSFEDDEGD----------LQEGQV 54

Query: 88  KQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELA 147
           K+ +KPRHV MI+L   IGTG+ VG    L + GP   LI Y  + +++Y V QS  E+A
Sbjct: 55  KRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMA 114

Query: 148 IIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDA 207
             +  ++     +    +  AF  +  ++Y   W     +E+      I+YW  ++   A
Sbjct: 115 T-FIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAA 173

Query: 208 XXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVY 267
                                       + KV+           + CGG+   G +G  Y
Sbjct: 174 WIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS-KQGPIGFRY 232

Query: 268 WHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 322
           W +PG +      G+    RF G VA L+NA+F Y G E   +TA E  NP+K++  A  
Sbjct: 233 WRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAIN 292

Query: 323 KLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXX 382
           K+ +RI+  Y+++   +G LVPYN P L    ++   +SPFVI+I S G +++P      
Sbjct: 293 KVFFRILFFYILSLFFVGLLVPYNHPGL-DKHTSVIASSPFVISIQSAGTRILPDIFNAV 351

Query: 383 XXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAA 442
                                     G APK F+YV  +G P   ++ + + GLL F+  
Sbjct: 352 VLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVV 411

Query: 443 SPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYY 502
                  F WL+ IS L+ L  W  IS+SH+RF + +  +G S D+L ++S    +GAYY
Sbjct: 412 DDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYY 471

Query: 503 AXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPA 562
           A          Q + A  P    K     FF  Y+++ +L  ++   +L+YR  R     
Sbjct: 472 AAFWVAVIIFVQGFQAFCP----KFKVAEFFTGYISLILLAVVFCLAQLYYRC-RFFNRL 526

Query: 563 NEVDLVSHRKIFDAEIMQSEQ 583
            ++D+ S R+  DA I + E+
Sbjct: 527 EDIDIDSDRREIDALIWEEEE 547

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  230 bits (586), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 154/509 (30%), Positives = 238/509 (46%), Gaps = 20/509 (3%)

Query: 84  HKT-LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
           H T +K+ +K RH+ MI+L   IGTG+ +G    L N GP   LI Y  + +++Y + QS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
             E+A  +  ++     +    +  AF  +  ++Y   W     +E+      I+YW D 
Sbjct: 149 LGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDK 207

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           +   A                              KVL           + CGG+ + G 
Sbjct: 208 VPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGS-SQGP 266

Query: 263 LGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317
           +G  YW +PG +       +    RF G V+ L+NAAF Y G E   +TA E  NP+K++
Sbjct: 267 IGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 326

Query: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377
             A  K+V+RI   Y+M+   +G LVPYN  E L S SA   +SPFVI+I + G KV+P 
Sbjct: 327 PRAINKVVFRIALFYIMSLFFIGMLVPYND-ERLASTSAVIASSPFVISIQNAGTKVLPD 385

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437
                                          G APK F +V R G P   ++V+   GLL
Sbjct: 386 IFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLL 445

Query: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497
            F+  +    T F WL+ IS L+ L  W  IS+SH+RF +++  +G S D+L +++    
Sbjct: 446 AFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMP 505

Query: 498 WGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYR--- 554
           +GAYYA          Q + A SP      D   FF +Y+++ IL  L++G +++YR   
Sbjct: 506 FGAYYATFFVTVIIFIQGFQAFSP----HWDTTAFFTSYISLIILAVLFIGCQIFYRCRF 561

Query: 555 DWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
            WRV     ++D+ S R+  +A I + ++
Sbjct: 562 FWRV----EDIDIDSDRREIEAVIWEDDE 586

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  230 bits (586), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 151/532 (28%), Positives = 251/532 (47%), Gaps = 36/532 (6%)

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           D   ++  LK+ +K RH+ MI++   +GTG+L+G G +L  GGP ++LI YA V  +++ 
Sbjct: 72  DGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFF 131

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
            +    E+A  Y  L G F +Y +  VD A  F++ + Y  ++  + P +L  A++ I+Y
Sbjct: 132 TMACLGEMAS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189

Query: 199 W--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGG 256
           W   D +NP                             ++ KV++          +  GG
Sbjct: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGG 249

Query: 257 AGNDGYLGSVYWHDPGAFR-------GNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309
             +   LG  YW DPGAF+       G+ G  +F   VAV V + F+Y G E + +  +E
Sbjct: 250 GPDHDRLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSE 307

Query: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGS--GSAATHASPFVIAI 367
            +NP+KS+  A K  VYRII  YL T  LLG  V YN P LL +   S +  ASPFV+AI
Sbjct: 308 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 367

Query: 368 ASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRC 427
            + G+KV+PH                               G APK+F    + G P   
Sbjct: 368 QNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNA 427

Query: 428 LLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLD 487
           L++S +F  L ++  S     +F + + +  +  + +W +I + ++ F ++   QG    
Sbjct: 428 LILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 487

Query: 488 ELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGS------NKLDANNFFENYLAMPI 541
           +  Y +    +GAY+A           F + I+ + +      +K D   F   Y+ +P+
Sbjct: 488 KFAYVAPGQRYGAYFAL---------SFCILIALIKNFTVFLGHKFDYKTFITGYIGLPV 538

Query: 542 LIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAE----IMQSEQLEEKEQ 589
            I  + GYKL Y+    +I + +VDL + ++I+D E     ++ ++ EE+ Q
Sbjct: 539 YILSWAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  229 bits (583), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 155/536 (28%), Positives = 247/536 (46%), Gaps = 23/536 (4%)

Query: 71  EDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYA 130
           ED      D       LK+ +K RH+ MI++   +GTG+L+G G +L  GGPAS+LI Y+
Sbjct: 34  EDDSNKISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYS 93

Query: 131 IVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELV 190
            V  +++ V+    E+A  Y  L G F +Y     D A  F+V + Y  ++  I P +L 
Sbjct: 94  FVGILVFFVMACLGEMAT-YIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLT 151

Query: 191 TASMTIKYWND--SINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXX 248
             ++ I+YW D  ++NP                             ++ K+++       
Sbjct: 152 AGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILF 211

Query: 249 XXXVNCGGAGNDGYLGSVYWHDPGAFR-------GNNGINRFKGLVAVLVNAAFAYGGAE 301
              +  GG  N   LG  YW +PGAF+       G+ G  +F   VAV V A FAY G E
Sbjct: 212 LFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG--KFVSFVAVFVYALFAYLGIE 269

Query: 302 FSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL--GSGSAATH 359
            + + AAE +NP+++I  A K  +YRII  Y++T  LLG  V YN P LL     S +  
Sbjct: 270 LTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAA 329

Query: 360 ASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVD 419
           ASPFV+AI + GV+ +PH                               G APKLF   +
Sbjct: 330 ASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTN 389

Query: 420 RRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSM 479
           R G P   L    +F LL ++  S     +F + + +  +  + +W SI ++++ F R+ 
Sbjct: 390 RWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRAC 449

Query: 480 IVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAM 539
           I Q    +   Y++    +GAY              ++    V   + D  +F   Y+ +
Sbjct: 450 IAQNVDRNSFAYRAPFQPYGAYITLFFCVLIA----FIKNFTVFIGEFDYKSFITGYIGL 505

Query: 540 PILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQS--EQLEEKEQLRHA 593
           P+ +  Y GYK+ Y+    ++ A E DL S ++  D E  +   ++ E KE+L+++
Sbjct: 506 PLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAIDREEAEGKIKEAEAKERLKNS 559

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  229 bits (585), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 153/530 (28%), Positives = 250/530 (47%), Gaps = 33/530 (6%)

Query: 78  PDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLY 137
           PD   +   L++++K RH+ MI++   +GTG+L+G G +L  GGP S+LI Y  V  +++
Sbjct: 71  PDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVF 130

Query: 138 CVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIK 197
             +    E+A  Y  L G F +Y +  VD A  F++ + Y  ++  + P +L  A++ I+
Sbjct: 131 FTMACLGEMAS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188

Query: 198 YW--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCG 255
           YW   D +NP                             ++ KV++          +  G
Sbjct: 189 YWVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLG 248

Query: 256 GAGNDGYLGSVYWHDPGAFR-------GNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAA 308
           G  +   LG  YW DPGAF+       G+ G  +F    +V V + F+Y G E + +  +
Sbjct: 249 GGPDHDRLGFRYWRDPGAFKEYSTAITGSKG--KFVAFASVFVYSLFSYTGIELTGIVCS 306

Query: 309 EQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATH--ASPFVIA 366
           E +NP+KS+  A K  VYRII  YL T  LLG  V YN P LL +   A    ASPFV+A
Sbjct: 307 EAKNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVA 366

Query: 367 IASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVR 426
           I + G+KV+PH                               G APK+F    + G P  
Sbjct: 367 IQNSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYY 426

Query: 427 CLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSL 486
            L+VS +F  L ++  S     +F + + +  +  + +W +I + ++ F R+   QG   
Sbjct: 427 ALMVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDK 486

Query: 487 DELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGS------NKLDANNFFENYLAMP 540
            +  Y +    +GAY+A           F + I+ + +      +  D   F   Y+ +P
Sbjct: 487 SKFAYVAPGQRYGAYFALF---------FCILIALIKNFTVFLGHTFDYKTFITGYIGLP 537

Query: 541 ILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSE-QLEEKEQ 589
           I +  ++GYKL Y+  +V+ PA + DL + ++I+D E  Q + Q +EKE+
Sbjct: 538 IYVFSWVGYKLIYKT-KVVKPA-DADLYTLKEIYDREEEQGKLQDQEKEE 585

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  228 bits (582), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 157/539 (29%), Positives = 244/539 (45%), Gaps = 17/539 (3%)

Query: 52  EEEYNGGD--GIHSTHERVSGEDFERLAPDDSSKHKT-LKQNIKPRHVLMISLATGIGTG 108
           +E++  GD       ++   GE  E   P     H T +K+ +KPRH+ MI+L   IGTG
Sbjct: 64  DEDFRHGDEEDDILAYDDDDGECDESGLPAKGKFHDTQVKRALKPRHLGMIALGGTIGTG 123

Query: 109 MLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKA 168
           + VG  + L   GP   LI Y  + +++Y V QS  E+A  +  ++     +    +  A
Sbjct: 124 LFVGISEPLSRSGPVGSLIAYIFMGSVVYFVTQSLGEMAT-FIPVTSSITVFTKRFLSPA 182

Query: 169 FAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXX 228
              S  ++Y   W      EL      I+YW   +   A                     
Sbjct: 183 LGVSNGYMYWFNWAITFATELSVTGQIIQYWTYKVPLAAWIPIFWVIVAVLNFFPVKIYG 242

Query: 229 XXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRF 283
                 ++ KVL           + CGG+   G +G  YW    AF       N    RF
Sbjct: 243 EIEFWVSSVKVLAIVGYLIYALVIVCGGS-RQGPIGFRYWRHGYAFGDGYISKNKDEARF 301

Query: 284 KGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLV 343
            G V+ L+NAAF Y G E   ++A E  NP+K++  A  K+++RI   Y+++   +G LV
Sbjct: 302 LGWVSSLINAAFTYQGTELVGISAGEAANPRKTVPRAINKVIFRIALFYILSLFFIGLLV 361

Query: 344 PYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXX 403
           PYN   L   GSA   +SPFVI++ + G   +P                           
Sbjct: 362 PYNDKRL-SDGSAIIASSPFVISMLNAGTSALPDIFNAVILITVLSAANSDVYIASRVLY 420

Query: 404 XXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELF 463
               QG APK F YV+R G P   + V+C+ G L F+  S    T F WL+ IS L+ L 
Sbjct: 421 ALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGWLAFLVVSNNANTAFNWLINISTLAGLT 480

Query: 464 TWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVG 523
            WF I  +H+RF +++  +G S D+L +++    WGAYYA          Q + A +P  
Sbjct: 481 AWFFICFAHIRFMQALKHKGISRDDLPFKARFMPWGAYYAAFFVGLIIFIQGYDAFTP-- 538

Query: 524 SNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSE 582
               D  +FF +Y+++ +   LYLG  ++YR  R++I   ++D+ + RK  +A + + +
Sbjct: 539 ---WDTKSFFTSYISLILFGVLYLGCLIYYRG-RLLIKIEDIDIDTDRKEVEAYVWEED 593

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  227 bits (579), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 148/510 (29%), Positives = 237/510 (46%), Gaps = 15/510 (2%)

Query: 80  DSSKHKT-LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           ++  H+T +K+ +K RH+ MI+L   IGTG+ VG    L   GP   LI Y  + T++Y 
Sbjct: 84  EAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYF 143

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
           V QS  E+A  +  ++     +    +  AF  +  ++Y   W     +E+      I+Y
Sbjct: 144 VTQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQY 202

Query: 199 WNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAG 258
           W  ++   A                              KVL           + CGG+ 
Sbjct: 203 WTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGS- 261

Query: 259 NDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNP 313
           + G +G  YW  PGAF       N    +F G VA L+NAAF Y G E   +TA E  NP
Sbjct: 262 HQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANP 321

Query: 314 QKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVK 373
           +K++  A  K+V+RI+  Y+M+   +G L+PYN   L  +  A   +SPFVI+I +   K
Sbjct: 322 RKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRL-SAQDAVIASSPFVISIKNAHTK 380

Query: 374 VVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCV 433
           V+P                                G APK F+YV R G P   ++ +  
Sbjct: 381 VLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTAS 440

Query: 434 FGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQS 493
            GLL F+  +    T F WL+ IS L+ L  W  ISL+H+RF +++  +G S D+L +++
Sbjct: 441 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKA 500

Query: 494 WTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWY 553
               WGAYYA          Q + A  P      D + FF +Y+++ +L  L +G +L+Y
Sbjct: 501 KLMPWGAYYAAFFVTVIIFIQGYQAFCP-----WDVSTFFTSYISLILLAVLVVGCQLYY 555

Query: 554 RDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
           R  R ++   ++D+ + R+  ++ + + ++
Sbjct: 556 RG-RFLLKLEDIDIDTDRREIESIVWEDDE 584

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  226 bits (576), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 147/506 (29%), Positives = 234/506 (46%), Gaps = 19/506 (3%)

Query: 81  SSKH--KTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           SS H    +++ +KPRHV MI+L   IGTG+ +G    L N GP   LI Y  + ++ YC
Sbjct: 45  SSGHGRNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYC 104

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
           V QS  E+A  +  ++  F  +    +      +  ++YC  W     LEL      I+Y
Sbjct: 105 VTQSLGEMA-TFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEY 163

Query: 199 WNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAG 258
           W  ++   A                              KV+           + C GAG
Sbjct: 164 WTSAVPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVC-GAG 222

Query: 259 NDGYLGSVYWHDPGAFRGNNGI-------NRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQ 311
             G +G  YW +PG +   +GI        RF G V+ LVNAAF Y G E   ++A E  
Sbjct: 223 KTGPVGFRYWRNPGPW--GDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESA 280

Query: 312 NPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHG 371
           NP+K++  A  K+ +RI+  Y+ +   +G LVP+N  +L  S S +   SPF+IAI + G
Sbjct: 281 NPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSYSA-GSPFIIAIQNSG 339

Query: 372 VKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVS 431
            K++P                              ++  AP+ F   +R G P   +L  
Sbjct: 340 TKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFV 399

Query: 432 CVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGY 491
             FG L +++ S      F WLL I+ ++  F+W  ISL HVRF +++ +QG S D+L +
Sbjct: 400 ANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPF 459

Query: 492 QSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKL 551
           ++    WGAYY+          Q + +++P      + +NFF  Y+++ + + ++  ++ 
Sbjct: 460 KAKLMPWGAYYSAFFITLIIIIQGFTSLAP----TFNVSNFFAAYISVFMFLVIWAVFQC 515

Query: 552 WYRDWRVIIPANEVDLVSHRKIFDAE 577
           WYR  R+I     VD+ S R+  DA+
Sbjct: 516 WYRT-RIIHRIEHVDIDSDRREVDAQ 540

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  227 bits (579), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 159/561 (28%), Positives = 260/561 (46%), Gaps = 27/561 (4%)

