Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F00572g1.10ON19519510081e-141
Kwal_33.130231.10ON1931674607e-58
SAKL0C00572g1.10ON3381653343e-37
ZYRO0F18370g1.10ON2201682802e-30
TDEL0C069301.10ON1841822591e-27
KLLA0C00594g1.10ON1941642503e-26
NDAI0A001901.10ON1711572467e-26
KNAG0C002701.10ON1741691996e-19
NCAS0B090601.10ON1671651971e-18
TPHA0E039601.10ON1771601726e-15
KAFR0D001901.10ON1851751641e-13
TBLA0A049701.10ON181531342e-09
Ecym_10121.10ON177167880.003
Kpol_2002.131.10ON16442750.17
Smik_3.191.10ON144162730.25
TPHA0M020906.373ON196468720.75
TPHA0A002603.3ON250134700.90
Kwal_27.117078.462ON974101701.6
Skud_8.1525.393ON64285664.7
Suva_5.391.474ON64636646.5
ZYRO0F10912g8.613ON35456647.0
TBLA0B005706.46ON517109638.3
TBLA0E01970singletonON57825639.1
KLTH0E10736g8.462ON973105639.5
NOTE: 3 genes in the same pillar as KLTH0F00572g were not hit in these BLAST results
LIST: Skud_3.8 YCL056C Suva_3.157

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F00572g
         (195 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...   392   e-141
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...   181   7e-58
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...   133   3e-37
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...   112   2e-30
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....   104   1e-27
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...   100   3e-26
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...    99   7e-26
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    81   6e-19
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....    80   1e-18
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...    71   6e-15
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    68   1e-13
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    56   2e-09
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    39   0.003
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    33   0.17 
Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON} YC...    33   0.25 
TPHA0M02090 Chr13 (430238..436132) [5895 bp, 1964 aa] {ON} Anc_6...    32   0.75 
TPHA0A00260 Chr1 complement(35020..35772) [753 bp, 250 aa] {ON} ...    32   0.90 
Kwal_27.11707 s27 complement(911797..914721) [2925 bp, 974 aa] {...    32   1.6  
Skud_8.152 Chr8 complement(258812..260740) [1929 bp, 642 aa] {ON...    30   4.7  
Suva_5.39 Chr5 (70129..72069) [1941 bp, 646 aa] {ON} YEL030W (REAL)    29   6.5  
ZYRO0F10912g Chr6 complement(888696..889760) [1065 bp, 354 aa] {...    29   7.0  
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...    29   8.3  
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    29   9.1  
KLTH0E10736g Chr5 complement(965155..968076) [2922 bp, 973 aa] {...    29   9.5  

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score =  392 bits (1008), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 195/195 (100%), Positives = 195/195 (100%)

Query: 1   MDTHPGKSRPLSKRGSRSCPDKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVI 60
           MDTHPGKSRPLSKRGSRSCPDKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVI
Sbjct: 1   MDTHPGKSRPLSKRGSRSCPDKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVI 60

Query: 61  GENNVFYQKLNKSGFCSKAWLVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPV 120
           GENNVFYQKLNKSGFCSKAWLVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPV
Sbjct: 61  GENNVFYQKLNKSGFCSKAWLVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPV 120

Query: 121 RKVLNAKVTARIQEINQKLILVALELIQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIF 180
           RKVLNAKVTARIQEINQKLILVALELIQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIF
Sbjct: 121 RKVLNAKVTARIQEINQKLILVALELIQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIF 180

Query: 181 AIARLLFSGFSSLTP 195
           AIARLLFSGFSSLTP
Sbjct: 181 AIARLLFSGFSSLTP 195

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score =  181 bits (460), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 123/167 (73%), Gaps = 1/167 (0%)

Query: 21  DKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAW 80
           D   T +G G+ IE+  +SG+E++AG+FDD+ LL+SFG+I E+N  Y+KLNKSGFCSK W
Sbjct: 22  DVTKTNKG-GEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVW 80

Query: 81  LVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTARIQEINQKLI 140
           L+SL LS+R+   D+ NL +SRSRL++E+  F     N +R+ L+ K+  +I+++N++LI
Sbjct: 81  LLSLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVNRRLI 140

