Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F00550g1.8ON82824074e-53
SAKL0C00528g1.8ON110823765e-48
Kwal_33.130161.8ON82823736e-48
AFR743W1.8ON82823553e-45
Ecym_10101.8ON82823423e-43
ZYRO0F18414g1.8ON87763242e-40
Kpol_2002.111.8ON86793145e-39
NCAS0B090801.8ON93763085e-38
CAGL0B00396g1.8ON88703061e-37
TPHA0E039801.8ON86853051e-37
TBLA0A049601.8ON96723061e-37
KLLA0C00550g1.8ON82823042e-37
Skud_3.61.8ON97962862e-34
Smik_3.171.8ON97962862e-34
YCL057C-A (MOS1)1.8ON97692852e-34
TDEL0C069401.8ON86862817e-34
Suva_3.1551.8ON97962792e-33
KNAG0C002501.8ON94712541e-29
NDAI0A001701.8ON96782436e-28
KAFR0D001701.8ON90892392e-27
SAKL0H19646g8.163ON155125631.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F00550g
         (82 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   161   4e-53
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   149   5e-48
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   148   6e-48
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   141   3e-45
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   136   3e-43
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   129   2e-40
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   125   5e-39
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   123   5e-38
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   122   1e-37
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   122   1e-37
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   122   1e-37
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   121   2e-37
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   114   2e-34
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   114   2e-34
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   114   2e-34
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   112   7e-34
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   112   2e-33
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   102   1e-29
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...    98   6e-28
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...    97   2e-27
SAKL0H19646g Chr8 complement(1731049..1735704) [4656 bp, 1551 aa...    29   1.5  

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  161 bits (407), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 82/82 (100%), Positives = 82/82 (100%)

Query: 1  MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60
          MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL
Sbjct: 1  MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60

Query: 61 GRGYAEGDAIFRSSAGLRTVKA 82
          GRGYAEGDAIFRSSAGLRTVKA
Sbjct: 61 GRGYAEGDAIFRSSAGLRTVKA 82

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  149 bits (376), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 72/82 (87%), Positives = 79/82 (96%)

Query: 1   MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60
           MSEQL+VS  ++S+LNDKWDVVLSN+VVKTGLGFGAG+VASVLLFKRRAFPVW+GVGFGL
Sbjct: 29  MSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88

Query: 61  GRGYAEGDAIFRSSAGLRTVKA 82
           GRGYAEGDAIFRSSAGLRTV A
Sbjct: 89  GRGYAEGDAIFRSSAGLRTVNA 110

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  148 bits (373), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%)

Query: 1  MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60
          MS+Q K++P SRSLLNDKWDVVLSNLVVK GLGFGAGVVASVLLFKRRA PVWIGVGFGL
Sbjct: 1  MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60

Query: 61 GRGYAEGDAIFRSSAGLRTVKA 82
          GRGY+EGDAIFRSSAGLRTVKA
Sbjct: 61 GRGYSEGDAIFRSSAGLRTVKA 82

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  141 bits (355), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 71/82 (86%), Positives = 75/82 (91%)

Query: 1  MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60
          MS QL+VS  SRS+LNDKWDVVLSNLVVKTGLGFGAGV ASVL FKRRAFPVW+GVGFGL
Sbjct: 1  MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60

Query: 61 GRGYAEGDAIFRSSAGLRTVKA 82
          GRGYAEGDAIFRS AGLR V+A
Sbjct: 61 GRGYAEGDAIFRSHAGLRAVRA 82

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  136 bits (342), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 74/82 (90%)

Query: 1  MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60
          M E+L+V+  SRS+LNDKWDVVLSNLVVK GLGF  GV+ASVL FKRRAFPVW+G+GFGL
Sbjct: 1  MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60

Query: 61 GRGYAEGDAIFRSSAGLRTVKA 82
          GRGYAEGDAIFRS AGLRT+KA
Sbjct: 61 GRGYAEGDAIFRSHAGLRTMKA 82

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  129 bits (324), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 62/76 (81%), Positives = 72/76 (94%)

Query: 7  VSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYAE 66
          V+  ++S+LNDKWDVVLSNL+VK+GLGFG GVVASVL+FKRRAFPVW+G+GFGLGRGYAE
Sbjct: 12 VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71