Query: 49  KRPEEEYNGGDGIHSTHERVSGEDFER---LAPDDSSKHKTLKQNIKPRHVLMISLATGI 105
           K+   + N  D + +   R+  ED E+      D   +H  L++++K RH+ MI++   I
Sbjct: 47  KKDGLDINDMDNLSTVSSRL--EDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSI 104

Query: 106 GTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLV 165
           GTG+L+G G SL+  GP S+ I YA V  +++  + +  E+A  Y  L G F +Y +   
Sbjct: 105 GTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMAS-YIPLDG-FTSYASRYC 162

Query: 166 DKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWND--SINPDAXXXXXXXXXXXXXXXX 223
           D A  F+V + Y  ++L + P +L  A++ I+YW D   +NP                  
Sbjct: 163 DPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG 222

Query: 224 XXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFR-------G 276
                      +T KV++          +  GG      LG  ++  PGAF+       G
Sbjct: 223 VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDG 282

Query: 277 NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTA 336
           + G  +F   VAVLV A FAY G E + + AAE  NP+KSI  A K  +YRII  YL+T 
Sbjct: 283 SKG--KFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTI 340

Query: 337 ALLGFLVPYNSPELLGSGSAAT--HASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXX 394
            LLG  V Y+ P L  + ++ T   ASP+V+AI + G+K +PH                 
Sbjct: 341 FLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSD 400

Query: 395 XXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLL 454
                           APK+F   +R G P   LL+S  F LL +++ S     +F + +
Sbjct: 401 LYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFV 460

Query: 455 AISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQ 514
            +  +  L +W SI ++++ F R++  Q        Y++    +G+Y+            
Sbjct: 461 NVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILI---A 517

Query: 515 FWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIF 574
           F    +   ++  D  NF   Y+ +P+ +  Y GYK + +  ++  P  EVDL + +   
Sbjct: 518 FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAI 575

Query: 575 DAEIMQSE--QLEEKEQLRHA 593
           D E  Q +    E +E+L+++
Sbjct: 576 DEEEEQGKIADAERRERLKNS 596

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  225 bits (574), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 144/491 (29%), Positives = 232/491 (47%), Gaps = 12/491 (2%)

Query: 69  SGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIG 128
           SG++      +   +   +K+ +KPRH+ MI+L   IGTG+ VG    L   GP   LI 
Sbjct: 38  SGDNAPCEKGEGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIA 97

Query: 129 YAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLE 188
           Y  + +++Y V QS  E+A  +  ++     +    +  AF  +  ++Y   W     +E
Sbjct: 98  YIFIGSIVYFVTQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVE 156

Query: 189 LVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXX 248
           +      I+YW D++   A                            + KV+        
Sbjct: 157 IAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIY 216

Query: 249 XXXVNCGGAGNDGYLGSVYWHDPGAFRG---NNGIN--RFKGLVAVLVNAAFAYGGAEFS 303
              + CGG+ + G +G  YW +PG +     +  +N  RF G V+ L+NAAF Y G E  
Sbjct: 217 ALVIVCGGS-HQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELV 275

Query: 304 VLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPF 363
            +TA E  NP+K++  A  K+ +RI+  Y+++   +G LVPY+   L  + +A   +SPF
Sbjct: 276 GITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRL-SNTTAVIASSPF 334

Query: 364 VIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGR 423
           VI+I + G KV+PH                               G APK F YV ++G 
Sbjct: 335 VISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGV 394

Query: 424 PVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQG 483
           P   ++V+ + GLL F+  +      F WL+ IS L+ L  W  ISLSHVRF + +  +G
Sbjct: 395 PYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRG 454

Query: 484 RSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILI 543
            S ++L +++    WGAYYA          Q + A +P    K   ++FF +Y+++ +L 
Sbjct: 455 ISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFTP----KFRVSDFFTSYISLILLA 510

Query: 544 GLYLGYKLWYR 554
            L+LG +L+YR
Sbjct: 511 VLFLGCQLFYR 521

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  225 bits (574), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 171/572 (29%), Positives = 266/572 (46%), Gaps = 21/572 (3%)

Query: 36  SRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSK--HKT-LKQNIK 92
           S  G+F    DS    +    G D I  +  +VS E ++    ++     H+T +K+ +K
Sbjct: 21  SIKGMFS--TDSGTLSKRSKAGEDSIELSDVQVSSELYDHAESEEGEGDFHETEVKRALK 78

Query: 93  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTS 152
           PRHV MI+L   IGTG+ VG  K L   GP   LI Y  + +++Y V QS  E+A  +  
Sbjct: 79  PRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMAT-FIP 137

Query: 153 LSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXX 212
           ++     +    +  AF  +  ++Y   W     +EL      I YW D++   A     
Sbjct: 138 VTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIF 197

Query: 213 XXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPG 272
                                  + KV+           + CGG+ + G +G  YW +PG
Sbjct: 198 WVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGS-SQGPIGFRYWRNPG 256

Query: 273 -----AFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYR 327
                    N    RF G V  LVNA+F Y G E   +TA E  NP+K++  A  K+ +R
Sbjct: 257 PWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFR 316

Query: 328 IIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXX 387
           I+  Y+ +   +G LVPYNSP+L  S SA   +SPFVI+I + G KV+P           
Sbjct: 317 ILVFYIGSLFFVGLLVPYNSPQL-ESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTI 375

Query: 388 XXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEE 447
                                G APK F+YV ++G P   ++ + + GLL F+A +    
Sbjct: 376 LSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENAN 435

Query: 448 TVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXX 507
           T F WL+ IS L+ L  WF IS++H+RF + + ++G S D L +++    WGAYYA    
Sbjct: 436 TAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFV 495

Query: 508 XXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDL 567
                 Q + A +P    + D + FF  Y+++ +L+ L++  +L+YR  R +    ++D+
Sbjct: 496 GLIVFIQGFTAFAP----RFDVSEFFTAYISLILLVVLFILCQLYYRC-RFLTKIEDIDI 550

Query: 568 VSHRKIFDAEIMQSEQLEEKEQLRHASWTKRA 599
            S R+  DA I +    +E + L    W   A
Sbjct: 551 DSDRREIDAIIWED---DEPKNLWEKFWVALA 579

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  226 bits (575), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 163/586 (27%), Positives = 265/586 (45%), Gaps = 30/586 (5%)

Query: 12  PEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGG-----DGIHSTHE 66
           PED +    ++++   +T+P S   +         + K+      GG     + I ++  
Sbjct: 29  PEDQIEHEMEAIDPSNKTTPYSIDEKQ-------YNTKKKHGSLQGGAIADVNSITNSLT 81

Query: 67  RVSGEDFER-LAPDDSSKH---KTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGP 122
           R+     E  +  D+   H   K +K+ +K RH+ MI+L   IGTG+ VG    L N GP
Sbjct: 82  RLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGP 141

Query: 123 ASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWL 182
              LI Y  + T++Y V QS  E+A  +  ++     +    +  AF  S  ++Y   W 
Sbjct: 142 VGSLIAYIFMGTIVYFVTQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA 200

Query: 183 CILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMX 242
               +E+      I+YW D +   A                            + KVL  
Sbjct: 201 ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAI 260

Query: 243 XXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAY 297
                    + CGG+ + G +G  YW +PGA+       +    RF G V+ L+NAAF Y
Sbjct: 261 MGYLIYALIIVCGGS-HQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTY 319

Query: 298 GGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAA 357
            G E   +TA E  NP+K++  A  K+V+RI+  Y+M+   +G LVPYN   L  S SA 
Sbjct: 320 QGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSAS-SAV 378

Query: 358 THASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNY 417
             +SPFVI+I + G   +P                                G APK F Y
Sbjct: 379 IASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGY 438

Query: 418 VDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRR 477
           V R+G P   ++ +   GLL F+  +    T F WL+ IS L+ L  W  ISL+H+RF +
Sbjct: 439 VTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQ 498

Query: 478 SMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYL 537
           ++  +G S D+L +++    +GAYYA          Q + A  P        + FF +Y+
Sbjct: 499 ALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-----FKVSEFFTSYI 553

Query: 538 AMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
           ++ +L  +++G +++Y+  R I    ++D+ S R+  +A I + ++
Sbjct: 554 SLILLAVVFIGCQIYYKC-RFIWKLEDIDIDSDRREIEAIIWEDDE 598

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  226 bits (576), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 151/524 (28%), Positives = 240/524 (45%), Gaps = 27/524 (5%)

Query: 87  LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASEL 146
           LK+ +K RH+ MI++   +GTG+L+  G+SL   GP S LI Y  V  M++  +    E+
Sbjct: 65  LKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEM 124

Query: 147 AIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW--NDSIN 204
           A  +  L G F +Y +   D A  F+V + Y +++  + P +L  A+M ++YW   D++N
Sbjct: 125 AT-FIPLDG-FTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVN 182

Query: 205 PDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLG 264
           P                             ++ KVL+          +  GGAG+   LG
Sbjct: 183 PGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLG 242

Query: 265 SVYWHDPGAFRG-----NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 319
             YW  PGAF       +  + +F   VAVLV   FAY G E + + AAE  NP++S+  
Sbjct: 243 FRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPK 302

Query: 320 ASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXX 379
           A K   YRI+  Y+++  LLG  VPYN  +L+ +   +  ASPF IAI + G+ V+P   
Sbjct: 303 AIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGITVLPDIF 362

Query: 380 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCF 439
                                          APK+F + +R G P   L VSC+F LL +
Sbjct: 363 NGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAY 422

Query: 440 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWG 499
           +  S     VF + + +  ++ L TW SI ++++ F R++  Q        Y +    +G
Sbjct: 423 MTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYG 482

Query: 500 AYYAXXXXXXXXXGQFWVAISPVGSN------KLDANNFFENYLAMPILIGLYLGYKLWY 553
           AY +           F+  +  +  N        D   F   Y+ +PI +  Y GYK+  
Sbjct: 483 AYVSL----------FFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITC 532

Query: 554 RDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTK 597
           +    I  A  VDLVS + + D E ++ E +E+ ++    + TK
Sbjct: 533 KSE--IRSARYVDLVSQKSLVDREQVEYELIEQLKREEMIANTK 574

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  224 bits (571), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 152/537 (28%), Positives = 245/537 (45%), Gaps = 22/537 (4%)

Query: 56  NGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGK 115
           NG D   S  E +  ED      +   ++  +K+ +K RH+ MI+L   IGTG+ +G   
Sbjct: 60  NGQD-TFSMEEDIQDED------EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLST 112

Query: 116 SLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSW 175
            L N GP   LI Y  + ++ Y V QS  E+A  +  ++  F  +    +  AF  +  +
Sbjct: 113 PLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGY 171

Query: 176 VYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXN 235
           +Y   W     LEL      I++W  ++   A                            
Sbjct: 172 MYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVA 231

Query: 236 TCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVL 290
           + KV+           + CG AG  G +G  YW +PGA+       N    RF G V+ L
Sbjct: 232 SIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSL 290

Query: 291 VNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPEL 350
           +NAAF + G E   +TA E  NP+K++  A KK+V+RI+  Y+ +   +G LVPYN P+L
Sbjct: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350

Query: 351 LGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGF 410
             S ++    SPF+IAI + G KV+PH                             +   
Sbjct: 351 T-SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKL 409

Query: 411 APKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISL 470
           APK F+   + G P   +  + +FG L ++  S     VF WLL I+G++  F W  IS+
Sbjct: 410 APKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISV 469

Query: 471 SHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDAN 530
           SH+RF +++  +G S DEL +++      AYYA          Q + + +P      +  
Sbjct: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT----FNGV 525

Query: 531 NFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEK 587
           NF   Y+++ + + +++ ++L +R  R +    +VD+ S R+  D E +  E+ E K
Sbjct: 526 NFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  223 bits (567), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 144/516 (27%), Positives = 240/516 (46%), Gaps = 14/516 (2%)

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           DD  K + +K+ +K RH+ MI+L   IGTG+ +G  + L   GP   LI Y  + T+++ 
Sbjct: 27  DDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFS 86

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
           V QS  E+   +  ++  F  +    +  AF  +  ++Y   W     LEL      I++
Sbjct: 87  VTQSLGEMCT-FIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145

Query: 199 WNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAG 258
           W  ++   A                            + KVL               GAG
Sbjct: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVL-AILGFIIYGICIICGAG 204

Query: 259 NDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNP 313
             G +G  YW +PG +       N    RF G V+ L+NAAF + G E   +TA E Q P
Sbjct: 205 VTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264

Query: 314 QKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVK 373
           +K++  A KK+V+RI+  Y+ +  ++G LVPYN P+L  S  +   +SPF+I I + G K
Sbjct: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSNDSYVSSSPFIITIQNAGTK 323

Query: 374 VVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCV 433
           ++PH                             +   APK F    + G P   +L + +
Sbjct: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383

Query: 434 FGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQS 493
           FG L ++  +   +  FTWLL I G++  F W  IS SH+RF +++  +G S ++L Y++
Sbjct: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443

Query: 494 WTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWY 553
               W AYYA          Q + + +P    K    NFF  Y+++ + I  ++ +++W+
Sbjct: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWF 499

Query: 554 RDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQ 589
           +  R++    +VDL + R+  + E+  S+ +E+K +
Sbjct: 500 KC-RLVWKLQDVDLDTDRRDIEEEV-WSDDVEDKNK 533

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  223 bits (568), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 143/519 (27%), Positives = 239/519 (46%), Gaps = 13/519 (2%)

Query: 59  DGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLH 118
           + +HS   +++ E  E    +   +   +K+ +K RH+ MI+L   IGTG+ +G    L 
Sbjct: 31  NSVHSIPSQITIESQEEEIANGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLT 90

Query: 119 NGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYC 178
           N GP   LI Y  + T++Y V QS  E+A  +  ++  F  +    +  +F  +  ++Y 
Sbjct: 91  NAGPVGALIAYLFMGTLVYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPSFGAANGYMYW 149

Query: 179 LQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCK 238
             W     LEL      I++W  ++   A                            + K
Sbjct: 150 FSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIK 209

Query: 239 VLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNA 293
           VL           + CG AG  G +G  YW +PG         N    +F G V+ L+NA
Sbjct: 210 VLAIMGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINA 268

Query: 294 AFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGS 353
           AF Y G E   +TA E  NP+KS+  A KK+V+RI+  Y+ +   +G LVPYN P+ L S
Sbjct: 269 AFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPK-LTS 327

Query: 354 GSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPK 413
             +   ASPF+I+I + G  ++PH                             +   AP+
Sbjct: 328 DDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPR 387

Query: 414 LFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHV 473
           + +  ++ G P   ++ + +FG L ++  S   E  F WLL I+G++  F+W  IS+SHV
Sbjct: 388 ILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHV 447

Query: 474 RFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFF 533
           RF +++  +G S D+L +++      AYYA          Q + +  P      D  +F 
Sbjct: 448 RFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFL 503

Query: 534 ENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRK 572
             Y++  + I +++ ++LW+R  R+I    +VD+ + R+
Sbjct: 504 AAYISCFLFIAIWIVFQLWFRC-RLIWKIEDVDIDTDRR 541

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  223 bits (569), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 164/582 (28%), Positives = 257/582 (44%), Gaps = 32/582 (5%)

Query: 11  SPEDGVVESFDSVEVV----KETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHE 66
           SP+D  +E   + E++    K+ +  ++ S D   H   DS  R    + G D      E
Sbjct: 36  SPDDHSIEIIKN-EILEKDKKKIAHTNQFSSD--IHSITDSLARSRLPHLGDDDDEEDAE 92

Query: 67  RVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLL 126
                D E            +K+ +K RH+ MI+L   IGTG+ VG    L N GP   L
Sbjct: 93  EAQYHDTE------------VKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSL 140

Query: 127 IGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILP 186
           I Y  + +++Y + QS  E+A  +  ++     +    +  AF  +  ++Y   W     
Sbjct: 141 IAYLFMGSIIYSITQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYA 199

Query: 187 LELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXX 246
           +E+      I+YW   +   A                              KVL      
Sbjct: 200 VEISVVGQVIEYWTKKVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYL 259

Query: 247 XXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAE 301
                + CGG+ + G +G  YW +PG +       +   +RF G V+ L+NAAF Y G E
Sbjct: 260 LYALIIVCGGS-SQGPIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTE 318