Query: 141 LVALELIQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLF 187
           LVALE++QNI YL +VAADV    L E+WK LLE+ SS+  + + LF
Sbjct: 141 LVALEIMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLF 187

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score =  133 bits (334), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 104/165 (63%)

Query: 29  QGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSS 88
           Q  + E  L+ GLE++  +FDD+ LL++FG+IGE N  Y+ LNK G  SK WL +L LS 
Sbjct: 172 QPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSL 231

Query: 89  RRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTARIQEINQKLILVALELIQ 148
           R++   +  LA +R  L++E+     +      K++  K T +I ++++++  V L+++Q
Sbjct: 232 RKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQ 291

Query: 149 NIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLFSGFSSL 193
           N+ YL +VA DV    L  +W+RLLE VSS+  ++R  F+GFS++
Sbjct: 292 NLAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGFSTI 336

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score =  112 bits (280), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 57/168 (33%), Positives = 105/168 (62%), Gaps = 1/168 (0%)

Query: 28  GQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLS 87
           G     E  L++GLE+I G+FD++ LL++ G+I E+N+ Y++LNK  + SK W V+L LS
Sbjct: 52  GHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLS 111

Query: 88  SRRNASDIINLAISRSRLKREQAEFMRR-PVNPVRKVLNAKVTARIQEINQKLILVALEL 146
           +R++ S ++ +  ++S+LK E  E       + V++VL  K T  +++ +  +  V LEL
Sbjct: 112 ARKSFSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLEL 171

Query: 147 IQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLFSGFSSLT 194
           +Q + YL +V  +V    +++K  ++LE +S   A+ R+  +G+++LT
Sbjct: 172 LQTLAYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFTTGYTTLT 219

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score =  104 bits (259), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 97/182 (53%), Gaps = 2/182 (1%)

Query: 12  SKRGSRSCPDKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLN 71
           S   S S   KP+   G   + E  L++GLE++   FD++   +S G+IGENN  Y++LN
Sbjct: 3   SGNSSPSSLGKPTG--GSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLN 60

Query: 72  KSGFCSKAWLVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTAR 131
           K G+ SK W V+L LS R+    I  +  +R RLK E     +     +  VL  K+   
Sbjct: 61  KGGWGSKLWFVTLLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLM 120

Query: 132 IQEINQKLILVALELIQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLFSGFS 191
           +Q+ N  +    L+L+QN  YL +V  DV    + ++ +++LE +S+   I R    GFS
Sbjct: 121 LQKSNAMMRETLLDLLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGFS 180

Query: 192 SL 193
           S+
Sbjct: 181 SV 182

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score =  100 bits (250), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 94/164 (57%)

Query: 27  EGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTL 86
           +    ++E  L+  L +++  FDDL LLRSFG+I + N  YQKLNK    SK WLVSL L
Sbjct: 27  DAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWLVSLLL 86

Query: 87  SSRRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTARIQEINQKLILVALEL 146
           S RR+ + +  L   + +L++E            +K++  K+ A   +++ K+  + ++L
Sbjct: 87  SIRRSLTRLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRSLCMDL 146

Query: 147 IQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLFSGF 190
           +Q++ Y+ +V+ D+    L+ K+KR LE +SS   + + + S +
Sbjct: 147 LQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSSSY 190

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score = 99.4 bits (246), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 93/157 (59%), Gaps = 2/157 (1%)

Query: 31  KNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSSRR 90
           + +E +++ GLE I  IFD++ LL+S G+I ENN+ Y+ LNK  F SK W V+L L++R+
Sbjct: 3   RTMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRK 62

Query: 91  NASDIINLAISRSRLKREQAEFMR--RPVNPVRKVLNAKVTARIQEINQKLILVALELIQ 148
               +I    +R RL +E+    R  R  N V  VL+ K+   I++ +  ++ + LEL Q
Sbjct: 63  LVHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQ 122

Query: 149 NIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARL 185
            + YL LV+ ++     ++K   +LE +S++  + R+
Sbjct: 123 TLVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRM 159

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score = 81.3 bits (199), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 97/169 (57%), Gaps = 14/169 (8%)

Query: 34  ESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSSRRNAS 93
           E  L+  LE+I  IFD++ LL+S G+I + N  Y+KLNK    SK W ++L LS R+N  
Sbjct: 10  EDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKNLK 69