Query: 67 GDAIFRSSAGLRTVKA 82
          GDAIFRS+AGLRT KA
Sbjct: 72 GDAIFRSAAGLRTSKA 87

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  125 bits (314), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 59/79 (74%), Positives = 73/79 (92%), Gaps = 1/79 (1%)

Query: 1  MSEQLKV-SPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFG 59
           S++L++ S  +RS+LNDKWDVVLSN +VKT LGFGAGV+ASV+LFKRRAFPVW+G+GFG
Sbjct: 4  QSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFG 63

Query: 60 LGRGYAEGDAIFRSSAGLR 78
          +GRGY+EGDAIFRS+AGLR
Sbjct: 64 IGRGYSEGDAIFRSAAGLR 82

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  123 bits (308), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 59/76 (77%), Positives = 67/76 (88%), Gaps = 1/76 (1%)

Query: 7  VSPT-SRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYA 65
          V+PT  RS+LNDKWDVVLSN++VK GLGF  GVVASV+ FKRR FPVW+G+GFG+GRGYA
Sbjct: 17 VTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYA 76

Query: 66 EGDAIFRSSAGLRTVK 81
          EGDAIFRS AGLRT K
Sbjct: 77 EGDAIFRSPAGLRTAK 92

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  122 bits (306), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 65/70 (92%)

Query: 12 RSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYAEGDAIF 71
          RS+LNDKWDVVLSN++VK GLGFG GVV SVL FKRR+FPVW+GVGFG GRGY+EGDAIF
Sbjct: 18 RSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGDAIF 77

Query: 72 RSSAGLRTVK 81
          RS+AGLR+VK
Sbjct: 78 RSTAGLRSVK 87

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  122 bits (305), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 73/85 (85%), Gaps = 4/85 (4%)

Query: 1  MSEQLKVS----PTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGV 56
          MSEQ   +     + +S+LNDKWDVVLSN++VKTGLGFG GVV S+LLFKRRAFPVW+G+
Sbjct: 1  MSEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGI 60

Query: 57 GFGLGRGYAEGDAIFRSSAGLRTVK 81
          GFG+GRGY++GDAIFRS+AGLR+ +
Sbjct: 61 GFGVGRGYSDGDAIFRSAAGLRSTR 85

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  122 bits (306), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 68/72 (94%)

Query: 10 TSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYAEGDA 69
          ++RS+LNDKWD+V+SN++VKT  GFGAGV+ASV+ FKRRAFPVW+GVGFGLGRGY+EGDA
Sbjct: 24 SNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDA 83

Query: 70 IFRSSAGLRTVK 81
          IFRS+AGLR+ +
Sbjct: 84 IFRSTAGLRSFQ 95

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  121 bits (304), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 58/82 (70%), Positives = 69/82 (84%)

Query: 1  MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60
          MSEQ++ +    S+L+ +WDVVLSN+V KT LG G G+VASVL FKRRAFPVW+GVGFGL
Sbjct: 1  MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60

Query: 61 GRGYAEGDAIFRSSAGLRTVKA 82
          GRGYAEGDAIFR++AGLR V A
Sbjct: 61 GRGYAEGDAIFRTNAGLRKVNA 82

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  114 bits (286), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (72%), Gaps = 15/96 (15%)

Query: 1  MSEQLKVSPTSRS---------------LLNDKWDVVLSNLVVKTGLGFGAGVVASVLLF 45
          MSEQ K+   ++S               +L+ KWD+V+SN++VKT +GFG GV  SVL F
Sbjct: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60

Query: 46 KRRAFPVWIGVGFGLGRGYAEGDAIFRSSAGLRTVK 81
          KRRAFPVW+G+GFG+GRGYAEGDAIFRSSAGLR+ K
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  114 bits (286), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 71/96 (73%), Gaps = 15/96 (15%)

Query: 1  MSEQL------KVSPTSRS---------LLNDKWDVVLSNLVVKTGLGFGAGVVASVLLF 45
          MSEQ       KV+P+  S         +L+ KWD+VLSN++VKT +GFG GV  SVL F
Sbjct: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 46 KRRAFPVWIGVGFGLGRGYAEGDAIFRSSAGLRTVK 81
          KRRAFPVW+G+GFG+GRGYAEGDAIFRSSAGLR+ K
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  114 bits (285), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 51/69 (73%), Positives = 62/69 (89%)