Query: 302 FSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHAS 361
              +TA E  NP+KS+  A  K+V+RI   Y+M+   +G LVPY+ P L    SA   +S
Sbjct: 319 LVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSD-SAVVASS 377

Query: 362 PFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRR 421
           PFVI+I + G K++P                              + G APK F YV R 
Sbjct: 378 PFVISIQNAGTKILPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRH 437

Query: 422 GRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIV 481
           G P   +L +   GLL F+  +    T F WL+ IS L+ L  W  IS+SH+RF +++  
Sbjct: 438 GVPYLGVLCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKF 497

Query: 482 QGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPI 541
           +G S D+L +++    W AYYA          Q + A SP      D   FF  Y+++ I
Sbjct: 498 RGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGFQAFSP----HFDVTAFFTAYISLII 553

Query: 542 LIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
           L  L++G +++YR  R      ++D+ + R+  +  I + ++
Sbjct: 554 LAVLFIGCQIYYRC-RFFWKLEDIDIDTDRREIEEVIWEDDE 594

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  221 bits (563), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 147/501 (29%), Positives = 232/501 (46%), Gaps = 13/501 (2%)

Query: 87  LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASEL 146
           +K+ +K RH+ MI+L   IGTG+ +G    L N GP   LI Y  ++T++Y V+QS  E+
Sbjct: 77  VKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136

Query: 147 AIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPD 206
           A  +  ++  F  + +  +  AF  +  ++Y   W     LEL      I++W  ++   
Sbjct: 137 A-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMA 195

Query: 207 AXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSV 266
           A                              KV+           + C GAG  G +G  
Sbjct: 196 AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC-GAGITGPVGFR 254

Query: 267 YWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSAS 321
           YW +PGA+       +    RF G V+ L+NAAF Y G E   +TA E  NP+KS+  A 
Sbjct: 255 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 314

Query: 322 KKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXX 381
           KK+V+RI+  Y   A  +G LVPYN P+ L S  +   +SPF+IAI + G KV+PH    
Sbjct: 315 KKVVFRILVFYYPIAVFIGLLVPYNDPK-LNSSDSYVSSSPFIIAIENSGTKVLPHIFNA 373

Query: 382 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVA 441
                                    +   AP  F   +  G P   +  +  FG L ++ 
Sbjct: 374 VVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYME 433

Query: 442 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAY 501
            S    + F WLL I+G++  FTW  IS  H+RF +++  +G S D+L +++    W AY
Sbjct: 434 LSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAY 493

Query: 502 YAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIP 561
           YA          Q + A +P  S      +F   Y+++ + I ++LG ++W+R  R+   
Sbjct: 494 YALFFMVVIILIQGFTAFAPTFSGV----DFAAAYVSVFLFIAIWLGAQIWFRC-RIFHR 548

Query: 562 ANEVDLVSHRKIFDAEIMQSE 582
            +EVD+ + R+  +A +   E
Sbjct: 549 LDEVDIDTDRRDIEAVVWDDE 569

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  221 bits (563), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 155/538 (28%), Positives = 246/538 (45%), Gaps = 21/538 (3%)

Query: 61  IHSTHERVSGEDF----ERLAPDDSS--KHKTLKQNIKPRHVLMISLATGIGTGMLVGNG 114
           + S   RV+GED     + +  +D    ++  +K+ +K RH+ MI+L   IGTG+ +G  
Sbjct: 52  LRSFPTRVNGEDTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLS 111

Query: 115 KSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVS 174
             L N GP   LI Y  + ++ Y V QS  E+A  +  ++  F  +    +  AF  +  
Sbjct: 112 TPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANG 170

Query: 175 WVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXX 234
           ++Y   W     LEL      I++W   +   A                           
Sbjct: 171 YMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWV 230

Query: 235 NTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAV 289
            + KVL           + CG AG  G +G  YW +PGA+       +    RF G V+ 
Sbjct: 231 ASIKVLAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSS 289

Query: 290 LVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPE 349
           L+NAAF + G E   +TA E  NP+KS+  A KK+V+RI+  Y+ +   +G LVPYN P+
Sbjct: 290 LINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPK 349

Query: 350 LLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQG 409
           L  S S  +  SPF+IAI + G KV+PH                             +  
Sbjct: 350 LTQSTSYVS-TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNK 408

Query: 410 FAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSIS 469
            APK  +   + G P   + V+  FG L ++  S   + VF WLL I+G++  F W  IS
Sbjct: 409 LAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFIS 468

Query: 470 LSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDA 529
           +SH+RF +++  +G S DEL +++      AYYA          Q + A +P    K + 
Sbjct: 469 ISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP----KFNG 524

Query: 530 NNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEK 587
            +F   Y+++ + + +++ ++  +R  R I    +VD+ S R+  D E +  E  E K
Sbjct: 525 VSFAAAYISIFLFLAVWILFQCIFRC-RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  221 bits (563), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 151/537 (28%), Positives = 244/537 (45%), Gaps = 22/537 (4%)

Query: 56  NGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGK 115
           NG D   S  E +  ED      +   ++  +K+ +K RH+ MI+L   IGTG+ +G   
Sbjct: 60  NGQD-TFSMEENLQDED------EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLST 112

Query: 116 SLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSW 175
            L N GP   LI Y  + ++ + V QS  E+A  +  ++  F  +    +  AF  +  +
Sbjct: 113 PLANAGPVGALIAYLFMGSLAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGY 171

Query: 176 VYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXN 235
           +Y   W     LEL      I++W   +   A                            
Sbjct: 172 MYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVA 231

Query: 236 TCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVL 290
           + KV+           + CG AG  G +G  YW +PGA+       N    RF G V+ L
Sbjct: 232 SIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSL 290

Query: 291 VNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPEL 350
           +NAAF + G E   +TA E  NP+K++  A KK+V+RI+  Y+ +   +G LVPYN P+L
Sbjct: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350

Query: 351 LGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGF 410
             + S  +  SPF++AI + G KV+PH                             +   
Sbjct: 351 TEATSYVS-TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKL 409

Query: 411 APKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISL 470
           APK  +   + G P   +  + VFG L ++  S   + VF WLL I+G++  F W  IS+
Sbjct: 410 APKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISI 469

Query: 471 SHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDAN 530
           SH+RF +++  +G S DEL +++      AYY+          Q + A +P    K + +
Sbjct: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAP----KFNGS 525

Query: 531 NFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEK 587
           +F   Y+++ + I +++ ++  +R  R I    +VD+ S R+  D E +  E  E K
Sbjct: 526 SFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  221 bits (562), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 148/518 (28%), Positives = 235/518 (45%), Gaps = 16/518 (3%)

Query: 87  LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASEL 146
           +K+ +KPRHV MI+L   IGTG+ VG    L   GP   LI Y  + T++Y V QS  E+
Sbjct: 115 VKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYFVTQSMGEM 174

Query: 147 AIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPD 206
           A  +  ++     + +  +  AF  +  ++Y   W     +EL      I+YW +++   
Sbjct: 175 AT-FIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYWTEAVPRA 233

Query: 207 AXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSV 266
           A                            + KVL           + CGG+   G +G  
Sbjct: 234 AWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGS-KQGPIGFR 292

Query: 267 YWHDPGAFRG-----NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSAS 321
           YW +PG +       +    RF G VA L+NA+F Y G E   +TA E  NP++++  A 
Sbjct: 293 YWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPRRTVPRAI 352

Query: 322 KKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXX 381
            K+ +RI+  Y+++   +G LVPYN   L    +    +SPFVI+I + G + +P     
Sbjct: 353 NKVFFRILFFYILSLFFVGLLVPYNHSSL-DKTTTVIASSPFVISIQNAGTRALPDIFNA 411

Query: 382 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVA 441
                                      G APK+F+ V  +G P   ++V+ + GLL F+ 
Sbjct: 412 VVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLLAFLV 471

Query: 442 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAY 501
            +      F WL+ IS L+ L  W  IS+SH+RF + +  +G S D+L ++S    +GAY
Sbjct: 472 VNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAY 531

Query: 502 YAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIP 561
           YA          Q + A SP          FF +Y+++ +L+ ++ G +L+YR  R    
Sbjct: 532 YAAFWVTVIIFVQGFQAFSP----HFKVTEFFTSYISLMLLVVVFCGAQLFYRC-RFFNR 586

Query: 562 ANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRA 599
             ++D+ S R+  DA I +    +E   L    WT  A
Sbjct: 587 LEDIDIDSDRREADALIWED---DEPTTLWGKFWTAVA 621

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  219 bits (559), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 150/537 (27%), Positives = 243/537 (45%), Gaps = 26/537 (4%)

Query: 69  SGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIG 128
           S  +   L  ++  KH+++K+ +KPRH+ MI+L   IGTG+ +G  K L N GP   LI 
Sbjct: 75  SATNTGTLCTEEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIA 134

Query: 129 YAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLE 188
           Y  V T+++ V QS  E+ + +  ++  F  +    +  AF  +  ++Y   W     +E
Sbjct: 135 YIFVGTIIFSVTQSLGEM-VTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVE 193

Query: 189 LVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXX 248
           L      I++W  ++   A                              KVL        
Sbjct: 194 LSVLGKVIQFWTTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIF 253

Query: 249 XXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFS 303
              +   GAG  G  G  YW DPGA+       +    RF G V+ L+NAAF Y G E  
Sbjct: 254 CLCIT-SGAGPHGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELV 312

Query: 304 VLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPF 363
            +TA E  NP+K++  A KK++ RI+  Y+ +   +G LVP+N P+ L S ++   +SPF
Sbjct: 313 GITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPK-LTSATSFVSSSPF 371

Query: 364 VIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGR 423
           +IAI + GV ++P                                  AP+ F    + G 
Sbjct: 372 IIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGV 431

Query: 424 PVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQG 483
           P   +L + +FG L F+  +   + VF WLL+I  ++  F W  ISLSH+RF +++  +G
Sbjct: 432 PFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRG 491

Query: 484 RSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILI 543
            S + L +++    W AYYA          Q + A +P    + + ++F  +Y+++ + +
Sbjct: 492 ISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAFAP----RFNVSDFVASYISLLLFV 547

Query: 544 ---GLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTK 597
              G++   K     W+V     ++DL S RK  D E ++ E    K       WTK
Sbjct: 548 IIWGVFQAMKKCRIFWKV----EDIDLDSDRK--DIEDIRWEDDSPK-----TFWTK 593

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  219 bits (558), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 149/544 (27%), Positives = 247/544 (45%), Gaps = 24/544 (4%)

Query: 21  DSVEVVKETSPRSEGSRDGLF--HRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAP 78
           + +E +     +S+ +R G+   +  +D   R  ++ N       T E +  +      P
Sbjct: 11  EELEALHSNLSQSQSARSGMHVSNSKIDDPLRFSKDNN------LTLEAIDDDSSRMFDP 64

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           + S     +K+ +KPRHV MI+L   IGTG+ +     L N GP   LI + ++ T+ Y 
Sbjct: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
           V QS  E+A  +  ++  F  +    +  A   +  ++Y   W     LEL      I+Y
Sbjct: 125 VTQSLGEMAT-FIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQY 183

Query: 199 WNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAG 258
           W D++  +A                            + KV+           + CG AG
Sbjct: 184 WTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AG 242

Query: 259 NDGYLGSVYWHDPGAFRGNNGI-------NRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQ 311
            +G +G  YW  PG +   NGI        RF G V+ L++AAF Y G E   +TA E +
Sbjct: 243 PEGPIGFRYWRKPGPW--GNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETK 300

Query: 312 NPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHA-SPFVIAIASH 370
           NP+K++  A  K+ +RI+  Y+ +   +G LVPYN P+L GS + +  A SPF+IAI + 
Sbjct: 301 NPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNC 360

Query: 371 GVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLV 430
              V+PH                             +   APK F+   + G P   +L+
Sbjct: 361 RTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLI 420

Query: 431 SCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELG 490
           + VFG L ++  S   + VF WLL I+ ++   TW  IS+SH+RF +++  +G S D+L 
Sbjct: 421 TAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLP 480

Query: 491 YQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYK 550
           Y++    + AYYA          Q + A +P      + ++FF  Y+++ +   ++  ++
Sbjct: 481 YKAKFMPYAAYYAAFFITVIIIIQGFTAFAP----HFNVSDFFAAYISVFLFFIVWAIFQ 536

Query: 551 LWYR 554
             YR
Sbjct: 537 TIYR 540

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  219 bits (559), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 151/530 (28%), Positives = 247/530 (46%), Gaps = 28/530 (5%)

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           DD ++   LK+++K RH+ MI++   +GTG+L+G G +L   GPAS+LI Y  V T+++ 
Sbjct: 77  DDGTR---LKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFF 133

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
            + +  E+A  Y  L G F +Y +   D A  F+V + Y  ++  I P +L  A++ I+Y
Sbjct: 134 TMAALGEMAA-YIPLDG-FTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQY 191

Query: 199 W--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGG 256
           W   D++NP                             ++ K+++          +  GG
Sbjct: 192 WVDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGG 251

Query: 257 AGNDGYLGSVYWHDPGAFR----------GNNGINRFKGLVAVLVNAAFAYGGAEFSVLT 306
             N   LG  YW  PGAF+          G+ G  +F   V V V A FAY G E + + 
Sbjct: 252 GPNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTG--KFVAFVNVFVYALFAYLGIELTGIV 309

Query: 307 AAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL--GSGSAATHASPFV 364
           AAE +NP+++I  A K  V+RI+  Y+ T  LLG  V Y+ P LL   +   +  ASPFV
Sbjct: 310 AAEAENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFV 369

Query: 365 IAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRP 424
           +AI + GV V+PH                               G APK+F   +R G P
Sbjct: 370 VAIQNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVP 429

Query: 425 VRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGR 484
              +    +F LL ++  S     +F + + +  +  + +W SI ++ + F R++  QG 
Sbjct: 430 YNAMGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGI 489

Query: 485 SLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIG 544
                 Y +    +G+Y+A          +     S    N+ D   F   Y+ +P+   
Sbjct: 490 DRSTFAYVAPFQPYGSYFALFFCVLLALIK---NFSVFLGNEFDYKTFITGYIGLPVYAF 546

Query: 545 LYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQS--EQLEEKEQLRH 592
            ++GYKL+Y+  + + P +E DL S++   D E  +   ++ E KE+L+H
Sbjct: 547 SFIGYKLYYKT-KTVKP-HEADLNSYKAAVDREEEEGKIKEAERKERLKH 594

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  218 bits (556), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 148/546 (27%), Positives = 244/546 (44%), Gaps = 16/546 (2%)

Query: 45  VDSFKRPEEEYNGGD-GIHSTHERVSGEDFERLAP--DDSSKHKTLKQNIKPRHVLMISL 101
           +D         N G+ G       VS   +E LA   D+  +H  +K+++K RH+ MI+L
Sbjct: 21  IDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIAL 80

Query: 102 ATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYP 161
              IGTG+ +G    L N GP   L+ Y  + T+++ V QS  E+A  +  ++  F+ + 
Sbjct: 81  GGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT-FIPVTSSFSVFA 139

Query: 162 ALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXX 221
              +  A   +  ++Y L W     LEL      I++W   +   A              
Sbjct: 140 QRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNM 199

Query: 222 XXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RG 276
                         + KVL           + CG AG  G +G  YW +PGA        
Sbjct: 200 FPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISS 258

Query: 277 NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTA 336
           N G  RF G V+ L+NAAF Y G E   +TA E  NP+K++  A +K++ RI+  Y+ + 
Sbjct: 259 NTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSL 318

Query: 337 ALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXX 396
             +G  VPYN P+L  + S  + +SPF+I I + G +V+PH                   
Sbjct: 319 FFIGLTVPYNDPKLTSTDSYVS-SSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVY 377

Query: 397 XXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAI 456
                     + G APK       +G P   +L    FG L ++  S      F WLL I
Sbjct: 378 VGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNI 437

Query: 457 SGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFW 516
           +G++  F W  IS SHVRF +++  +G S D+L Y++    W AYYA          Q +
Sbjct: 438 TGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGF 497

Query: 517 VAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDA 576
            + +P         +F   Y+++ + +  +  +++++R  R+I    +VD+ + R+  ++
Sbjct: 498 TSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRREIES 552

