Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F00594gna 1ON43343321580.0
Kwal_33.13025na 1ON42340612601e-172
SAKL0H24838gna 1ON41040710771e-144
Ecym_1013na 1ON4114059451e-124
AFR741Wna 1ON4074089171e-120
ZYRO0D05434gna 1ON4284328341e-107
TDEL0H03670na 1ON4264297654e-97
YLR452C (SST2)7.514ON69866723.1
KLTH0D01826g7.57ON132492723.2
SAKL0A03322g6.263ON18142693.2
NDAI0C048508.424ON35659704.3
SAKL0E11066g2.147ON96542705.3
Smik_12.5507.514ON69866695.7
Skud_12.5457.514ON70066687.3
CAGL0L11924g8.237ON77573687.8
NDAI0B040402.198ON70234687.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F00594g
         (433 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON...   835   0.0  
Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON...   489   e-172
SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON} cons...   419   e-144
Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON} s...   368   e-124
AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667;...   357   e-120
ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {...   325   e-107
TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON}              299   4e-97
YLR452C Chr12 complement(1039270..1041366) [2097 bp, 698 aa] {ON...    32   3.1  
KLTH0D01826g Chr4 complement(175846..179820) [3975 bp, 1324 aa] ...    32   3.2  
SAKL0A03322g Chr1 complement(304459..305004) [546 bp, 181 aa] {O...    31   3.2  
NDAI0C04850 Chr3 (1120524..1121594) [1071 bp, 356 aa] {ON} Anc_8...    32   4.3  
SAKL0E11066g Chr5 (928800..931697) [2898 bp, 965 aa] {ON} simila...    32   5.3  
Smik_12.550 Chr12 complement(968124..970220) [2097 bp, 698 aa] {...    31   5.7  
Skud_12.545 Chr12 complement(973113..975215) [2103 bp, 700 aa] {...    31   7.3  
CAGL0L11924g Chr12 (1279776..1282103) [2328 bp, 775 aa] {ON} hig...    31   7.8  
NDAI0B04040 Chr2 (1025150..1027258) [2109 bp, 702 aa] {ON} Anc_2...    31   7.9  

>KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON}
           conserved hypothetical protein
          Length = 433

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/433 (93%), Positives = 406/433 (93%)

Query: 1   MITLRISSRTTPQGLQRDDLKARLIYQSMARSTEEKIAELQNLYPDYGVDGLLDVLVSCG 60
           MITLRISSRTTPQGLQRDDLKARLIYQSMARSTEEKIAELQNLYPDYGVDGLLDVLVSCG
Sbjct: 1   MITLRISSRTTPQGLQRDDLKARLIYQSMARSTEEKIAELQNLYPDYGVDGLLDVLVSCG 60

Query: 61  GSLKRSAQLLGDTTTPEXXXXXXXXXXXXTLNRFLDVRLLPKAAIKTNGSKASRPIELHS 120
           GSLKRSAQLLGDTTTPE            TLNRFLDVRLLPKAAIKTNGSKASRPIELHS
Sbjct: 61  GSLKRSAQLLGDTTTPESSSKRFKSRQQQTLNRFLDVRLLPKAAIKTNGSKASRPIELHS 120

Query: 121 KEDVESTLKYCTYHPNVLPLELANKLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPE 180
           KEDVESTLKYCTYHPNVLPLELANKLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPE
Sbjct: 121 KEDVESTLKYCTYHPNVLPLELANKLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPE 180

Query: 181 NRIEPFYYNGKRVESYSTYSDEIMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLS 240
           NRIEPFYYNGKRVESYSTYSDEIMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLS
Sbjct: 181 NRIEPFYYNGKRVESYSTYSDEIMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLS 240

Query: 241 NSYSRDSNLDWHSDRLTNIGPHAIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLII 300
           NSYSRDSNLDWHSDRLTNIGPHAIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLII
Sbjct: 241 NSYSRDSNLDWHSDRLTNIGPHAIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLII 300