Query: 94  DIINLAISRSRLKREQAEFMRRP------VNPVRKVLNAKVTARIQEINQKLILVALELI 147
            ++ L  +R +L  E  + +R+       VN V  VLN K++  +++ +  +I   L+L 
Sbjct: 70  RLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNV--VLN-KLSTNLRKCHFMIIDTFLDLA 126

Query: 148 QNIGYLTLVAADVLAFGL---TEKWKRLLERVSSIFAIARLLFSGFSSL 193
           Q + YL +V+ D   F +    +K+K+ L  +S++  I R+L S ++++
Sbjct: 127 QLLIYLFIVSGD--CFNIPPRFKKFKKYLGPMSNVVTILRMLVSVYTTI 173

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 97/165 (58%), Gaps = 5/165 (3%)

Query: 33  IESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSSRRNA 92
           +E  +++ LE+I  IFD++   +S GV+ E N+ Y+ LNK  F SK W ++L LSS++  
Sbjct: 4   LEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKLI 63

Query: 93  SDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTARIQEINQKLILV----ALELIQ 148
           + +      R+++K+E  E  +   +  + ++N+ +  +++    K + +     LEL+Q
Sbjct: 64  TRLTKSLKIRAKIKKEIDESPKEN-DEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQ 122

Query: 149 NIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLFSGFSSL 193
            + YL++   +V    + +KWK LLE++S+I  I R+  SG+SSL
Sbjct: 123 TMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGYSSL 167

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score = 70.9 bits (172), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 84/160 (52%), Gaps = 1/160 (0%)

Query: 19  CPDKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSK 78
             D  S   G  +  ES L++ LE+I  IFD +  LRS G+I ENN FY+ LN+S   SK
Sbjct: 3   SSDVFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSK 62

Query: 79  AWLVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTARIQEINQK 138
            W V+L LS R+   +I+      S LK E  + + +  +    ++  K+      + +K
Sbjct: 63  IWFVTLILSIRKLYKNILKSTKLLSLLKTELTK-IEKNNDLTSDIILQKIQNNNTILKKK 121

Query: 139 LILVALELIQNIGYLTLVAADVLAFGLTEKWKRLLERVSS 178
           +    +ELIQ+  YL +V+ ++    +++K    LE +S+
Sbjct: 122 IKNFIIELIQDFIYLIIVSLEIFKISISKKLNHRLEILSN 161

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score = 67.8 bits (164), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 88/175 (50%), Gaps = 8/175 (4%)

Query: 20  PDKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKA 79
            DK      +   +E  L+  LE I  +FD++  L++ GVI E+N  Y+KLNK    SK 
Sbjct: 6   TDKDDEFHRKSITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKI 65

Query: 80  WLVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNP-----VRKVLNAKVTARIQE 134
           WLVSL LS RR   ++ ++  +R +   E +   ++         V  +L  K+   +Q+
Sbjct: 66  WLVSLILSIRRCFKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQK 125

Query: 135 INQKLILVALELIQNIGYLTLVAADVLAFGLTEKWK---RLLERVSSIFAIARLL 186
            N  +  + LE +Q + YL +V  +V      E++    R LE +S++  + R++
Sbjct: 126 CNSIIRDLLLEFLQVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRII 180

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa]
          {ON} Anc_1.10 YCL056C
          Length = 181

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 38/53 (71%)

Query: 37 LVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSSR 89
          ++ GLE+I  +FD++  LRS G+I + N+FY+ LN+S   SK WL++L L+ R
Sbjct: 13 ILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
           similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 77/167 (46%), Gaps = 12/167 (7%)

Query: 8   SRPLSK--RGSRSCPDKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNV 65
           ++PLS   R +     + S   G     E  L   L +    +D + L +S G+I ++NV
Sbjct: 6   NQPLSGIFRYAEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNV 65

Query: 66  FYQKLNKSGFCSKAWLVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLN 125
            Y+ L      S + L+ L L +R+    ++ L      LK         P   ++K  N
Sbjct: 66  IYKALAVGKINSGSRLLFLLLVARKTFLKLLRLVRLWYALKNVL------PPASIKKKYN 119