Query: 577 EIMQSE 582
            + + +
Sbjct: 553 VVWEDD 558

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  219 bits (557), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 138/492 (28%), Positives = 231/492 (46%), Gaps = 13/492 (2%)

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           + + +   +K+ +KPRH+ MI+L   IGTG+ +G    L + GP   LI Y  + T+ Y 
Sbjct: 74  EGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYF 133

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
           V QS  E+A  +  ++  F  +    +  AF  +  ++Y   W     LEL      I++
Sbjct: 134 VTQSLGEMAT-FIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQF 192

Query: 199 WNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAG 258
           W  ++   A                              KVL           + CG AG
Sbjct: 193 WTFAVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AG 251

Query: 259 NDGYLGSVYWHDPGAFRG---NNGIN--RFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNP 313
             G +G  YW +PG +     +  +N  RF G V+ L+NAAF Y G E   +TA E +NP
Sbjct: 252 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNP 311

Query: 314 QKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVK 373
           ++++  A  K+ +RI+  Y+++   +G LVP+N P+ L S  +   +SPFVIAI + G K
Sbjct: 312 RRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPK-LKSEDSYISSSPFVIAIENSGTK 370

Query: 374 VVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCV 433
           V+PH                             +   APK+F    + G P   +L +  
Sbjct: 371 VLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAA 430

Query: 434 FGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQS 493
           FG L ++  S   + VF WLL I+ ++  F W  ISL+H+RF + +  +  S ++L +++
Sbjct: 431 FGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKA 490

Query: 494 WTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWY 553
               WGAYY+          Q + A +P    K + +NFF  Y+++ + + +++ +++ +
Sbjct: 491 KFMPWGAYYSAFFISLIIIIQGFTAFAP----KFNVSNFFAAYISVFLFLAIWVVFQIRF 546

Query: 554 RDWRVIIPANEV 565
           R  R I+  N+V
Sbjct: 547 RT-RFILTKNDV 557

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  218 bits (556), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 146/506 (28%), Positives = 236/506 (46%), Gaps = 14/506 (2%)

Query: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
           + K +K+ +K RH+ MI+L   IGTG+ VG    L   GP   LI Y  + T++Y + QS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
             E+A  +  ++     +    +  AF  +  ++Y   W     +E+      I+YW D 
Sbjct: 163 LGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDK 221

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           +                                + KVL           + CGG+ + G 
Sbjct: 222 VPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-HQGP 280

Query: 263 LGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317
           +G  YW +PGA+       +    RF G V+ L+NAAF Y G E   +TA E  NP+K++
Sbjct: 281 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 340

Query: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377
             A  K+V+RI+  Y+M+   +G LVPYN P L  S SA   +SPFVI+I + G   +P 
Sbjct: 341 PRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSAS-SAVIASSPFVISIQNAGTYALPD 399

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437
                                        + G APK F YV ++G P   +L +   GLL
Sbjct: 400 IFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLL 459

Query: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497
            F+  +    T F WL+ IS L+ L  W  ISL+H+RF +++  +G S D+L +++    
Sbjct: 460 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMP 519

Query: 498 WGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWR 557
           +GAYYA          Q + A  P        ++FF +Y+++ +L  ++ G +L+Y+  R
Sbjct: 520 YGAYYAAFFVTVIIFIQGFQAFCP-----FKVSDFFTSYISLILLAVVFTGCQLYYKC-R 573

Query: 558 VIIPANEVDLVSHRKIFDAEIMQSEQ 583
            I    ++D+ + R+  +A I + ++
Sbjct: 574 FIWKLEDIDIDTDRREIEAIIWEDDE 599

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  216 bits (551), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 158/574 (27%), Positives = 264/574 (45%), Gaps = 33/574 (5%)

Query: 5   EMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHS- 63
           E  NI+  ++G  E  +S  ++KE               FVD      E+Y+G +   + 
Sbjct: 3   ETVNIQMSKEGQYE-INSSSIIKE-------------EEFVD------EQYSGENVTKAI 42

Query: 64  THERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPA 123
           T ER   +D  +       + + +K+ +K RH+ MI+L   IGTG+++G G  L + GP 
Sbjct: 43  TTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPV 102

Query: 124 SLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLC 183
             LI Y  + T++Y V QS  E+ + +  ++  F+ +    +  A   +  ++Y L W  
Sbjct: 103 GALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCF 161

Query: 184 ILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXX 243
              LEL      I+YW +++   A                            + KV+   
Sbjct: 162 TFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALL 221

Query: 244 XXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYG 298
                   V CG   +DG +G  YW +PGA+       +    RF G V+ L+NAAF Y 
Sbjct: 222 GFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQ 281

Query: 299 GAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAAT 358
           G E   +TA E  NP+K++  A KK+V RI+  Y+++   +G LVPYN P+L   G   +
Sbjct: 282 GTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVS 341

Query: 359 HASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYV 418
            +SPF+I+I + G KV+P                              +   AP+  + V
Sbjct: 342 -SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNV 400

Query: 419 DRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRS 478
            R G P   +L + VFG L F+  S      F WLL I+G++  F W  IS SH+RF ++
Sbjct: 401 TRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQA 460

Query: 479 MIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLA 538
           +  +G S D+L Y++    + AYYA          Q + A +P         +F   Y++
Sbjct: 461 IRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT----FQPIDFVAAYIS 516

Query: 539 MPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRK 572
           + + + ++L +++W++  R++    ++D+ S R+
Sbjct: 517 IFLFLAIWLSFQVWFKC-RLLWKLQDIDIDSDRR 549

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  215 bits (547), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 140/483 (28%), Positives = 223/483 (46%), Gaps = 17/483 (3%)

Query: 80  DSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCV 139
           +      +K+ +KPRHV MISL   IGTG+ +G    + N GP   L+ Y  V+TM YCV
Sbjct: 42  EKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCV 101

Query: 140 IQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW 199
            QS  E+A  +  ++  F  + +  V  A   +  ++Y L W     LE+      I YW
Sbjct: 102 TQSLGEMAT-FIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW 160

Query: 200 NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGN 259
           +D++   A                            + KV+           V CGG+  
Sbjct: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-K 219

Query: 260 DGYLGSVYWHDPGAFRGNNGI-------NRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQN 312
            G +G  YW DPG +    GI        +F G V+ L+ AAF + G E   +TA E +N
Sbjct: 220 LGRIGFRYWKDPGPW--GVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKN 277

Query: 313 PQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAA-THASPFVIAIASHG 371
           P++++  A   + +RI+  Y+ +  ++G LV Y+ P+L+  GS    +ASPFV+AI + G
Sbjct: 278 PRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAG 337

Query: 372 VKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVS 431
            KV+P                                G AP   +    RG P   +L +
Sbjct: 338 TKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLAT 397

Query: 432 CVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGY 491
            +FG L ++  S K  +VF WLL+I+ +S  FTW  IS+SH+RF + +  +G S D+L +
Sbjct: 398 SMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPF 457

Query: 492 QSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKL 551
           ++    +GAYYA          Q + A +P       A +F   Y++  I + ++L ++ 
Sbjct: 458 KAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIFVVIWLLFQF 512

Query: 552 WYR 554
            ++
Sbjct: 513 LFK 515

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  216 bits (550), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 147/506 (29%), Positives = 233/506 (46%), Gaps = 14/506 (2%)

Query: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
           + K +++ +K RH+ MI+L   IGTG+ VG    L N GP   LI Y  + T++Y V QS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
             E+A  +  ++     +    +  AF  S  ++Y   W     +E+      I+YW   
Sbjct: 162 LGEMAT-FIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTK 220

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           +                                + KVL           + CGG+   G 
Sbjct: 221 VPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQGP 279

Query: 263 LGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317
           +G  YW +PGA+       +    RF G V+ L+NAAF Y G E   +TA E  NP+K++
Sbjct: 280 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 339

Query: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377
             A  K+V+RI+  Y+M+   +G LVPY  P L  S SA   +SPFVI+I + G   +P 
Sbjct: 340 PRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSAS-SAVIASSPFVISIQNAGTYALPD 398

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437
                                        + G APK F YV ++G P   +L +   GLL
Sbjct: 399 IFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLL 458

Query: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497
            F+  +    T F WL+ IS L+ L  W  ISLSH+RF +++  +G S D+L +++    
Sbjct: 459 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMP 518

Query: 498 WGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWR 557
           +GAYYA          Q + +  P         +FF +Y+++ +L  ++ G +L+Y+  R
Sbjct: 519 YGAYYASFFVTVIIFIQGFQSFCP-----FRVADFFTSYISLILLAVVFTGCQLYYKC-R 572

Query: 558 VIIPANEVDLVSHRKIFDAEIMQSEQ 583
            I    ++D+ S R+  +A I + ++
Sbjct: 573 FIWKLEDIDIDSDRREIEAIIWEDDE 598

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  215 bits (548), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 140/480 (29%), Positives = 216/480 (45%), Gaps = 15/480 (3%)

Query: 87  LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASEL 146
           +K+ +KPRH+ MI+L   IGTG+ +G    + N GP   LI Y  + T+++ V QS  E+
Sbjct: 102 VKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEM 161

Query: 147 AIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPD 206
           A  +  ++  F  + +  V   F  +  ++Y   W     LEL      I++W   +   
Sbjct: 162 AT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLA 220

Query: 207 AXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSV 266
           A                            + KV+           + CG AG  G +G  
Sbjct: 221 AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPVGFR 279

Query: 267 YWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSAS 321
           YW  PG +       +    RF G V+ L+NAAF Y G E   +TA E  NP+KS+  A 
Sbjct: 280 YWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 339

Query: 322 KKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXX 381
           KK+  RI+  Y+++   +G LVPYN P+ L S  +   ASPF+IAI + G KV+PH    
Sbjct: 340 KKVSVRILLFYILSLFFIGLLVPYNDPK-LSSTDSYVSASPFIIAIQNSGTKVLPHIFNA 398

Query: 382 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVA 441
                                        APK F    R G P   +L +  FG L ++ 
Sbjct: 399 VILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYME 457

Query: 442 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAY 501
            S   +  F WLL I+G++  F W SIS+SH+RF +++  +G S D+L Y++      AY
Sbjct: 458 TSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAY 517

Query: 502 YAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRD--WRVI 559
           Y           Q + A +P    K D+  F   Y++  + + +Y+  + ++R   WR +
Sbjct: 518 YGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL 573

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  214 bits (546), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 160/561 (28%), Positives = 256/561 (45%), Gaps = 29/561 (5%)

Query: 48  FKRP--EEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGI 105
           FK P  EEE    D   +     S ++ +    D  ++   LK+ +K RHV MI++   +
Sbjct: 27  FKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMIAIGGSL 86

Query: 106 GTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLV 165
           GTG+L+G G SL   GP S LI YA V  +++  +    E+A  Y  L G F +Y +   
Sbjct: 87  GTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGEMAT-YIPLDG-FTSYASRYC 144

Query: 166 DKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS--INPDAXXXXXXXXXXXXXXXX 223
           D A  F+V + Y  ++  + P +L  A++ I+YW D   +NP                  
Sbjct: 145 DPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFG 204

Query: 224 XXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFR-------G 276
                      ++ KVL+          +  GG  +   LG  YW  PG+F+       G
Sbjct: 205 VRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITG 264

Query: 277 NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTA 336
           + G  RF   V+V V A +AY G E + + AAE QNP+KSI  A K  +YRI+  YL++ 
Sbjct: 265 DTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISI 322

Query: 337 ALLGFLVPYNSPELLGSGSAATH--ASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXX 394
            LLG  V Y+ P L+ + +++T   ASPFV+AI + G+  +PH                 
Sbjct: 323 FLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINALPHIINACVLVFVFSACNSD 382

Query: 395 XXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLL 454
                           APK+F   +R G P   L VS +F LL ++  S     +F + +
Sbjct: 383 LYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFV 442

Query: 455 AISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXX-XXXXXXG 513
            +  +  + +W SI ++++ F R++  QG       Y +    +GA+++           
Sbjct: 443 NVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIK 502

Query: 514 QFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKI 573
            F V +    +++ D  NF   Y+ +P+    Y GYK  Y+  +VI P  +VDL + +  
Sbjct: 503 NFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT-KVIDPL-KVDLYTFKAA 556

Query: 574 FDAE-----IMQSEQLEEKEQ 589
            D E     +  +E+ E  +Q
Sbjct: 557 IDQEEEDGKMADAEKAERIKQ 577

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  214 bits (546), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 169/587 (28%), Positives = 263/587 (44%), Gaps = 31/587 (5%)

Query: 24  EVVKE--TSPRSEGSRDGLFHRFVDS--FKRPEEEYNGGDGIHSTHERVSGED-FERLAP 78
           EV+ E  TS R E   D    + VDS  F   E E    D  ++     S ED  +    
Sbjct: 5   EVLTEETTSDRYEEYFDP--QKKVDSKTFPTQERELLHDDLENNISLSTSAEDQNDSYNV 62

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           D  ++   LK+ ++ R V M+++   +GTG+L+G G SL   GP S+LI YA V  +++ 
Sbjct: 63  DGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFF 122

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
            + S  E+A  Y  L G F +Y     D A  F+V + Y  ++  + P +L  A++ I+Y
Sbjct: 123 TMASLGEMAS-YIPLDG-FTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQY 180

Query: 199 W--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGG 256
           W   + +NP                             ++ KVL+          +  GG
Sbjct: 181 WIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGG 240

Query: 257 AGNDGYLGSVYWHDPGAFR-------GNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309
             N   LG  +W  PGAF        G+ G  +F   V+V V A FAY G E   +   E
Sbjct: 241 GPNHDRLGFRHWKHPGAFNNYSPAITGDTG--KFVAFVSVFVYATFAYLGTELVGIVVGE 298

Query: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATH--ASPFVIAI 367
            +NP+KS+  A K  +YRII  YL++  LLG  V Y+ P LL + + +T   ASPFV+AI
Sbjct: 299 ARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAI 358

Query: 368 ASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRC 427
            + G+KV+PH                                 APK+F   +R G P   
Sbjct: 359 VNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYS 418

Query: 428 LLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLD 487
           L +S +F LL +++ S     +F + + +  +  L +W  I ++++ F R++  QG    
Sbjct: 419 LGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKS 478

Query: 488 ELGYQSWTGVWGAYYAXXX-XXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLY 546
              Y +    +GAY+A            F V +     ++ D   F   Y+ +P+    Y
Sbjct: 479 TFSYVAPGQRYGAYFALFFCSLIALIKNFTVFL----GHQFDYKTFITGYIGIPVFFISY 534

Query: 547 LGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQS--EQLEEKEQLR 591
            GYKL Y+  ++I P  EVDL + +   D E      E +  KE+++
Sbjct: 535 FGYKLIYKT-KIIDPL-EVDLYTFKAAIDQEEEDGKLEDIARKERIK 579

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  212 bits (539), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 141/506 (27%), Positives = 235/506 (46%), Gaps = 14/506 (2%)

Query: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
           + +T+++ +K RH+ MI+L   IGTG+ +G    L N GP   LI Y  ++T+ Y V QS
Sbjct: 23  EAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
             E+A  +  ++  F  +    V  AF  +  ++Y   W     LEL      I++W  +
Sbjct: 83  LGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           +   A                              KV+           + C GAG  G 
Sbjct: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC-GAGVTGP 200

Query: 263 LGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317
           +G  YW  PGAF       +    RF G V+ L+NAAF + G E   +TA E  NP+K++
Sbjct: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260

Query: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377
             A KK+V+RI+  Y+++   +G LVPY+  +L  + S  + ASPF+IAI + G  V+PH
Sbjct: 261 PRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVS-ASPFIIAIENSGTHVLPH 319

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437
                                            AP + +   + G P   +LV+ +FG L
Sbjct: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379

Query: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497
            ++  S   +  F WLL I+G++  FTW  ISLSH+RF +++ ++G S D+L +++    
Sbjct: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439

Query: 498 WGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWR 557
             AYY           Q + +  P   N +D   F   Y+++ + I +++ ++ W+R  R
Sbjct: 440 GLAYYGVFFMTLIIIIQGFTSFCP--WNGID---FLTAYISVFMFIAIWIAFQAWFRC-R 493