Query: 301 MHAGFQEEYKHCVPFLPKNCNIPAEDVHPISNDVRVNLTFRNYALTTKVFCKLCGFPMDL 360
           MHAGFQEEYKHCVPFLPKNCNIPAEDVHPISNDVRVNLTFRNYALTTKVFCKLCGFPMDL
Sbjct: 301 MHAGFQEEYKHCVPFLPKNCNIPAEDVHPISNDVRVNLTFRNYALTTKVFCKLCGFPMDL 360

Query: 361 RRSFKDPSKRGLYIFQCSKSYTEENSFKEGREXXXXXXXXXXXXXXXTEFETDGSRWIAD 420
           RRSFKDPSKRGLYIFQCSKSYTEENSFKEGRE               TEFETDGSRWIAD
Sbjct: 361 RRSFKDPSKRGLYIFQCSKSYTEENSFKEGRECKGFAFACFKKKPPFTEFETDGSRWIAD 420

Query: 421 DDLEAKQAQRQLK 433
           DDLEAKQAQRQLK
Sbjct: 421 DDLEAKQAQRQLK 433

>Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON}
           [contig 123] FULL
          Length = 423

 Score =  489 bits (1260), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 294/406 (72%), Gaps = 5/406 (1%)

Query: 29  MARSTEEKIAELQNLYPDYGVDGLLDVLVSCGGSLKRSAQLLG----DTTTPEXXXXXXX 84
           MA+ST+EK+  L+ L+P Y  DGLLDVLVSC GSLKRSA  LG     T TP+       
Sbjct: 1   MAQSTDEKLLHLKELFPKYDTDGLLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHPKRLK 60

Query: 85  XXXXXTLNRFLDVRLLPKAAIKTNGSKAS-RPIELHSKEDVESTLKYCTYHPNVLPLELA 143
                +L+R+L+V  L     K   SK+  RP+ELH KE +E+ + YCTYH +VLP E+A
Sbjct: 61  TKSQQSLSRYLEVNALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVA 120

Query: 144 NKLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPENRIEPFYYNGKRVESYSTYSDEI 203
           +KLL+ L +D + KPN+FYLFGN C SNC SR+F+PE R +PF+YNGK V++   Y+DE+
Sbjct: 121 DKLLQQLLEDRNHKPNKFYLFGNLCTSNCASRLFVPEAREKPFFYNGKEVKNPGNYTDEM 180

Query: 204 MMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSNSYSRDSNLDWHSDRLTNIGPHA 263
           M+AQ+++E +VN+ +S+R  LPFQV+A +WE QAVLSN Y +DSNLDWHSDRLTNIGP A
Sbjct: 181 MLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGPQA 240

Query: 264 IIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIMHAGFQEEYKHCVPFLPKNCNIP 323
           IIASLSLGF+REFRVR+ +PSNS  +SL PQHNSLIIMHAGFQEEYKHCVP L K   IP
Sbjct: 241 IIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIP 300

Query: 324 AEDVHPISNDVRVNLTFRNYALTTKVFCKLCGFPMDLRRSFKDPSKRGLYIFQCSKSYTE 383
            ED+HPIS   RVNLT+RNY +T  VFCKLCG PM+LRR+FK+P KRG YI+QCS+SYT 
Sbjct: 301 KEDLHPISGTTRVNLTYRNYVMTENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSRSYTA 360

Query: 384 ENSFKEGREXXXXXXXXXXXXXXXTEFETDGSRWIADDDLEAKQAQ 429
            N F E +E                  +++GS W+A+DD EA++ Q
Sbjct: 361 ANGFHENQECKGFAFANFCKTPPLVSVDSEGSHWLAEDDTEARELQ 406

>SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON}
           conserved hypothetical protein
          Length = 410

 Score =  419 bits (1077), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/407 (48%), Positives = 271/407 (66%), Gaps = 5/407 (1%)