Query: 13 SLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYAEGDAIFR 72
          ++L+ KWD+VLSN++VKT +GFG GV  SVL FKRRAFPVW+G+GFG+GRGYAEGDAIFR
Sbjct: 28 TILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87

Query: 73 SSAGLRTVK 81
          SSAGLR+ K
Sbjct: 88 SSAGLRSSK 96

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  112 bits (281), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (89%), Gaps = 4/86 (4%)

Query: 1  MSE----QLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGV 56
          MSE    QL+V+  SRS+LNDKWDVVLSN++VKTGLGFG GVV SVL FKRRAFPVW+G+
Sbjct: 1  MSEKSQAQLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGI 60

Query: 57 GFGLGRGYAEGDAIFRSSAGLRTVKA 82
          GFGLGRGYAEGDAIFRS+AGLR+VKA
Sbjct: 61 GFGLGRGYAEGDAIFRSAAGLRSVKA 86

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  112 bits (279), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (72%), Gaps = 15/96 (15%)

Query: 1  MSEQL------KVSPTSRS---------LLNDKWDVVLSNLVVKTGLGFGAGVVASVLLF 45
          MSEQ       K +P++ S         +L+ KWD+VLSN++VKT +GFG GV  SVL F
Sbjct: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60

Query: 46 KRRAFPVWIGVGFGLGRGYAEGDAIFRSSAGLRTVK 81
          KRRAFP W+G+GFG+GRGYAEGDAIFRSSAGLR+ K
Sbjct: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score =  102 bits (254), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 56/71 (78%), Positives = 67/71 (94%)

Query: 11 SRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYAEGDAI 70
           RSLLNDKWDVVLSN++VK G+GFG GVV SVLLF+RRAFPVW+G+GFG+GRGY+EGDAI
Sbjct: 23 DRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIGFGVGRGYSEGDAI 82

Query: 71 FRSSAGLRTVK 81
          FRS++G+RTVK
Sbjct: 83 FRSTSGIRTVK 93

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score = 98.2 bits (243), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (84%)

Query: 4  QLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRG 63
          Q +++   +S+LNDKWD+VLSN +VK GLGFG GVV SV+ FKRR FPVW+G+GFG GRG
Sbjct: 18 QQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFKRRTFPVWLGIGFGAGRG 77

Query: 64 YAEGDAIFRSSAGLRTVK 81
          YAEGDAIFRSSAG+R+V 
Sbjct: 78 YAEGDAIFRSSAGIRSVN 95

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score = 96.7 bits (239), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 71/89 (79%), Gaps = 8/89 (8%)

Query: 1  MSEQLKV--------SPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPV 52
          MSE+ KV        +   RS+LNDKWD+VLSN++VK GLGFG GVV SV+ FKRRAFPV
Sbjct: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPV 60

Query: 53 WIGVGFGLGRGYAEGDAIFRSSAGLRTVK 81
          W+G+G+G GR Y+EGDAIFRS+AGLR+V+
Sbjct: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQ 89

>SAKL0H19646g Chr8 complement(1731049..1735704) [4656 bp, 1551 aa]
            {ON} similar to uniprot|P32319 Saccharomyces cerevisiae
            YBL017C PEP1 Type I transmembrane sorting receptor for
            multiple vacuolar hydrolases cycles between the
            late-Golgi and prevacuolar endosome-like compartments
          Length = 1551

 Score = 28.9 bits (63), Expect = 1.5,   Method: Composition-based stats.
 Identities = 12/25 (48%), Positives = 20/25 (80%)

Query: 25   NLVVKTGLGFGAGVVASVLLFKRRA 49
            N +VK+G+ F +GV A++ LFKR++
Sbjct: 1430 NSIVKSGVIFVSGVFAALQLFKRKS 1454

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,332,149
Number of extensions: 230404
Number of successful extensions: 613
Number of sequences better than 10.0: 21
Number of HSP's gapped: 613
Number of HSP's successfully gapped: 21
Length of query: 82
Length of database: 53,481,399
Length adjustment: 54
Effective length of query: 28
Effective length of database: 47,289,435
Effective search space: 1324104180
Effective search space used: 1324104180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)