Query: 558 VIIPANEVDLVSHRKIFDAEIMQSEQ 583
           +I    +VD+ + R+  +  +   ++
Sbjct: 494 LIWRVEDVDIDTDRRAVEEAVWIEQE 519

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  212 bits (540), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 157/564 (27%), Positives = 258/564 (45%), Gaps = 36/564 (6%)

Query: 56  NGGDGIHSTHE----RVSGEDFERLAPDDSSKH-------KTLKQNIKPRHVLMISLATG 104
           N  D I +  E     +  E  E +A DD+++        + LK+++K RHV MI++   
Sbjct: 20  NHSDNIDNKKEPFQIDIEKESTESVALDDTNEQFDGKCSDQRLKKDLKARHVSMIAIGGS 79

Query: 105 IGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALL 164
           +GTG+L+G G SL   GP S+LI Y+ V  +++ V+    E+A  Y  L  GF +Y +  
Sbjct: 80  LGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMA-AYIPLD-GFTSYASRY 137

Query: 165 VDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW--NDSINPDAXXXXXXXXXXXXXXX 222
            D A  F+V + Y +++  + P +L  A++ I+YW   + +NP                 
Sbjct: 138 CDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTF 197

Query: 223 XXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRG-----N 277
                       ++ KV++          +  GG      LG  YW  PGAF+      +
Sbjct: 198 GVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIH 257

Query: 278 NGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAA 337
             I RF   V+  V   F Y G E + + AAE +NP+K+I  A K  ++RII  Y++T  
Sbjct: 258 GDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITIF 317

Query: 338 LLGFLVPYNSPELLGSGSAATH--ASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXX 395
           LLG  V  N P LL + + +T   ASPFV+AI + G++ +PH                  
Sbjct: 318 LLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSDL 377

Query: 396 XXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLA 455
                          APK+F   +R G P   L V+ +F LL +++ S     +F + + 
Sbjct: 378 YVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVN 437

Query: 456 ISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXX-XXXXXXGQ 514
           +  ++ + TW SI ++++ F R++  QG       Y +    +GAY++            
Sbjct: 438 VVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKN 497

Query: 515 FWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIF 574
           F V +    ++K D  NF   Y+ +P+    Y GYK + +  ++  P  EVDL S +   
Sbjct: 498 FTVFL----NHKFDYRNFITGYIGLPLFFICYFGYK-FVKKTKIRKP-EEVDLFSFKAAI 551

Query: 575 DAEIMQSEQLEEKEQLRHASWTKR 598
           D E       EE  +++ A+  +R
Sbjct: 552 DQE-------EEDGRIKDAATAER 568

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  212 bits (539), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 155/553 (28%), Positives = 255/553 (46%), Gaps = 26/553 (4%)

Query: 52  EEE-----YNGGDGIHSTHERVSGE-----DFERLAPDDSSKHKTLKQNIKPRHVLMISL 101
           EEE     Y+G D    T E V+G+     D  +       K   +K+ +K RH+ MI+L
Sbjct: 25  EEELICARYDGQD----TEEAVAGKSSINNDSAKETETSPRKGGEVKRKLKQRHIGMIAL 80

Query: 102 ATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYP 161
              IGTG+++G G  L + GP   LI Y  + T++Y V QS  E+A  +  ++  F+ + 
Sbjct: 81  GGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMAT-FIPVTSSFSVFA 139

Query: 162 ALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXX 221
              +  A   +  ++Y L W     LEL      I+YW D++   A              
Sbjct: 140 QRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAVPLVAWIVIFWCLLTLMNM 199

Query: 222 XXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RG 276
                         + KV+           + CG   + G +G  YW +PGA+       
Sbjct: 200 FPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGIISK 259

Query: 277 NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTA 336
           N    RF G V+ L+NAAF Y G E   +TA E  NP++++  A KK+V RI+  Y+++ 
Sbjct: 260 NKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYILSL 319

Query: 337 ALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXX 396
             +G LVPYN P+L   G+  + +SPF+I+I + G KV+P                    
Sbjct: 320 FFIGLLVPYNDPKLDSEGTFVS-SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVY 378

Query: 397 XXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAI 456
                     +   AP+  + V + G P   +L +  FG L F+  S     VF WLL I
Sbjct: 379 IGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNWLLNI 438

Query: 457 SGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFW 516
           +G++  F W  ISLSH+RF +++  +G S D+L Y++    + AYYA          Q +
Sbjct: 439 TGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALIVLIQGF 498

Query: 517 VAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDA 576
            A +P         +F   Y+++ + I ++L +++W++  R +    +VD+ S R+  + 
Sbjct: 499 TAFAP----TFQPIDFIAAYISVFLFIAIWLLFQVWFKC-RFVWKLQDVDIDSDRRDIEE 553

Query: 577 EIMQSEQLEEKEQ 589
           ++    + + + Q
Sbjct: 554 QVWIEPECKTRWQ 566

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  212 bits (539), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 157/553 (28%), Positives = 254/553 (45%), Gaps = 23/553 (4%)

Query: 63  STHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGP 122
           S  + +S ++   L  D       LK+ ++ RHV MI++   +GTG+L+G G SL   GP
Sbjct: 32  SNQDDISSQE-SHLNIDGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGP 90

Query: 123 ASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWL 182
            S+LI Y+ V  ++Y V+    E+A  Y  L G F +Y +   D A  F+V + Y  ++L
Sbjct: 91  VSILIAYSFVGFLVYIVMTCLGEMAT-YIPLDG-FTSYASRYCDPALGFAVGYSYLFKYL 148

Query: 183 CILPLELVTASMTIKYW--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVL 240
            I P +L  A++ ++YW   + +NP                             ++ KVL
Sbjct: 149 IITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVL 208

Query: 241 MXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFR-------GNNGINRFKGLVAVLVNA 293
           +          +  GG  +   LG  ++ DPGAFR       G+ G  +F   VAV V A
Sbjct: 209 VMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKG--KFVSFVAVFVYA 266

Query: 294 AFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGS 353
            FAY G E   + AAE +NP++++  A K  +YRI+  YL+T  LLG  V YN P LL +
Sbjct: 267 LFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQA 326

Query: 354 GSAATH--ASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFA 411
              +T   ASPFV+AI + G+ V+PH                                 A
Sbjct: 327 KKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKA 386

Query: 412 PKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLS 471
           PK+F   ++ G P   L++  +F LL ++  S     VF + + +  +  L +W +I ++
Sbjct: 387 PKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILIT 446

Query: 472 HVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXX-XXXXXXGQFWVAISPVGSNKLDAN 530
           ++ F R++  QG     L Y +     GAY+A            F V +     +K D  
Sbjct: 447 YIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL----GHKFDYK 502

Query: 531 NFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQL 590
           NF   Y+ +P+ I  + GYK + R  + + P  E DL + +++ D E  + +  +  ++ 
Sbjct: 503 NFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKELIDLEEEEGKLWDAAQKE 560

Query: 591 RHASWTKRAAEFW 603
           +  S  K    F+
Sbjct: 561 KMESSPKNFKWFY 573

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  211 bits (537), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 138/500 (27%), Positives = 229/500 (45%), Gaps = 13/500 (2%)

Query: 60  GIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHN 119
           G H +H  VSG++ E        +   +K+ +K RH+ MI+L   IGTG+ +G    L N
Sbjct: 63  GSHGSHS-VSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKN 121

Query: 120 GGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCL 179
            GP   LI Y  ++T+++ V QS  E+A  +  ++  F  + +  +  +   +  ++Y  
Sbjct: 122 AGPVGSLIAYLFMATIVFSVTQSLGEMAT-FIPVTSSFTVFSSRFISPSIGAANGYMYWF 180

Query: 180 QWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKV 239
            W     LEL      I++W D++   A                            + KV
Sbjct: 181 SWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKV 240

Query: 240 LMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAA 294
           +           + CG AG  G +G  YW +PG +            RF G V+ L+NAA
Sbjct: 241 IAIMGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAA 299

Query: 295 FAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSG 354
           F Y G E   +TA E  NP+K++  A KK+ +RI+  Y+++   +G LVP++ P+L  S 
Sbjct: 300 FTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLS-SD 358

Query: 355 SAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKL 414
            +   +SPF+IAI + G KV+PH                             +   AP+ 
Sbjct: 359 DSYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRW 418

Query: 415 FNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVR 474
           F    + G P   +L +  FG L F+  S      F WLL I G++  F W  IS++HVR
Sbjct: 419 FGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVR 478

Query: 475 FRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFE 534
           F +++  +G S D+L +++    W AYYA          Q + A +P      + ++F  
Sbjct: 479 FIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAP----TFNGSDFVA 534

Query: 535 NYLAMPILIGLYLGYKLWYR 554
            Y+++ +   L++ ++L++R
Sbjct: 535 AYISVFLFFFLWVSFQLYFR 554

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  210 bits (535), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 146/507 (28%), Positives = 235/507 (46%), Gaps = 22/507 (4%)

Query: 83  KHK--TLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140
           KH+   LK+ ++ RHV MI++   +GTG+L+G G SL + GP S+LI Y+ V  ++Y V+
Sbjct: 44  KHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVM 103

Query: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW- 199
               E+A  +  L G F +Y +  VD A  F+V + Y  ++  + P +L   +M +++W 
Sbjct: 104 SCLGEMAA-FIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161

Query: 200 -NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAG 258
             D +NP                             ++ KVL+          +  GG  
Sbjct: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 221

Query: 259 NDGYLGSVYWHDPGAFR-------GNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQ 311
           N    G  +W DPGAF+       G+ G  +F    +V   A FAY G E   + AAE +
Sbjct: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKG--KFVSFASVFALALFAYTGTELCGIVAAEAK 279

Query: 312 NPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATH--ASPFVIAIAS 369
           NP++S+  A K  +YRI+  Y++T  LLG  V YN P LL +   AT   ASPFV+AI +
Sbjct: 280 NPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIEN 339

Query: 370 HGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLL 429
             + V+PH                               G AP++F   ++ G P   L 
Sbjct: 340 ASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLG 399

Query: 430 VSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDEL 489
           +S +F LL ++  S     VF + + +  +  L +W +I ++++RF +++ VQ      L
Sbjct: 400 LSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSL 459

Query: 490 GYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGY 549
            Y +    W  Y A          + +        +K D   F   Y+ +P+ +  Y+GY
Sbjct: 460 SYTAAFQPWSTYVALFFCCLIGLIKNYTVFL---GHKFDYKTFISGYIGIPVYLICYVGY 516

Query: 550 KLWYRDWRVIIPANEVDLVSHRKIFDA 576
           K+ YR  ++I P  +VDL + +   DA
Sbjct: 517 KVVYRT-KLIKP-EDVDLYTFKDAIDA 541

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  209 bits (533), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 152/562 (27%), Positives = 256/562 (45%), Gaps = 13/562 (2%)

Query: 34  EGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHK-TLKQNIK 92
           EG R+      +   +  + +Y   D   +     S E+      + S + +  +++ +K
Sbjct: 12  EGKREANSAPTIKEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSPRSRGEVQRKLK 71

Query: 93  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTS 152
            RH+ MI+L   IGTG+++G G  L + GP   LI Y  + T++Y V QS  E+A  +  
Sbjct: 72  ERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMAT-FIP 130

Query: 153 LSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXX 212
           ++  F+ +    +  A   +  ++Y L W     LEL      I+YW  ++   A     
Sbjct: 131 VTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLAAWIVIF 190

Query: 213 XXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPG 272
                                  + KV+           + CG    DG +G  YW +PG
Sbjct: 191 WCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPG 250

Query: 273 AF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYR 327
           A+       N    RF G V+ L+NAAF Y G E   +TA E  NP+K++  A KK+V R
Sbjct: 251 AWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIR 310

Query: 328 IIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXX 387
           I+  Y+++   +G LVPYN P+L   G+  + ASPF+I+I + G KV+P           
Sbjct: 311 ILVFYILSLFFIGLLVPYNDPKLDSDGTFVS-ASPFMISIENSGTKVLPDIFNAVVLITI 369

Query: 388 XXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEE 447
                              +   APK  + V R G P   +L++ +FG L F+  S    
Sbjct: 370 FSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGSG 429

Query: 448 TVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXX 507
             F WLL I+G++  F W  IS SH+RF +++  +G S D+L Y++    + AYYA    
Sbjct: 430 KAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFFI 489

Query: 508 XXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDL 567
                 Q + A +P         +F   Y+++ +   ++L ++LW++  R+I    ++D+
Sbjct: 490 ALIVLIQGFTAFAPT----FQPVDFVAAYISVFLFAIIWLSFQLWFKC-RLICKLQDIDI 544

Query: 568 VSHRKIFDAEIMQSEQLEEKEQ 589
            S R+  + ++    + + + Q
Sbjct: 545 DSDRREIEEQVWIEPECKTRWQ 566

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  209 bits (532), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 146/566 (25%), Positives = 250/566 (44%), Gaps = 28/566 (4%)

Query: 30  SPRSEGSRDGLFHRFVDSFKR----PEEEYNGG----DGIHSTHERVSGEDFERLAPDDS 81
           S +    +  L   +V  + R    P +E +G     D  +   + V GE  E       
Sbjct: 16  SSKENTDKPSLNETYVKEYDRSISSPPKENDGYGYRVDNEYDVDDSVDGEKGE------- 68

Query: 82  SKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQ 141
            +   +K+ +KPRH+ MI+L   IGTG+ VG  + L N GP  +LI Y  ++T+ + V+Q
Sbjct: 69  VRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQ 128

Query: 142 SASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWND 201
           S  E+A  Y  ++  F+ +    +  AF  +  ++Y   W     LEL      ++YW  
Sbjct: 129 SLGEMA-TYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTF 187

Query: 202 SINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDG 261
            +   A                              KV+           + C GAG  G
Sbjct: 188 KVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVC-GAGKTG 246

Query: 262 YLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 316
            +G  YW    AF       N    RF G V+ L+NAAF Y G E   +TA E  NP+K+
Sbjct: 247 PVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 306

Query: 317 IRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVP 376
           +  + K+ ++RI+  Y+ +   +G LVP+N   L  S S A  +SPF++AI + G K +P
Sbjct: 307 VPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAA-SSPFILAIKNSGTKALP 365

Query: 377 HXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGL 436
                                             AP +     + G P   +L +   G 
Sbjct: 366 DIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGA 425

Query: 437 LCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTG 496
           L ++  S     VF WL+ I+G++  F+W+ IS SH+RF +++  +G S ++L +++   
Sbjct: 426 LAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFM 485

Query: 497 VWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDW 556
            W A Y+          Q +   +P       A++F  +Y+++ +   ++  +++W+R  
Sbjct: 486 PWIAIYSFFFMTLIILVQGFTCFTP----HFQASDFVASYISVGLFFVIWAVFQIWFRC- 540

Query: 557 RVIIPANEVDLVSHRKIFDAEIMQSE 582
            +++P  E+D+ + R+  DAE+ + E
Sbjct: 541 PLLVPIAEIDIDTDRRDVDAEVWEDE 566

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  209 bits (531), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 137/524 (26%), Positives = 233/524 (44%), Gaps = 19/524 (3%)

Query: 69  SGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIG 128
           +GE  E    +   +   +K+ +K RH+ MI+L   IGTG+ +     L   GP   L+ 
Sbjct: 37  TGEFPEDHTEEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLA 96

Query: 129 YAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLE 188
           Y  + T++Y + QS  E+A  +  ++     +    +  AF  +  ++Y   W     +E
Sbjct: 97  YIFIGTVVYSITQSLGEMAT-FIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVE 155

Query: 189 LVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXX 248
           L      I+YW D +   A                            + KVL        
Sbjct: 156 LSVVGQIIQYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIY 215

Query: 249 XXXVNCGGAGNDGYLGSVYWHDPGAF--RGNNGINR-------FKGLVAVLVNAAFAYGG 299
              + CGG+      G +     G    RG    +R       F G V+ L+ AAF Y G
Sbjct: 216 AFIIVCGGSKQ----GPIGLPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQG 271

Query: 300 AEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATH 359
            E   +TA E  NP+K++  A  K+ +RI+  Y+ +   +G LVPY+ P L    S   +
Sbjct: 272 TELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVN 331

Query: 360 ASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVD 419
           ASPFVI+I + G K++P                                G APK   +V 
Sbjct: 332 ASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVT 391