Query: 27  QSMARSTEEKIAELQNLYPDYGVDGLLDVLVSCGGSLKRSAQLLGDTTTPEX----XXXX 82
           + M  +TEEKI +L  L+PD   + LL+VL SC GS++++  L+  + + +         
Sbjct: 4   REMESTTEEKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLIDASVSQKYDQLYSTKR 63

Query: 83  XXXXXXXTLNRFLDVRLLPKAAIKTNGSKASRPIELHSKEDVESTLKYCTYHPNVLPLEL 142
                  TL + L   L  K  I     K   PI LH+K++VESTL YCTYH ++LP E+
Sbjct: 64  LKAKTQSTLTKLLSDSLT-KPGISRGPQKTRTPIALHTKDEVESTLAYCTYHKDILPSEV 122

Query: 143 ANKLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPENRIEPFYYNGKRVESYSTYSDE 202
           ANK+LE +  D S + NEFYLFGNKC SN K+RI+      +   YNG+ ++    Y+DE
Sbjct: 123 ANKILELVMNDKSARSNEFYLFGNKCTSNHKTRIYSCAEHRKALTYNGRVIDDVGEYTDE 182

Query: 203 IMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSNSYSRDSNLDWHSDRLTNIGPH 262
           +M+A +L+E+ VN+VL  R  LP+QV+ G+W  Q  ++N Y  DSNL WHSDRLTNIGP 
Sbjct: 183 MMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKLDSNLQWHSDRLTNIGPQ 242

Query: 263 AIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIMHAGFQEEYKHCVPFLPKNCNI 322
           AI+ASLSLGF+REFRVR ++PS+S  YS++P+HNSL+IMHAGFQEEYKHCVP +PK   +
Sbjct: 243 AIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGFQEEYKHCVPPVPKCSRV 302

Query: 323 PAEDVHPISNDVRVNLTFRNYALTTKVFCKLCGFPMDLRRSFKDPSKRGLYIFQCSKSYT 382
           P ++ HPIS   RVN+T+RN  +     C  CG+PM+LRR+FK P  RG+Y++QCSKSYT
Sbjct: 303 PKDEFHPISGTTRVNMTYRNRIMKKTPSCIKCGYPMELRRTFKKPDNRGMYMWQCSKSYT 362

Query: 383 EENSFKEGREXXXXXXXXXXXXXXXTEFETDGSRWIADDDLEAKQAQ 429
           EEN FK G+E               T+ E++ SRW+ADDD++A++AQ
Sbjct: 363 EENDFKAGKECKGMRYANFNNDSVVTDDESNCSRWLADDDIQAREAQ 409

>Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON}
           similar to Ashbya gossypii AFR741W
          Length = 411

 Score =  368 bits (945), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 189/405 (46%), Positives = 263/405 (64%), Gaps = 16/405 (3%)

Query: 32  STEEKIAELQNLYPDYGVDGLLDVLVSCGGSLKRSAQLLGDTTTPEXX--------XXXX 83
           +T+EK+A LQNL+P    + LLD+LVSC GS+ R A LL D +                 
Sbjct: 6   TTDEKLAYLQNLFPSANAEVLLDLLVSCNGSV-RDATLLLDLSEEGTQLEEQRSPPRKVA 64

Query: 84  XXXXXXTLNRFLDVRLLPKAAIKTNGSKASRPIELHSKEDVESTLKYCTYHPNVLPLELA 143
                 +L+ FL ++ L     + +G    +PI L+ K+D+E  LKYCTYH +VLP ELA
Sbjct: 65  KVKGQQSLSSFLPLQSLYNRQSRPSG----KPIILYGKKDIELELKYCTYHTDVLPEELA 120

Query: 144 NKLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPENRIEP-FYYNGKRVESYSTYSDE 202
           N+LL+    + + KPNEFYLFGNKC+SNC+S I+   +  E  +YYNG RV++ + ++D+
Sbjct: 121 NRLLKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLSAEEDDYYYNGMRVQTVNRFNDD 180