Query: 126 AKVTARIQEINQKLILVALELIQNIGYLTLVAADVLAFGLTEKWKRL 172
            +  +R++   + ++ ++++L+  + YL +V  D+  F +++  ++L
Sbjct: 120 -ETKSRVK---RSILRLSVDLLDTLVYLIVVLIDLFKFKVSDSTRKL 162

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
          complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 26/42 (61%)

Query: 34 ESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGF 75
          E  ++ GLE I  +FD +  +++ G+I + +  Y+K+ ++ F
Sbjct: 7  EDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNF 48

>Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 32.7 bits (73), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 75/162 (46%), Gaps = 29/162 (17%)

Query: 27  EGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTL 86
           E  GKN+   + +G   ++ + D   +L + GV+ +      KL  SG   K WL    +
Sbjct: 9   EVSGKNLWINVWNG---VSSLLDFFAVLENLGVVDD------KLYVSGVLRKVWLCYSWI 59

Query: 87  SSRRNASDIINLAISRSRLKREQAEFMRRPVNPV--RKVLNAKVTARIQEINQKLILVAL 144
           S  +    +INL   + + K +Q   +  P N +   K++N K   R  +I Q    +  
Sbjct: 60  SVIKCVWKLINLC--KVKFKIDQR--LNGPGNGLVKEKLMNFKKRYR-DQIRQ----ITA 110

Query: 145 ELIQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLL 186
            L+Q++ YL      VL +  T    RL +R+S+I  + R++
Sbjct: 111 TLLQDLSYLM-----VLIYPGT----RLFKRLSNIITLCRII 143

>TPHA0M02090 Chr13 (430238..436132) [5895 bp, 1964 aa] {ON}
           Anc_6.373 YCR093W
          Length = 1964

 Score = 32.3 bits (72), Expect = 0.75,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 88  SRRNASDIINLAISRSRLKREQAEFMRRPV---NPVRKVLNAKVTAR-IQEINQKLILVA 143
           S  N  D++N     ++LK E   F R      N + +V+N  +++  +  I  K IL  
Sbjct: 229 SSTNLEDVVNYLYKNNKLKNETMSFARYKALNWNNIFQVINKNISSEDVNAITPKSILFI 288

Query: 144 LELIQNIG 151
           L L  NIG
Sbjct: 289 LALFNNIG 296

>TPHA0A00260 Chr1 complement(35020..35772) [753 bp, 250 aa] {ON}
           Anc_3.3 YOL147C
          Length = 250

 Score = 31.6 bits (70), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 59/134 (44%), Gaps = 12/134 (8%)

Query: 48  FDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSSRRNASDIINLAISRSRLK- 106
           FD L LLR   V+ +N    ++L K    +  WL  L  S   +A  II L      LK 
Sbjct: 115 FDQLNLLRILNVLPKNEFTVKRLPK--ITNYFWLFGLVTSLLTSAKTIITLNEKLIELKN 172

Query: 107 ---REQAEFMRRPVNPVRKVLNAKVTARI--QEINQKLILVALELI---QNIGYLTLVAA 158
               +Q EF    +     +   +V  +I    ++  +++ +L+LI   QN GY +L   
Sbjct: 173 NNIEKQNEFEDEKIIQSLNIQKHQVLRKIVWDLLDSTVVVNSLDLIKLNQN-GYASLAGV 231

Query: 159 DVLAFGLTEKWKRL 172
               FG+ E W ++
Sbjct: 232 ITSYFGIKEAWDKI 245

>Kwal_27.11707 s27 complement(911797..914721) [2925 bp, 974 aa] {ON}
           YDR238C (SEC26) - encodes a subunit of yeast coatomer
           [contig 27] FULL
          Length = 974

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 77  SKAWLVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVL---NAKVTARIQ 133
           SKA  ++L L S RN  D+I L     ++    A+   + ++  R++L     KV  R  
Sbjct: 339 SKALDIALELVSSRNVDDVIKLLKKELQITIANAQNDEKAMD-YRQLLIKNIHKVAIRFA 397

Query: 134 EINQKLILVALELIQNIGYLTLVAADVLAF--GLTEKWKRL 172
           E++  ++ + LEL+ ++   +  A+DV+AF   + EK+ +L
Sbjct: 398 EVSADVVSLFLELVGDLS--SNAASDVIAFIKQVIEKYPQL 436