Query: 420 RRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSM 479
           ++G P   +L++ + GL+ F+  +    T F WL+ IS L+ L  W  ISL+H+RF + +
Sbjct: 392 KQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCL 451

Query: 480 IVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAM 539
             +G S D+L +++    W AYYA          Q + A +P    K D   FF +Y+++
Sbjct: 452 KHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTP----KFDVTTFFTSYISL 507

Query: 540 PILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQ 583
            +++ +++G +++Y+  R +    ++D+ S R+  DA + + ++
Sbjct: 508 FLMLLVFIGCQIYYKC-RFLWAVEDIDIDSDRREIDAIVWEEDE 550

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  208 bits (529), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 138/529 (26%), Positives = 239/529 (45%), Gaps = 18/529 (3%)

Query: 52  EEEYNGGDGIHSTHE--RVSGEDFERLAPDDSSKHK-TLKQNIKPRHVLMISLATGIGTG 108
           ++E+NG   + S  E  R S  + E    D  S ++  LK+ +  RH+ +I+L   IGTG
Sbjct: 13  KQEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQLIALGGCIGTG 72

Query: 109 MLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKA 168
           + VG   +L   GPA L + + I+STM+YC++ + +E+ + Y    G         VD +
Sbjct: 73  LFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEM-VCYLPQQGSVPELVTRYVDPS 131

Query: 169 FAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXX 228
             F+  W Y   +  ++  EL  A+  ++YW D +                         
Sbjct: 132 LGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLNFSAVRFYG 191

Query: 229 XXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF----RGNNGINRFK 284
                  + K++           +  GGA N   +G  YW +PGAF     G N + RF 
Sbjct: 192 ESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITGGN-LGRFL 250

Query: 285 GLVAVLVNAAFAY-GGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLV 343
            L   ++ +AFA+    E   L   E ++ +++I  AS++ +YRII  YL ++ ++G +V
Sbjct: 251 DLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLMIGVIV 310

Query: 344 PYNSPELLGS---GSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXX 400
             N   LL +         +SPFV  IA+ G+ V+ H                       
Sbjct: 311 AKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFFYASSR 370

Query: 401 XXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLS 460
                 +QG APK+F+ ++R G P   + +  +   L ++  S     VF WL  I  +S
Sbjct: 371 SILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSNICTIS 430

Query: 461 ELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAIS 520
               WF I ++++RFR++++   R LD + Y+S    + AY+             +V   
Sbjct: 431 GFIGWFLIGVAYIRFRKAILFN-RLLDRIPYRSPLQPFSAYFFTIVVAIITLTNGYVVFI 489

Query: 521 PVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVS 569
                + D  +F  +Y+++PI +  YLG+K  Y+  R  IP +++D+++
Sbjct: 490 ---KGRWDYKDFLTSYISLPIFLAFYLGHKTIYKT-RFCIPVDQIDVIT 534

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  209 bits (531), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 147/537 (27%), Positives = 237/537 (44%), Gaps = 35/537 (6%)

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           D  ++   LK+N+K RHV MI++   +GTG+L+G G SL   GP SL I Y+ V  +++ 
Sbjct: 56  DGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFF 115

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
            +    E+A  +  L G F +Y +  VD A  F+V + Y  ++L +   +L   +M ++Y
Sbjct: 116 TMSCLGEMAA-FIPLDG-FTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQY 173

Query: 199 W--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGG 256
           W   D++NP                             ++ KVL+          +  GG
Sbjct: 174 WVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGG 233

Query: 257 AGNDGYLGSVYWHDPGAFR--------GNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAA 308
             N   LG  YW DPG+F+         +    +F    +  V A F Y G E + + AA
Sbjct: 234 GPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAA 293

Query: 309 EQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATH--ASPFVIA 366
           E QNP+K+I  A K  +YRII  Y++T  LL   V YN P LL +   +T   ASPFV+A
Sbjct: 294 EAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVA 353

Query: 367 IASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVR 426
           I + G+ ++PH                                 APK F   ++ G P  
Sbjct: 354 IENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYW 413

Query: 427 CLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSL 486
            L  S  F  L ++  S     VF + +    +  + +W  I ++++ F ++   QG   
Sbjct: 414 SLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDK 473

Query: 487 DELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSN-------KLDANNFFENYLAM 539
               Y +    +GAY+A           F+  +  +  N       + D  NF   Y+ +
Sbjct: 474 SNFTYVAPWQPYGAYFAL----------FFCCVLALVKNFTVFLGGQFDYKNFITGYIGI 523

Query: 540 PILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQS--EQLEEKEQLRHAS 594
           P+    ++GYK+ Y+  +   P  EVDLV+ + + D E      E  E +E+L++ +
Sbjct: 524 PVFFICFVGYKIVYKT-KTHRP-EEVDLVTLKALIDQEEEDGKIEDAEREERLKNGN 578

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  208 bits (529), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 153/578 (26%), Positives = 256/578 (44%), Gaps = 27/578 (4%)

Query: 21  DSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDD 80
           D++E   ++ PR   S    F     S    +++    + I  T    + ED E +    
Sbjct: 2   DTLESSSQSVPRQRKSGVQTF-----STMSQDDDMKKINIIQQTDASSTTED-EEMLNSG 55

Query: 81  SSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140
           S     +K+ +K RH+ MI+L   IGTG+ +G    L + GP   LI Y  V T+ Y V 
Sbjct: 56  SVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVT 115

Query: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN 200
           QS  E+A  +  ++  F  + +  +  +   +V ++Y   W     LEL      + YW 
Sbjct: 116 QSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT 174

Query: 201 DSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND 260
            ++   A                              KV+           + C GAG  
Sbjct: 175 FAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVC-GAGVT 233

Query: 261 GYLGSVYWHDPGAF-----------RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309
           G +G  YW +PG +             N    RF G    L+NAAF Y G E   +TA E
Sbjct: 234 GPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGE 293

Query: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIAS 369
             NP+K++  A KK+V+RI+  Y+ +   +G LVP++ P+L  S  +   +SPF+IAI +
Sbjct: 294 AANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLS-SDDSYVSSSPFIIAIEN 352

Query: 370 HGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLL 429
            G K++P                              + G APK+ +   ++G P   +L
Sbjct: 353 SGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVL 412

Query: 430 VSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDEL 489
            + VFG+L ++  +   +TVF WL+ I+ ++  + W  I +SH+RF + +  +G S D+L
Sbjct: 413 ATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDL 472

Query: 490 GYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGY 549
            +++      AYYA          Q + A +P      D ++FF  Y+++ +   ++  +
Sbjct: 473 PFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAF 528

Query: 550 KLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEK 587
           +LW++  R I    +VD+ S+R+  D E +  E  E K
Sbjct: 529 QLWFKC-RWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563

>ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]
           {ON} similar to uniprot|Q7LGU1 Saccharomyces cerevisiae
           YPL274W SAM3 High-affinity S-adenosylmethionine
           permease, required for utilization of
           S-adenosylmethionine as a sulfur source; has similarity
           to S-methylmethionine permease Mmp1p
          Length = 585

 Score =  207 bits (526), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 186/350 (53%), Gaps = 10/350 (2%)

Query: 259 NDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIR 318
           + GY+G+ YWHDPG+F  NN +  FK L    V+AAF++GG+E  +LT+ E ++   +I 
Sbjct: 242 SKGYIGTKYWHDPGSF--NNPV--FKNLCNTFVSAAFSFGGSELVLLTSKESKSVS-AIS 296

Query: 319 SASKKLVYRIIGIYLMTAALLGFLVPYNSPELL-GSGSAATHASPFVIAIASHGV--KVV 375
            A+K   +RI   Y+ T  ++G LVPY    LL G       ASPFVIA+++ G   K V
Sbjct: 297 RAAKGTFWRIAIFYITTVVIIGCLVPYTDDRLLNGRSDEDVTASPFVIALSNTGSMGKKV 356

Query: 376 PHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFG 435
                                            G  PK+  Y+DRRGRP+  + +S +FG
Sbjct: 357 SDFMNVVILIAVVSVCNSCVYAASRVIQALGASGQLPKICGYIDRRGRPLVGIAISGIFG 416

Query: 436 LLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWT 495
           LL F+ AS +E  VFTWL A+  +S  FTWF I  S +RFR ++  QGRS D++ Y+S  
Sbjct: 417 LLGFLVASSEESKVFTWLFALCSISSFFTWFCICYSQIRFRMALKYQGRSTDQIAYKSML 476

Query: 496 GVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRD 555
           GV+G             G+ +V+ SPVG  K  A  FFE  L++PI+I +Y+ ++++ +D
Sbjct: 477 GVYGGILGCILNILLIAGEIYVSASPVG-EKSTAEGFFEYCLSIPIMISVYVLHRIYRKD 535

Query: 556 W-RVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604
           W    I  +++DL +   + + E+ + ++ EEK       +  +   F C
Sbjct: 536 WTHWYIKRSDIDLDTGCSVENIELFKEQREEEKIYAATKPFYYKIYRFLC 585

 Score =  101 bits (252), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 96/169 (56%), Gaps = 17/169 (10%)

Query: 41  FHRFVDSFKR----PEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHV 96
             R  DSFK+    P +E +G DG+ S  E++      +L        K L Q    RH+
Sbjct: 32  LKRLKDSFKQSELAPIDEDSGFDGL-SEKEKI------QLKLASQPYEKVLSQ----RHL 80

Query: 97  LMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGG 156
            MI++   +GTG+ +G G SL  G P +LLIG+ +V T ++CV+QSA+EL+  +  +SG 
Sbjct: 81  TMIAIGGTLGTGLFIGLGYSLACG-PGALLIGFLLVGTSIFCVVQSAAELSCQF-PVSGS 138

Query: 157 FNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINP 205
           +  + +  +D++  F+V+  Y L WL   P EL+  S+TI YW+ + NP
Sbjct: 139 YATHVSRFIDQSIGFTVATNYALSWLISFPSELIGCSLTISYWDQTTNP 187

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  206 bits (524), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 133/512 (25%), Positives = 234/512 (45%), Gaps = 13/512 (2%)

Query: 74  ERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVS 133
           E ++ ++  ++  +K+++  RH+ MI+L   IGTG+ +G    L   GP   LI Y  + 
Sbjct: 47  ENVSENEKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLG 106

Query: 134 TMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTAS 193
           T++Y V QS  E+A  +  ++  F  +    +  A   +  ++Y   W     LEL    
Sbjct: 107 TVVYSVTQSLGEMAT-FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVG 165

Query: 194 MTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVN 253
             I++W  ++   A                              KV            + 
Sbjct: 166 QIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIV 225

Query: 254 CGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAA 308
           CG AG  G +G  YW +PG +       N    RF G  + L+NAAF + G E   +TA 
Sbjct: 226 CG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAG 284

Query: 309 EQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIA 368
           E  NP++++  A +K+V+RI+  Y+++   +G LVPY+  +L  S ++   +SPF+IAI 
Sbjct: 285 EAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIE 343

Query: 369 SHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCL 428
           + G K++PH                             + G  PKLF    + G PV  +
Sbjct: 344 NSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAV 403

Query: 429 LVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDE 488
           + + +FG L F+  S   +  F WLL + G++  F+W  IS +H+RF + +  +G S ++
Sbjct: 404 VFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRND 463

Query: 489 LGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLG 548
           L +++    + AYYA          Q + A +P    K D  NFF +Y+++ +    +  
Sbjct: 464 LPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGS 519

Query: 549 YKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQ 580
           ++LW++  R +    ++D+   R+  +  + Q
Sbjct: 520 FQLWFKC-RYVWKLVDIDIDKDRREIEDRVWQ 550

>Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)
          Length = 328

 Score =  199 bits (505), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 117/327 (35%), Positives = 179/327 (54%), Gaps = 8/327 (2%)

Query: 283 FKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFL 342
           FK L    V+AAF++GG+E  +LT+ E +N   +I  A+K   +RI   Y+ T  ++G L
Sbjct: 5   FKNLCNTFVSAAFSFGGSELVLLTSTESKNIS-AISRAAKGTFWRIAIFYITTVVIIGCL 63

Query: 343 VPYNSPELL-GSGSAATHASPFVIAIA---SHGVKVVPHXXXXXXXXXXXXXXXXXXXXX 398
           VPYN   LL GS S    ASPFVIA++   S G KV  +                     
Sbjct: 64  VPYNDSRLLNGSTSEDISASPFVIALSNTGSMGAKV-SNFMNVVILVAVVSVCNSCVYAS 122

Query: 399 XXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISG 458
                     G  P + +Y+DR+GRP+  + +S VFGLL F+ AS KE+ VFTWL A+  
Sbjct: 123 SRLIQALGASGQLPSICSYMDRKGRPLVGIAISGVFGLLGFLVASNKEDEVFTWLFALCS 182

Query: 459 LSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVA 518
           +S  FTWF I +S +RFR ++  QGRS DE+ Y+S  GV+G             G+ +V+
Sbjct: 183 ISSFFTWFCICMSQIRFRMALKAQGRSKDEIAYKSMLGVYGGVLGCVLNALLIAGEIYVS 242

Query: 519 ISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRV-IIPANEVDLVSHRKIFDAE 577
            +PVGS    A  FFE  L++PI+I +Y+ ++++ +DWR   I  +++DL +   I + +
Sbjct: 243 AAPVGSPS-SAKAFFEYCLSIPIMIVVYVAHRIYRKDWRNWYIKRSDIDLDTGCSIENLD 301

Query: 578 IMQSEQLEEKEQLRHASWTKRAAEFWC 604
           + ++++  EKE +    +  +   FWC
Sbjct: 302 LFKAQKEAEKELIASKPFYYKIYRFWC 328

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  205 bits (521), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 148/533 (27%), Positives = 242/533 (45%), Gaps = 24/533 (4%)

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           D   K   LK++++ RHV MI++   +GTG+L+G G +L   GP ++LI Y+I+  +++ 
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
           V+    E+A  Y  L G F +Y     D A  F+V + Y  ++L + P +L  A++ ++Y
Sbjct: 110 VMSCLGEMAA-YIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167

Query: 199 W--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGG 256
           W     +NP                             ++ KVL+          +  GG
Sbjct: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGG 227

Query: 257 AGNDGYLGSVYWHDPGAFRGNNGI-------NRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309
             +   LG  YW DPG F+  +G         +F    +V V A FAY G E   + AAE
Sbjct: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287

Query: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATH--ASPFVIAI 367
            +NP++++  A K  +YRI+  YL T  LLG  V YN P LL +  A T   ASP+V+AI
Sbjct: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAI 347

Query: 368 ASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRC 427
            + G+ V+PH                                 APK+F   +  G P   
Sbjct: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407

Query: 428 LLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLD 487
           L +  +F  L ++  S   ET+F++ + ++ +  L +W SI ++++ F R+  VQG   +
Sbjct: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467

Query: 488 ELGYQSWTGVWGAYYAX-XXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLY 546
            L YQ+      A+ A            F V +     +  D   F   Y+ +P+ I  +
Sbjct: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCF 523

Query: 547 LGYKLWYR-DWRVIIPANEVDLVSHRKIFDAEIMQS--EQLEEKEQLRHASWT 596
           + YK+ ++  W   I +  VDL +++   D E  +   E +  KE+ +   WT
Sbjct: 524 VCYKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWT 573

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  203 bits (516), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 136/487 (27%), Positives = 219/487 (44%), Gaps = 25/487 (5%)

Query: 117 LHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWV 176
           L + GP   LI Y  + T++Y V QS  E+A  +  ++  F+ +    +  A   +  ++
Sbjct: 20  LAHAGPVGALISYIFMGTVIYSVTQSLGEMAT-FIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 177 YCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNT 236
           Y L W     LEL      I+YW D++   A                            +
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 237 CKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLV 291
            KV+           + CG    DG +G  YW +PGA+       +    RF G V+ L+
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 292 NAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL 351
           NAAF Y G E   +TA E  NP+K++  A KK+V RI+  Y+M+   +G LVPYN P+L 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 352 GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFA 411
             GS  + ASPF+I+I + G KV+P                              +   A
Sbjct: 259 SDGSFVS-ASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLA 317