Query: 203 IMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSNSYSRDSNLDWHSDRLTNIGPH 262
           +++ + ++E+LVN+ L +R  LPFQ + G W+   V+SN Y++DS+L WHSDR+T IGPH
Sbjct: 181 MVITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAKDSDLQWHSDRMTYIGPH 240

Query: 263 AIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIMHAGFQEEYKHCVPFLPKNCNI 322
           ++IA+LSLGF+R  R RRV+PSNS  Y++ P+HNS++IMHAG QEE+KHCVP LPKN  I
Sbjct: 241 SVIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGCQEEFKHCVPPLPKNHQI 300

Query: 323 PAEDVHPISNDVRVNLTFRNYALTT--KVFCKLCGFPMDLRRSFKDPSKRGLYIFQCSKS 380
               ++PIS   RV+LTFR+Y + T   V C  CG+PMDLRR +K P KRG YI+ C+KS
Sbjct: 301 SKSAINPISQTTRVSLTFRDYKVNTYEPVHCDKCGYPMDLRRIYKTPEKRGHYIWLCTKS 360

Query: 381 YTEENSFKEGREXXXXXXXXXXXXXXXTEFETDGSRWIADDDLEA 425
           YT  N     +E               T  E++GS W+ADDD EA
Sbjct: 361 YTAGNGLNNKQECGGLKFARFNHPLPTTTTESEGSFWVADDDFEA 405

>AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667; No
           homolog in Saccharomyces cerevisiae
          Length = 407

 Score =  357 bits (917), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 180/408 (44%), Positives = 254/408 (62%), Gaps = 22/408 (5%)

Query: 30  ARSTEEKIAELQNLYPDYGVDGLLDVLVSCGGSLKRSAQLLGDTTTPEXXXXXX-----X 84
           + +T+EK+A+L+ + P    + LLDVLV CGG+L+ +A LL +   P             
Sbjct: 4   SETTDEKLAKLKAIIPSADTEALLDVLVCCGGNLEEAAALLRNGIDPADEKDARPLKKPR 63

Query: 85  XXXXXTLNRFLDVRLLPKAAIKTNGSKASRPIELHSKEDVESTLKYCTYHPNVLPLELAN 144
                +L+R+  ++  P  A+        RPI LH K D+E  L+YCTYH NVLP  LA 
Sbjct: 64  LQTQQSLSRYFGLKKSPVPAL------GGRPIVLHGKRDIEGALRYCTYHTNVLPAALAE 117

Query: 145 KLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPENRIEP-----FYYNGKRVESYSTY 199
           +LLE +  D   KPNEFYLFG++C++NC++ ++     ++P      +YNG R+ + ++Y
Sbjct: 118 RLLEVVMTDERAKPNEFYLFGSRCVTNCRTLLY---GNLDPADAGRVFYNG-RISTLTSY 173

Query: 200 SDEIMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSNSYSRDSNLDWHSDRLTNI 259
           + ++  AQ +VE LVN  L++R  LPFQV AG W     ++N Y +DS+L WHSDRLT I
Sbjct: 174 NADLCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEKDSDLQWHSDRLTYI 233

Query: 260 GPHAIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIMHAGFQEEYKHCVPFLPKN 319
           GPHAI+ASL+LGF REFR+RRV+P++S  YS+   HNS++IMHAG QEE+KHCVP L K 
Sbjct: 234 GPHAIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGCQEEFKHCVPPLGKR 293

Query: 320 CNIPAEDVHPISNDVRVNLTFRNYAL--TTKVFCKLCGFPMDLRRSFKDPSKRGLYIFQC 377
             + A ++HPIS  VRV+LTFR+Y +       C  CG+PMDLRR++K PSKRG YI+ C
Sbjct: 294 KKVSAAELHPISGSVRVSLTFRHYKVDFPRDALCPECGYPMDLRRTYKTPSKRGHYIWIC 353

Query: 378 SKSYTEENSFKEGREXXXXXXXXXXXXXXXTEFETDGSRWIADDDLEA 425
           S+ Y+  N                      T+ E++G+ W+ADDD EA
Sbjct: 354 SRGYSSGNDKSVESFCKGIKYACVDASPPVTDIESEGNVWLADDDFEA 401

>ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {ON}
           conserved hypothetical protein
          Length = 428

 Score =  325 bits (834), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/432 (43%), Positives = 250/432 (57%), Gaps = 48/432 (11%)

Query: 33  TEEKIAELQNLYPDYGVDG------LLDVLVSCGGSLKRSAQLLGDT------------- 73
           TE+K+ +L  LY D            L++LVSC G+L+ + +L+ D+             
Sbjct: 7   TEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTSETDILC 66

Query: 74  --TTPEXXXXXXXXXXXXTLNRFLDVRLLPKAAIKTN-----GSKASRPIELHSKEDVES 126
                E            +LN F+     P   IK+      G  ++R IEL +KED+E+
Sbjct: 67  AKGKHEDEAVSPAPKVQKSLNSFIKD---PNNKIKSVSEGSLGKISNRAIELFTKEDIET 123

Query: 127 TLKYCTYHPNVLPLELANKLLEALSKDT-SFKPNEFYLFGNKCISNCKSRIFLPENRIEP 185
            +KY + H NVLP  LAN LL+ LS+D  SF PN+FYLFG KC SN  +++F     I  
Sbjct: 124 NIKYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEEISA 183

Query: 186 ----FYYNGKRVESYSTYSDEIMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSN 241
                YYN   +   + Y D++ MAQ+L+E+LVND ++QR  LP+Q+ +  W+   VL N
Sbjct: 184 GNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVVLVN 243

Query: 242 SYSRDSNLDWHSDRLTNIGPHAIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIM 301
            Y ++SNLDWHSD++T+IGP  IIASLSLG +REFRVR+ +PSNS  Y +RP HN+L+IM
Sbjct: 244 RYYKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTLVIM 303

Query: 302 HAGFQEEYKHCVPFLPKNCNIPAEDVHPISNDVRVNLTFRNYA---LTTKVFCKLCGFPM 358
           HAGFQEEY+HCV    KN  +     HPIS  VR+NLT+R Y    L     CK CG PM
Sbjct: 304 HAGFQEEYRHCVHGHSKNSPLKP---HPISGHVRINLTYRCYLRKFLDRCPKCKKCGSPM 360

Query: 359 DLRRSFKDPSKRGLYIFQCSKSYTEENSFKEGREXXXXXXXXXXXXXXXTE-FETDGSRW 417
           DLRR+FKDP  RG YI+QCSKSYT       G+E                + F+ +GSRW
Sbjct: 361 DLRRAFKDPKTRGQYIWQCSKSYT-------GQECGGVIRAKFDNDSLTVQNFDEEGSRW 413

Query: 418 IADDDLEAKQAQ 429
           +A DD EA  AQ
Sbjct: 414 LAPDDQEAHSAQ 425

>TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score =  299 bits (765), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 179/429 (41%), Positives = 236/429 (55%), Gaps = 42/429 (9%)

Query: 33  TEEKIAELQNLYPDYGVDG------LLDVLVSCGGSLKRSAQLL--------------GD 72
           TEEKIA L +LY D           LL++L +C GS+K ++ +L              G 
Sbjct: 2   TEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIGK 61

Query: 73  TTTPEXXXXXXXXXXXXTLNRFL--DVRLLPKAAIKTNGSKASRPIELHSKEDVESTLKY 130
                            +LN+F+  D +     +       ++R IEL SKEDVEST+ Y
Sbjct: 62  RKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTIGY 121

Query: 131 CTYHPNVLPLELANKLLEALSKD-TSFKPNEFYLFGNKCISNCKSRIFLPENRI----EP 185
            T H   LP E AN LL  L  D   F P EF+LFGNKC SN  S+ +  +  I    + 
Sbjct: 122 VTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGRDK 181

Query: 186 FYYNGKRVESYSTYSDEIMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSNSYSR 245
            YYN +R   Y  Y+D +   Q+L+E++VN+ + +   LPFQ+ +  W+   VL N Y +
Sbjct: 182 IYYNNRRGTVYE-YNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKYGK 240