>Skud_8.152 Chr8 complement(258812..260740) [1929 bp, 642 aa] {ON}
           YHR091C (REAL)
          Length = 642

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 12/85 (14%)

Query: 66  FYQKLNKSGFCSKAWLVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLN 125
           F+    +  FCSK       +  +R +S+  N+  +      EQ+E    P++ +R+ + 
Sbjct: 29  FFDTRFRERFCSKT-----NMEQKRYSSETSNVKCN------EQSERAIYPLDALRQDI- 76

Query: 126 AKVTARIQEINQKLILVALELIQNI 150
           +KV + I  I+  LIL ALE   N+
Sbjct: 77  SKVLSNISGIDHSLILNALESTNNM 101

>Suva_5.39 Chr5 (70129..72069) [1941 bp, 646 aa] {ON} YEL030W (REAL)
          Length = 646

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 26/36 (72%), Gaps = 1/36 (2%)

Query: 96  INLAISRSRLKREQAEFMRRPVNPVRKVL-NAKVTA 130
           IN++ SR++L+   A  + R ++PV+K L +AK+T+
Sbjct: 316 INMSFSRAQLESLTAPLINRTIDPVKKALKDAKLTS 351

>ZYRO0F10912g Chr6 complement(888696..889760) [1065 bp, 354 aa]
          {ON} similar to uniprot|Q02950 Saccharomyces cerevisiae
          YPL118W MRP51 ;homolog group vGLR.3476 derived from
          GLR.3476
          Length = 354

 Score = 29.3 bits (64), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 5  PGKSRPLSKRGSRSCPD------KPSTLEGQGKNIESALVSGLETIAGIFDDLQLL 54
          P   +PL + G R  P       KPSTL+ Q   ++S++ S +++   IF+DL  L
Sbjct: 21 PRNGKPLVQTGPRYHPTHQIIETKPSTLDRQEWGLKSSIPSKVKSRYLIFNDLDTL 76

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 11/109 (10%)

Query: 32  NIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSL-TLSSRR 90
           N +S  +S   T++   DD     S G   E   F+ + ++     + W  S+ TL+S+ 
Sbjct: 73  NDDSDSISNTNTLS---DDEYNSDSTGTTNEETKFFNRYDRPQESFEVWNTSIDTLNSKT 129

Query: 91  NASDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTARIQEINQKL 139
                  + I+R+++      F R  +N V+K  N K+ AR+Q   ++L
Sbjct: 130 KLKSNGRIPINRNKIS-----FNR--LNRVKKFTNKKLEARLQHCTKRL 171

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 28.9 bits (63), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 43  TIAGIFDDLQLLRSFGVIGENNVFY 67
           TI G       +R FG +G NNV+Y
Sbjct: 85  TIGGFMAQTDFIRRFGTLGPNNVYY 109

>KLTH0E10736g Chr5 complement(965155..968076) [2922 bp, 973 aa] {ON}
           highly similar to uniprot|P41810 Saccharomyces
           cerevisiae YDR238C SEC26 Involved in
           endoplasmic-to-Golgi protein trafficking encodes a
           subunit of yeast coatomer
          Length = 973

 Score = 28.9 bits (63), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 16/105 (15%)

Query: 77  SKAWLVSLTLSSRRNASDIINL-------AISRSRLKREQAEFMRRPVNPVRKVLNAKVT 129
           SKA  ++L L S RN  D++ L        I+ +    +  E+ +  +  +      KV 
Sbjct: 339 SKALDIALELVSSRNVDDVVKLLKKELQITIANAHNDEKAIEYRQLLIKNIH-----KVA 393

Query: 130 ARIQEINQKLILVALELIQNIGYLTLVAADVLAF--GLTEKWKRL 172
            R  E++  ++ + LE I  +   +  A+DV+AF   + EK+ +L
Sbjct: 394 IRFVEVSADVVSLFLEFIGELS--SSAASDVIAFIKQVIEKYPQL 436

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,560,898
Number of extensions: 637623
Number of successful extensions: 1952
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1982
Number of HSP's successfully gapped: 29
Length of query: 195
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 91
Effective length of database: 41,556,135
Effective search space: 3781608285
Effective search space used: 3781608285
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)