Query: 412 PKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLS 471
           P+  + V + G P   +L + VFG L F+  S      F WLL I+G++  F W  IS S
Sbjct: 318 PRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFS 377

Query: 472 HVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANN 531
           H+RF +++  +G S ++L Y++    + AYYA          Q + A +P         +
Sbjct: 378 HIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAP----SFQPVD 433

Query: 532 FFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEK---E 588
           F   Y+++ + + ++  ++LW++   +I+   +VD+ S R+          ++EE+   E
Sbjct: 434 FVAAYISVFLFVAIWFSFQLWFKC-PIILKLQDVDIDSDRR----------EIEEQVWIE 482

Query: 589 QLRHASW 595
            LR   W
Sbjct: 483 PLRKTKW 489

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  203 bits (517), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 140/506 (27%), Positives = 229/506 (45%), Gaps = 15/506 (2%)

Query: 87  LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASEL 146
           +K+ +K RH+ MI+L   IGTG+ +G    L   GP   LI Y  + T++Y V QS  E+
Sbjct: 73  VKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGEM 132

Query: 147 AIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPD 206
           A  +  ++  F  +    +  +   +  ++Y   W     LEL      I+YW  ++   
Sbjct: 133 A-TFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAVPLA 191

Query: 207 AXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSV 266
           A                              KV+           + C GAG  G +G  
Sbjct: 192 AWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVC-GAGVTGPVGFR 250

Query: 267 YWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSAS 321
           YW +PG +       +    RF G V+ L+N AF Y G E   ++A E  NP+K++  A 
Sbjct: 251 YWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPRAI 310

Query: 322 KKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHXXXX 381
           KK+V+RI+  Y+ +   +G LVPYN  + L +  +   +SPF+IAI + G  V+PH    
Sbjct: 311 KKVVFRILFFYIGSLFFIGLLVPYND-DALNNTDSYVASSPFIIAIKNSGTPVLPHIFNA 369

Query: 382 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVA 441
                                    +   APK+ +   + G P   +LV+ V G L ++ 
Sbjct: 370 VIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAYME 429

Query: 442 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAY 501
            S   +  F WLL I+ ++  FTW  ISLSH+RF +++  +G S D+L +++      AY
Sbjct: 430 TSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGLAY 489

Query: 502 YAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIP 561
           YA          Q + A +P    K   ++F   Y+++ + IG++  +++ +R  R I  
Sbjct: 490 YASFLMFVIIIIQGFTAFAP----KFSGSDFAAAYISIFLFIGIWCLFQIIFRC-RFIHK 544

Query: 562 ANEVDLVSHRKIFDAEIMQSEQLEEK 587
             +VD+ + R+  D E +  E  E K
Sbjct: 545 VEDVDIDTDRR--DIEAVVWEDAEPK 568

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  203 bits (517), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 159/575 (27%), Positives = 260/575 (45%), Gaps = 33/575 (5%)

Query: 45  VDSFKRPEEEYNG-GDGIHSTHERVSGEDFERLAPDDSSKHK--TLKQNIKPRHVLMISL 101
           +D  K P+    G G G+  TH     E  + +  +   KH+   LK++++ RHV MI++
Sbjct: 15  LDELKGPKLAAAGEGRGLRHTHSSTDQEA-QSVDWNYDGKHEGIRLKKDLQARHVSMIAI 73

Query: 102 ATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYP 161
              +GTG+L+G G SL   GP S+LI Y+I+  +++ V+    E+A  Y  L G F +Y 
Sbjct: 74  GGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSCLGEMAA-YIPLDG-FTSYA 131

Query: 162 ALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS--INPDAXXXXXXXXXXXX 219
               D A  F+V W Y  ++L + P +L   ++ I++W  +  ++P              
Sbjct: 132 TRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVI 191

Query: 220 XXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFRG--- 276
                          ++ KVL+          +  GG      LG  YW DPGAF+    
Sbjct: 192 NTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHDRLGFRYWSDPGAFKEYSK 251

Query: 277 -----NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGI 331
                  G+ +F   ++V V A FAY G E   + AAE ++P++++  A K  +YRI+  
Sbjct: 252 KDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVF 311

Query: 332 YLMTAALLGFLVPYNSPELL--GSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXX 389
           YL+T  LLG  V YN P L+   S   +  ASP+V+AI +  + V+P+            
Sbjct: 312 YLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFS 371

Query: 390 XXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETV 449
                              G APKLF   ++ G P   L    +F  L +++ S    T 
Sbjct: 372 ACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTA 431

Query: 450 FTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXX 509
           F + + ++ +  L +W SI ++++ F R+   QG     L Y +    +  + A      
Sbjct: 432 FGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIF 491

Query: 510 XXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYR-DWRVIIPANEVDLV 568
               + + A       ++D   F   Y+ +PI I  ++GYK+ ++  W   IP+ EVDL 
Sbjct: 492 VALIKNFDAFI---GKEVDVPTFITGYIGLPIYIFCFIGYKIVHKTKW---IPSKEVDLF 545

Query: 569 SHRKIFDAEIMQSEQLEE----KEQLRHA--SWTK 597
           + ++  D E  + E + E    KEQL     SW K
Sbjct: 546 TFKEAIDLE--EEECIRERALMKEQLAKGGLSWKK 578

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  202 bits (515), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 142/503 (28%), Positives = 232/503 (46%), Gaps = 13/503 (2%)

Query: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142
           K   +K+ +K RH+ MI+L   IGTG+ +G    L N GP   LI Y  ++T+++ V QS
Sbjct: 93  KEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQS 152

Query: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202
             E+A  +  ++  F  + +  +  A   +  ++Y   W     LEL      I++W  +
Sbjct: 153 LGEMAT-FIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHA 211

Query: 203 INPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGY 262
           +   A                            + KVL           + CG AG  G 
Sbjct: 212 VPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCG-AGVTGP 270

Query: 263 LGSVYWHDPGAFRG---NNGIN--RFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317
           +G  YW +PG +     +  +N  RF G V+ L+NAAF Y G E   +TA E  NP+K++
Sbjct: 271 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 330

Query: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377
             A KK+ +RI+  Y+++   +G LVPY+  E L S  +   ASPF+IAI + G K++PH
Sbjct: 331 PRAIKKVTFRILIFYILSLFFIGLLVPYDD-EKLTSTDSYISASPFIIAIENSGTKILPH 389

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437
                                        +   APK F Y  R G P   +  +  FG L
Sbjct: 390 IFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGAL 449

Query: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497
            F+  S      F WLL I  ++  F W  IS++HVRF +++  +G S D+L +++    
Sbjct: 450 AFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMP 509

Query: 498 WGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWR 557
             AYY+          Q + A +P      + ++F   Y+++ +   L+L ++L++R  +
Sbjct: 510 HLAYYSIFFMTIIIIIQGFTAFAPT----FNGSDFVAAYISIFLFFFLWLCFQLYFRS-K 564

Query: 558 VIIPANEVDLVSHRKIFDAEIMQ 580
           ++    EVD+ + R+  DA I +
Sbjct: 565 LLWTVEEVDIDTDRRDVDAIIWE 587

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  202 bits (513), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 151/532 (28%), Positives = 242/532 (45%), Gaps = 30/532 (5%)

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           D   +   LK+ ++ RHV MI++   +GTG+L+G G SL + GPAS+LI Y+ V  ++Y 
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198
           V+    E+A  +  L  GF +Y +  VD A  F+V + Y  ++  + P +L   +M ++Y
Sbjct: 103 VMACLGEMA-AFIPLD-GFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQY 160

Query: 199 W--NDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGG 256
           W   + +NP                             ++ KVL+          +  GG
Sbjct: 161 WVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGG 220

Query: 257 AGNDGYLGSVYWHDPGAFR-------GNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309
             N    G  YW DPGAF+       G+ G  +F    +V   A FAY G E   + AAE
Sbjct: 221 GPNHDRTGFRYWRDPGAFKPYSEAISGSKG--KFVSFASVFALALFAYTGTELCGIVAAE 278

Query: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATH--ASPFVIAI 367
            +NP++S+  A K  +YRI+  Y+++  LLG  V YN P L+ +   +T   ASPFV+AI
Sbjct: 279 AKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAI 338

Query: 368 ASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRC 427
            + G+ V+PH                                 APK+F   +  G P   
Sbjct: 339 KNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYS 398

Query: 428 LLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLD 487
           L VS +F LL ++  S     +F + + +  +  L +W SI ++++RF +++I Q     
Sbjct: 399 LAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKS 458

Query: 488 ELGY----QSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILI 543
              Y    Q W+     ++            F         +  D   F   Y+ +P+  
Sbjct: 459 GFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFL-------GHTFDYKTFISGYIGIPVYA 511

Query: 544 GLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDA--EIMQSEQLEEKEQLRHA 593
             Y+GYKL +R  ++I P  +VDL + +   DA  E  +  +LE KEQL+ +
Sbjct: 512 ICYVGYKLVHRS-KLIKP-EDVDLYTFKAAIDAEEEEGKLLELERKEQLKSS 561

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  201 bits (510), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 139/539 (25%), Positives = 238/539 (44%), Gaps = 25/539 (4%)

Query: 64  THERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPA 123
           ++ ++SG      + D      TLK+ +K RH+ +I+L   IGTG+ VG   +LH  GPA
Sbjct: 30  SYSQISGPKVS--SSDAPQGDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPA 87

Query: 124 SLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALL----VDKAFAFSVSWVYCL 179
            L   Y I+S ++Y V+ +  E+               + L    VD +  F+  W Y  
Sbjct: 88  GLFTSYCIISVIIYPVMNALGEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYY 147

Query: 180 QWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKV 239
            ++ ++  E   AS  ++YW  ++   A                            + K+
Sbjct: 148 CYVILVAAECTAASGVVQYWTTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKI 207

Query: 240 LMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAA 294
           L           +  GG  +   LG  YW  PGAF      GN G  RF  +   ++   
Sbjct: 208 LCILGLLFVSFILFWGGGPHHDRLGFRYWQKPGAFAYHITSGNTG--RFLDIWTGVIKGG 265

Query: 295 FAY-GGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPEL--- 350
           FA+  G E   LT+AE Q+ +++I+ AS++ VYR+I  Y+ ++  +G +V YN   L   
Sbjct: 266 FAFILGPELVALTSAEAQDARRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTA 325

Query: 351 LGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGF 410
           L  G     +SPFVI I + G+KV+PH                             ++GF
Sbjct: 326 LDQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGF 385

Query: 411 APKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISL 470
           APK+   V+R G P   + ++ +   + ++  S     VFTW   IS +S    W  I +
Sbjct: 386 APKILGRVNRFGVPYAAVALTSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGI 445

Query: 471 SHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDAN 530
           +++RFR+++  Q    + + +++    +G ++             +    P   N    +
Sbjct: 446 AYLRFRKAIFFQNL-YERVPFKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWN---VS 501

Query: 531 NFFENYLAMPILIGLYLGYKLWYRDWRV-IIPANEVDLVSHRKIFDAEIMQSEQLEEKE 588
           +F   Y+ +PI + L++G+KLW R W+   IP  E+D+ +  K  + E   S++ +EK 
Sbjct: 502 DFIAAYVTLPIFLVLWIGHKLWTRTWKTWAIPVPEIDVTTGLKEIEEE---SKECDEKR 557

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  199 bits (505), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 145/562 (25%), Positives = 252/562 (44%), Gaps = 30/562 (5%)

Query: 52  EEEYNGGDGIHSTHERVSGE-DFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGML 110
            ++ N  DG+      +  E D E  A + SS++  LK  ++ RH+ +I+L   IGTG+ 
Sbjct: 22  NDKNNIKDGVSFEKPIIYSEVDIESGAKESSSRN--LKHGLQSRHIQLIALGGTIGTGLF 79

Query: 111 VGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIY-----TSLSGGFNAY-PALL 164
           VG   +L N GPA+L+I Y ++ST++Y ++    E+            S G+ AY  +  
Sbjct: 80  VGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGNDDDDESVGYCAYLVSKY 139

Query: 165 VDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXX 224
           VD++  F+ SW Y   ++ ++  E   AS  ++YW   I                     
Sbjct: 140 VDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSKIPKAVLIFLFLGVIFLLNFLPV 199

Query: 225 XXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGND---GYLGSVYWHDPGAFRG---NN 278
                        K+            + CGGA N+    ++G  YW +P +FR    N 
Sbjct: 200 KFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWKNPSSFRDYVTNG 259

Query: 279 GINRFKGLVAVLVNAAFAY-GGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAA 337
            +  F  +   L+  AFA+  G E   LT++E  + +++I  AS++ VYR++  Y+  A 
Sbjct: 260 SLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIAKASRRFVYRLMFFYIFGAL 319

Query: 338 LLGFLVPYNSPELLGS---GSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXX 394
            +  +VPYN P LL +         +SPFVI I + G+ ++PH                 
Sbjct: 320 SISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITILPHIINFCILTSAMSAGNAF 379

Query: 395 XXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLL 454
                       + G AP++F+ ++R G P   L +S +   L F+  S     VF W  
Sbjct: 380 LFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIACLAFLNCSASSAKVFQWFS 439

Query: 455 AISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQ 514
            IS +S    WF+  ++++RFRR++   G   D L +++   V+  +Y+           
Sbjct: 440 NISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVGILILTN 498

Query: 515 FWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVI---IPANEVDLVSHR 571
            ++ I P   N  D   F   Y+ +P+ + LY G+ ++   WR      P +E+D+V+  
Sbjct: 499 GYMYIIPKFWNYQD---FIAAYITLPVFLVLYFGHIIYSGRWRQRKWWKPVDEIDVVTGL 555

Query: 572 KIFDAEIMQSEQLEEKEQLRHA 593
           +    EI    ++ ++E+  H+
Sbjct: 556 E----EIELKTKIADEERQGHS 573

>Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)
          Length = 348

 Score =  192 bits (487), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 112/317 (35%), Positives = 171/317 (53%), Gaps = 14/317 (4%)

Query: 33  SEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIK 92
           SEG  +  + RF +SFKR E E              +  D E++A   ++    LK  +K
Sbjct: 45  SEGGLNNTWTRFKNSFKRFELE----------ELDPNLTDAEKIA--IATARSPLKHTLK 92

Query: 93  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTS 152
            RH+ MI++   IGTG+ VG+GK+L   GPA +LIG+ +  +M+YC++ +  ELA+I+  
Sbjct: 93  KRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGSMIYCMVMAVGELAVIF-P 151

Query: 153 LSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN-DSINPDAXXXX 211
           +SGGF  Y    +D++F F+V++ Y LQWL  LPLE+V AS+T+ YW  D    D     
Sbjct: 152 VSGGFTTYATRFIDESFGFAVNFNYMLQWLVTLPLEIVAASITVNYWGVDPKYRDGFVAL 211

Query: 212 XXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDP 271
                                     KV+           + CGG    G++G+ YWH+P
Sbjct: 212 FWVVIVSINLFGVKGYGEAEFIFAVIKVITIIGFIIMAVVLVCGGGPQGGFIGAKYWHNP 271

Query: 272 GAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGI 331
           GAF G     +FKG   V + A+F++GG+E   +  +E +NP+KS+  A+K++ +RII  
Sbjct: 272 GAFVGATPGLKFKGFCTVFITASFSFGGSEVVGIAGSEAENPRKSVPGAAKQVFWRIILF 331

Query: 332 YLMTAALLGFLVPYNSP 348
           Y++   L+G LVPYN P
Sbjct: 332 YVICLLLIGMLVPYNDP 348

>Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)
          Length = 349

 Score =  192 bits (487), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 112/317 (35%), Positives = 171/317 (53%), Gaps = 14/317 (4%)

Query: 33  SEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIK 92
           SEG  +  + RF +SFKR E E              +  D E++A   ++    LK  +K
Sbjct: 45  SEGGLNNTWTRFKNSFKRFELE----------ELDPNLTDAEKIA--IATARSPLKHTLK 92

Query: 93  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTS 152
            RH+ MI++   IGTG+ VG+GK+L   GPA +LIG+ +  +M+YC++ +  ELA+I+  
Sbjct: 93  KRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGSMIYCMVMAVGELAVIF-P 151