Query: 246 DSNLDWHSDRLTNIGPHAIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIMHAGF 305
             +L WHSDRLT+IGP  I+ASLSLG  REFR+RR +PS+S  Y +RP HNSLIIMHAGF
Sbjct: 241 SDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHAGF 300

Query: 306 QEEYKHCVPFLPKNCNIPAEDVHPISNDVRVNLTFRNYA---LTTKVFCKLCGFPMDLRR 362
           QEEY+H V    +  N  A ++HPIS DVR NLT+R+Y    +     C  C  PMDLRR
Sbjct: 301 QEEYRHSV---HQQTNNRATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRR 357

Query: 363 SFKDPSKRGLYIFQCSKSYTEENSFKEGREXXXXXXXXXXXXXXXTEFET-DGSRWIADD 421
           +FKDP +RG YI+QCS  Y+       G E                E    +GSRW+ADD
Sbjct: 358 AFKDPERRGQYIWQCSSHYS-------GVECGGVRLADFNCNSLVVEKNAGEGSRWLADD 410

Query: 422 DLEAKQAQR 430
           D EAK+AQ+
Sbjct: 411 DWEAKEAQK 419

>YLR452C Chr12 complement(1039270..1041366) [2097 bp, 698 aa] {ON}
           SST2GTPase-activating protein for Gpa1p, regulates
           desensitization to alpha factor pheromone; also required
           to prevent receptor-independent signaling of the mating
           pathway; member of the RGS (regulator of G-protein
           signaling) family
          Length = 698

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 6/66 (9%)

Query: 1   MITLRISSRT--TPQGLQRDDLKARLIYQSMARSTEEKIAELQNLYPDYGVDGLLDVLVS 58
           ++TL +SS+   TPQ   R + K ++++Q     T + +A LQ    D G+  + D+L+S
Sbjct: 104 LLTLFMSSKLLHTPQDRTRGEPKEKVLFQP----TPKGVAVLQKYVRDIGLKTMPDILLS 159

Query: 59  CGGSLK 64
              S+K
Sbjct: 160 SFNSMK 165

>KLTH0D01826g Chr4 complement(175846..179820) [3975 bp, 1324 aa]
           {ON} similar to uniprot|P22023 Saccharomyces cerevisiae
           YOR336W KRE5 Protein required for beta-1 6 glucan
           biosynthesis mutations result in aberrant morphology and
           severe growth defects
          Length = 1324

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 41/92 (44%), Gaps = 3/92 (3%)

Query: 129 KYCTYHPNVLPLELANKLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPENRIEPFYY 188
           K+      +L L+  N L++ L K  +  P E  +   K ++    R    +  ++P  Y
Sbjct: 334 KWSVLQSVILELQRVNFLMDLLQKYQNITPGESLVLAKKLLNTFSKRSLTTQQLLQPVKY 393

Query: 189 NGKRVESYS---TYSDEIMMAQILVEELVNDV 217
           +  R+  +S    Y ++I +     E+L +D+
Sbjct: 394 DLHRIPGFSESIIYFNDIELDSDYAEKLKDDI 425

>SAKL0A03322g Chr1 complement(304459..305004) [546 bp, 181 aa] {ON}
           similar to uniprot|Q03233 Saccharomyces cerevisiae
           YMR184W Hypothetical ORF
          Length = 181

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 141 ELANKLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPENR 182
           +L + + E LSK+T   P EF  + NK ISN ++ +   + R
Sbjct: 94  QLMDSVRELLSKETRLPPQEFKFYKNKVISNIETSLNTEQTR 135

>NDAI0C04850 Chr3 (1120524..1121594) [1071 bp, 356 aa] {ON}
           Anc_8.424
          Length = 356

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%)

Query: 159 NEFYLFGNKCISNCKSRIFLPENRIEPFYYNGKRVESYSTYSDEIMMAQILVEELVNDV 217
           ++F+ FG   +    S I LPE+++   Y    + +S++  S     AQ    ++ NDV
Sbjct: 133 DKFFQFGKDLLVTHGSDILLPEDQVNSSYTKQNQEKSFANSSSSKKQAQAQTSQISNDV 191

>SAKL0E11066g Chr5 (928800..931697) [2898 bp, 965 aa] {ON} similar
           to uniprot|P25846 Saccharomyces cerevisiae YHR120W MSH1
           DNA-binding protein of the mitochondria involved in
           repair of mitochondrial DNA has ATPase activity and
           binds to DNA mismatches has homology to E. coli MutS
           transcription is induced during meiosis
          Length = 965

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 8/42 (19%)

Query: 200 SDEIMMAQILVEELVN--------DVLSQRTALPFQVEAGKW 233
           + EI + Q+L+++LV+        ++L     LP+ VEAGKW
Sbjct: 240 TGEIFVQQVLLKDLVSAITRIKPREILLDEKLLPYTVEAGKW 281

>Smik_12.550 Chr12 complement(968124..970220) [2097 bp, 698 aa] {ON}
           YLR452C (REAL)
          Length = 698

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 6/66 (9%)

Query: 1   MITLRISSRT--TPQGLQRDDLKARLIYQSMARSTEEKIAELQNLYPDYGVDGLLDVLVS 58
           ++TL +SS+   TPQ   R + K ++++Q     T + +A LQ    D G+  + DVL+S
Sbjct: 104 LLTLFMSSKLLHTPQDRTRSEPKEKVLFQP----TPKGVAVLQKYVRDIGLKKIPDVLLS 159

Query: 59  CGGSLK 64
              S++
Sbjct: 160 SFNSME 165

>Skud_12.545 Chr12 complement(973113..975215) [2103 bp, 700 aa] {ON}
           YLR452C (REAL)
          Length = 700

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 6/66 (9%)

Query: 1   MITLRISSRT--TPQGLQRDDLKARLIYQSMARSTEEKIAELQNLYPDYGVDGLLDVLVS 58
           ++TL +S++   TPQ   R + K ++++Q     T + +A LQ    D G+  + D+L+S
Sbjct: 104 LLTLFMSAKLLHTPQDRTRSEPKEKVLFQP----TPKGVAVLQKYVRDIGLKRIPDILLS 159

Query: 59  CGGSLK 64
              S+K
Sbjct: 160 SFNSMK 165

>CAGL0L11924g Chr12 (1279776..1282103) [2328 bp, 775 aa] {ON} highly
           similar to uniprot|P06839 Saccharomyces cerevisiae
           YER171w DNA helicase/ATPase
          Length = 775

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 17/73 (23%)

Query: 107 TNGSKASRPIELHSKEDVESTLKYCTYHPNVLPLELANKLLEALSKDTSFKPNEFYLFGN 166
           TNG +A + +E    ED E+ ++ C YH N+  L++ N L           PN  + F  
Sbjct: 137 TNG-QAKKKLE----EDPEANVELCDYHENLYQLDVENYL-----------PNGVFSF-E 179

Query: 167 KCISNCKSRIFLP 179
           K I  C+ ++  P
Sbjct: 180 KLIKYCEQKVLCP 192

>NDAI0B04040 Chr2 (1025150..1027258) [2109 bp, 702 aa] {ON}
           Anc_2.198 YOR087W
          Length = 702

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 6/34 (17%)

Query: 7   SSRTTPQGLQRDDLKARLIYQSMARSTEEKIAEL 40
           S RTT  GL ++ L+ARL      R TEEKI++L
Sbjct: 659 SERTTSNGLTKEQLEARL------RKTEEKISDL 686

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,953,813
Number of extensions: 1841454
Number of successful extensions: 4687
Number of sequences better than 10.0: 24
Number of HSP's gapped: 4803
Number of HSP's successfully gapped: 25
Length of query: 433
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 321
Effective length of database: 40,638,807
Effective search space: 13045057047
Effective search space used: 13045057047
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)