Query: 153 LSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN-DSINPDAXXXX 211
           +SGGF  Y    +D++F F+V++ Y LQWL  LPLE+V AS+T+ YW  D    D     
Sbjct: 152 VSGGFTTYATRFIDESFGFAVNFNYMLQWLVTLPLEIVAASITVNYWGVDPKYRDGFVAL 211

Query: 212 XXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDP 271
                                     KV+           + CGG    G++G+ YWH+P
Sbjct: 212 FWVVIVSINLFGVKGYGEAEFIFAVIKVITIIGFIIMAVVLICGGGPQGGFIGAKYWHNP 271

Query: 272 GAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGI 331
           GAF G     +FKG   V + A+F++GG+E   +  +E +NP+KS+  A+K++ +RII  
Sbjct: 272 GAFVGATPGLKFKGFCTVFITASFSFGGSEVVGIAGSEAENPRKSVPGAAKQVFWRIILF 331

Query: 332 YLMTAALLGFLVPYNSP 348
           Y++   L+G LVPYN P
Sbjct: 332 YVICLLLIGMLVPYNDP 348

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  193 bits (491), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 132/494 (26%), Positives = 224/494 (45%), Gaps = 20/494 (4%)

Query: 69  SGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIG 128
           SGED E  + +   K+  L + +KPR V +++L + +GTG+++G+G +L  GGP SL I 
Sbjct: 15  SGED-ECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIA 73

Query: 129 YAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLE 188
           Y    ++L  VI S SE+A  +  +  GF+ Y    VD AF F+  W Y L++  +L   
Sbjct: 74  YLFTGSLLCVVIFSLSEMAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSAN 132

Query: 189 LVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXX 248
           L    + I YW   +N                                 K+L+       
Sbjct: 133 LTAFGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYIT 192

Query: 249 XXXVNCGGAGNDGYLGSVYWHDPGA--FRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLT 306
              + CGGA N    G  YW + GA  +    G  +F G  A +V + F + G+E   + 
Sbjct: 193 CLIITCGGAPNHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIV 252

Query: 307 AAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIA 366
             E  NP+K+I  +S  + +RI  +Y+    +LG  +   + +L+ + S   +ASPFVIA
Sbjct: 253 YGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIA 312

Query: 367 IASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVR 426
           I+S G+KV+P+                             + G APK+F  V+R   PV 
Sbjct: 313 ISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVV 372

Query: 427 CLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSL 486
             +   + G L ++       TVF+++ +   +  +  WF I ++++ + R++  +G S+
Sbjct: 373 GCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISI 432

Query: 487 DELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPV--GSN----KLDANNFFENYLAMP 540
           D++ ++ W   + AY             F+V I     G N    K     F  +Y+ + 
Sbjct: 433 DDIPFRMWFQPYAAYVTL----------FFVTIITFFNGYNAFIIKFHYKTFITSYIGVF 482

Query: 541 ILIGLYLGYKLWYR 554
             I + +GYKL+++
Sbjct: 483 ANILMVIGYKLYFK 496

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  193 bits (491), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 148/589 (25%), Positives = 251/589 (42%), Gaps = 35/589 (5%)

Query: 24  EVVKETSPRSEGSRDGLFHRFV----DSFKRPEEEYNGGDGIHST--HERVSGEDFERLA 77
           +VV+ T   S GSR+   HR      D+ +  +   N     + T   + +   D E+ +
Sbjct: 38  DVVQVTESPSSGSRNN--HRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEK-S 94

Query: 78  PD---DSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVST 134
           P    DS  HK LKQ ++ RHV +I+L   IGTG+LVG   +LH  GPA L I Y I+S 
Sbjct: 95  PSVDGDSEPHK-LKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISA 153

Query: 135 MLYCVIQSASELAIIY----TSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELV 190
           ++Y ++ +  E+        +  +G         VD +  F+  W Y   ++ ++  E  
Sbjct: 154 VIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECT 213

Query: 191 TASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXX 250
            AS  ++YW  ++                                + K+L          
Sbjct: 214 AASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSF 273

Query: 251 XVNCGGAGNDGYLGSVYWHDPGAFRGN---NGINRFKGLVAVLVNAAFAY-GGAEFSVLT 306
            +  GG  N   LG  YW  PGAF  +     +  F  +   ++  AFA+  G E   +T
Sbjct: 274 ILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVCMT 333

Query: 307 AAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPEL---LGSGSAATHASPF 363
           +AE  + +++I  AS++ V+R+I  Y++    +  +VPYN P L   L  G     +SPF
Sbjct: 334 SAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPF 393

Query: 364 VIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGR 423
           VI I + G+KV+PH                             + G APK    +++ G 
Sbjct: 394 VIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGV 453

Query: 424 PVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQG 483
           P   + VS +   L ++  S     VF W   IS +S    W    ++++RFR+++   G
Sbjct: 454 PYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNG 513

Query: 484 RSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILI 543
              D L +++W   +  +++            +    P         +F   Y+ +PI +
Sbjct: 514 L-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIP---KYWRVADFIAAYITLPIFL 569

Query: 544 GLYLGYKLWYRDWRV-IIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLR 591
            L+ G+KL+ R WR   +P +E+D+ +        +   E+  E E++R
Sbjct: 570 VLWFGHKLYTRTWRQWWLPVSEIDVTT------GLVEIEEKSREIEEMR 612

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  192 bits (487), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 147/590 (24%), Positives = 250/590 (42%), Gaps = 36/590 (6%)

Query: 24  EVVKETSPRSEGSRDGLFHRFVDSFK---------RPEEEYNGGDGIHSTHERVSGEDFE 74
            VV+ T   S GSR+   H+  D+ K           ++  +    IH   E V   D E
Sbjct: 36  NVVQVTESASSGSRNN--HQRYDNEKDDDIRMEKISKDQSASSNGTIH--EELVMDVDLE 91

Query: 75  RL-APDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVS 133
           +  + D  ++ + LKQ ++ RHV +I+L   IGTG+LVG   +LH  GP  L I Y I+S
Sbjct: 92  KSPSADGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIIS 151

Query: 134 TMLYCVIQSASELAIIY----TSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLEL 189
            ++Y ++ +  E+        +  +G         VD +  F+  W Y   ++ ++  E 
Sbjct: 152 AVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAEC 211

Query: 190 VTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXX 249
             AS  ++YW  ++                                + K+L         
Sbjct: 212 TAASGVVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILS 271

Query: 250 XXVNCGGAGNDGYLGSVYWHDPGAFRGN---NGINRFKGLVAVLVNAAFAY-GGAEFSVL 305
             +  GG      LG  YW  PGAF  +     +  F  +   ++  AFA+  G E   +
Sbjct: 272 FILFWGGGPKHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVCM 331

Query: 306 TAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPEL---LGSGSAATHASP 362
           T+AE  + +++I  AS++ V+R+I  Y++    +  +VPYN P L   L  G     +SP
Sbjct: 332 TSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSP 391

Query: 363 FVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRG 422
           FVI I + G+KV+PH                             + G APK    ++R G
Sbjct: 392 FVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWG 451

Query: 423 RPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQ 482
            P   +  S +   L ++  S     VF W   IS +S    W    ++++RFR+++   
Sbjct: 452 VPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYN 511

Query: 483 GRSLDELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPIL 542
           G   D L +++W   +  +++            +    P         +F   Y+ +PI 
Sbjct: 512 GL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIP---KYWKVADFIAAYVTLPIF 567

Query: 543 IGLYLGYKLWYRDW-RVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLR 591
           + L+LG+KL+ R W +  +P +E+D+   R + + E    E+  E E+LR
Sbjct: 568 LVLWLGHKLYTRTWHQWWLPVSEIDVT--RGLVEIE----EKSREIEELR 611

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  190 bits (482), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 135/530 (25%), Positives = 233/530 (43%), Gaps = 23/530 (4%)

Query: 52  EEEYNGG--DGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGM 109
           E+  NGG    + + H R S E+ E       S++ TL + ++ RH+ +I+L   IGTG+
Sbjct: 11  EKADNGGYMHKVKTPHSRTSLEELE--TQSAGSEYNTLHKGLQSRHIQLIALGGCIGTGL 68

Query: 110 LVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAF 169
            VG   +LHN G A LL+ + ++ST++Y ++ S +E+ I Y    G      +  VD + 
Sbjct: 69  FVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEM-ICYLPQQGSVPELVSRYVDPSL 127

Query: 170 AFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXX 229
            F+  W Y   +  ++  EL  A+  + YW++ +   A                      
Sbjct: 128 GFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGE 187

Query: 230 XXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDGYLGSVYWHDPGAFR-----GNNGINRFK 284
                 + K++           +  GGA N    G  YW +PG F      G+ G  RF 
Sbjct: 188 AEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGSTG--RFL 245

Query: 285 GLVAVLVNAAFAY-GGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLV 343
            +   ++ +AFA+    E   +   E Q+ +++   AS++ +YRII  Y+  A ++G ++
Sbjct: 246 DVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVIL 305

Query: 344 PYNSPEL---LGSGSAATHASPFVIAIASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXX 400
               P+L   L +G+    +SPFV  IA+ G+ V+ H                       
Sbjct: 306 SRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTR 365

Query: 401 XXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLS 460
                  +G APK    ++R G P   ++V  +   L ++        VF WL  I  +S
Sbjct: 366 MVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTIS 425

Query: 461 ELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYY-AXXXXXXXXXGQFWVAI 519
               WF++ ++ +RFRR ++        + YQ     + AYY             F V +
Sbjct: 426 GFIGWFAMGIAFIRFRRGIVFNNLQ-SRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFL 484

Query: 520 SPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVS 569
                 + +  +F   Y+ +PI + LYLG+KLW+R  R  IP  ++D+++
Sbjct: 485 ----KGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRT-RWYIPVEQIDVIT 529

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  189 bits (481), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 132/529 (24%), Positives = 224/529 (42%), Gaps = 24/529 (4%)

Query: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138
           D  +   +L+Q +K RH+ MI+L   IGTG+ VG   +L   GPA L I Y I+S+++Y 
Sbjct: 69  DPFANEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYP 128

Query: 139 VIQSASELAIIY----TSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASM 194
           ++    E+           SG      A  VDK+  F+ +W Y   ++ ++  E   AS 
Sbjct: 129 IMCGFGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASG 188

Query: 195 TIKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNC 254
            ++YW  ++                                + K+L           +  
Sbjct: 189 VVEYWTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFW 248

Query: 255 GGAGNDGYLGSVYWHDPGAFRGN---NGINRFKGLVAVLVNAAFAY-GGAEFSVLTAAEQ 310
           GG  N   LG  YW  PGAF  +    G  RF  + + ++   FA+  G E   LT+AE 
Sbjct: 249 GGGPNHDRLGFRYWQRPGAFTEHIMKGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAEC 308

Query: 311 QNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPEL---LGSGSAATHASPFVIAI 367
           ++ +++I  A+++ ++R++  Y++    +  +V YN P L   L SG     +SPFVI I
Sbjct: 309 EDQRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGI 368

Query: 368 ASHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRC 427
            + G++V+PH                               G AP++F  ++R G P   
Sbjct: 369 QNAGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVA 428

Query: 428 LLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLD 487
           + +S     L F+  S     VF W   IS +S    W    ++++RFR+++   G   D
Sbjct: 429 ISLSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YD 487

Query: 488 ELGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYL 547
            L +++W   +  YY+            +    P        ++F   Y+ +PI + L++
Sbjct: 488 RLPFKTWGQPYAVYYSLFVISLITLTNGYATFIP---KNWKGSDFVAAYITLPIFVVLWV 544

Query: 548 GYKLWYRD-----WRVI----IPANEVDLVSHRKIFDAEIMQSEQLEEK 587
           G+KLW R      WR +    +    VD+    KI D   ++     +K
Sbjct: 545 GHKLWTRTFTKRWWRRVDQIDVTTGLVDIEERTKILDETRVEPSTRWQK 593

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  188 bits (477), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 140/529 (26%), Positives = 228/529 (43%), Gaps = 29/529 (5%)

Query: 86  TLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASE 145
           TLKQ ++ RH+ +I+L   IGTG+ VG   +L   GPA LL  Y I+S ++Y V+ +  E
Sbjct: 48  TLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGE 107

Query: 146 LAIIY----TSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWND 201
           +        T   G  +   +   D +  F+  W Y   ++ ++  E   AS  + YW  
Sbjct: 108 MVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTT 167

Query: 202 SINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCGGAGNDG 261
            +   A                              K+L           +  GG  +  
Sbjct: 168 VVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHD 227

Query: 262 YLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYG-GAEFSVLTAAEQQNPQK 315
            LG  YW  PGAF      GN G  RF  +   ++   FA+  G E   +T++E  + ++
Sbjct: 228 RLGFRYWQKPGAFAYHITTGNTG--RFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRR 285

Query: 316 SIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPEL---LGSGSAATHASPFVIAIASHGV 372
           +I  AS++  YR+I  Y+ +A  +G +V  N P L   L SG A   +SPFVIAI +  +
Sbjct: 286 NIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHI 345

Query: 373 KVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCLLVSC 432
           K++PH                             E G APK+F  ++R G P   + VS 
Sbjct: 346 KILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSA 405

Query: 433 VFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQ 492
            F  L ++  S      FTW   IS +S    W  I ++++RFR+++  +G   D + ++
Sbjct: 406 AFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFK 464

Query: 493 SWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLW 552
           S    +G Y+             +    P         +F   Y+ +P+ + L++G+K++
Sbjct: 465 SPFQPYGTYFFIIVVSIICLTNGYATFIP---RFWKGADFVAAYITLPVFVVLWVGHKIY 521

Query: 553 YRDWRV-IIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLR---HASWTK 597
            R     +IP  EVD+ +      AEI   E  +E + LR   +++W K
Sbjct: 522 TRTLSTWVIPVAEVDVTTGL----AEI--EELTKELDALRVPPNSAWEK 564

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  189 bits (479), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 133/524 (25%), Positives = 224/524 (42%), Gaps = 23/524 (4%)

Query: 80  DSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCV 139
           D+  HK LKQ ++ RHV +I+L   IGTG+LVG   +LH  GPA L I Y I+S ++Y +
Sbjct: 104 DNEPHK-LKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPI 162

Query: 140 IQSASELAIIY----TSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMT 195
           + +  E+        +  +G         VD +  F+  W Y   ++ ++  E   AS  
Sbjct: 163 MCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGV 222

Query: 196 IKYWNDSINPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCKVLMXXXXXXXXXXVNCG 255
           ++YW  ++                                + K+L           +  G
Sbjct: 223 VEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWG 282

Query: 256 GAGNDGYLGSVYWHDPGAFRGN---NGINRFKGLVAVLVNAAFAY-GGAEFSVLTAAEQQ 311
           G  N   LG  YW  PGAF  +     +  F  +   ++  AFA+  G E   +T+AE  
Sbjct: 283 GGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECA 342

Query: 312 NPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPEL---LGSGSAATHASPFVIAIA 368
           + +++I  AS++ V+R+I  Y++    +  +VPYN P L   L  G     +SPFVI I 
Sbjct: 343 DQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQ 402

Query: 369 SHGVKVVPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPKLFNYVDRRGRPVRCL 428
           + G+KV+PH                             + G APK    ++R G P   +
Sbjct: 403 NAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAV 462

Query: 429 LVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDE 488
            VS +   L ++  S     VF W   IS +S    W    ++++RFR+++   G   D 
Sbjct: 463 GVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDR 521

Query: 489 LGYQSWTGVWGAYYAXXXXXXXXXGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLG 548
           L +++W   +  + +            +    P         +F   Y+ +PI + L+ G
Sbjct: 522 LPFKTWGQPYTVWASLIVVGIITLTNGYAIFIP---KYWKIADFIAAYITLPIFLVLWFG 578

Query: 549 YKLWYRDW-RVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLR 591
           +KL+ R W +  +P +E+D+ +        I   E+  E E++R
Sbjct: 579 HKLYTRTWSQWWLPVSEIDVTT------GLIEIEEKSREIEEMR 616

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,144,852
Number of extensions: 2124504
Number of successful extensions: 7020
Number of sequences better than 10.0: 377
Number of HSP's gapped: 5582
Number of HSP's successfully gapped: 507
Length of query: 604
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 489
Effective length of database: 40,294,809
Effective search space: 19704161601
Effective search space used: 19704161601
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)