Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F00528g1.7ON1041044375e-57
Kwal_YGOB_YCL058W-A1.7ON1051052441e-27
Kwal_33.13015singletonOFF1051052441e-27
SAKL0C00506g1.7ON105871381e-11
Smik_3.161.7ON1131051191e-08
Skud_3.51.7ON1131051084e-07
YCL058W-A (ADF1)1.7ON1131031023e-06
Suva_3.1541.7ON113105999e-06
Kpol_2002.101.7ON111113954e-05
ZYRO0F18436g1.7ON11281938e-05
TBLA0A049501.7ON113103820.002
KAFR0D001601.7ON111106770.014
NDAI0A001601.7ON12394740.036
AFR743CA1.7ON10198690.16
KNAG0C002401.7ON12644680.31
CAGL0B00374g1.7ON12166660.61
NCAS0B090901.7ON11982640.97
TPHA0D014408.704ON86174623.2
KLLA0C00528g1.7ON11617595.0
TPHA0A059403.540ON74072606.0
NOTE: 2 genes in the same pillar as KLTH0F00528g were not hit in these BLAST results
LIST: TDEL0C06950 TPHA0E03990

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F00528g
         (104 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...   172   5e-57
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    99   1e-27
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    99   1e-27
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    58   1e-11
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    50   1e-08
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    46   4e-07
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    44   3e-06
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    43   9e-06
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    41   4e-05
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    40   8e-05
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    36   0.002
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    34   0.014
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    33   0.036
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    31   0.16 
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    31   0.31 
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    30   0.61 
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    29   0.97 
TPHA0D01440 Chr4 complement(296591..299176) [2586 bp, 861 aa] {O...    28   3.2  
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    27   5.0  
TPHA0A05940 Chr1 (1343597..1345819) [2223 bp, 740 aa] {ON} Anc_3...    28   6.0  

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  172 bits (437), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 88/104 (84%), Positives = 88/104 (84%)

Query: 1   MARKGSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISELNEREHNTKRTPALE 60
           MARKGSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISELNEREHNTKRTPALE
Sbjct: 1   MARKGSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISELNEREHNTKRTPALE 60

Query: 61  SLKVSDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
           SLKVSDLIEDR                TDNNIIEQLELISGFSL
Sbjct: 61  SLKVSDLIEDREKDKSMQKKMEEQKQSTDNNIIEQLELISGFSL 104

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 98.6 bits (244), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 1   MARKGSGKK-PRSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISELNEREHNTKRTPAL 59
           M  KG  KK P S    SK VI+KHQKIRTKLKVEQANKE FLISELN+RE   +++  L
Sbjct: 1   MGLKGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNKREDTKRQSSPL 60

Query: 60  ESLKVSDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
           ESLK S L++D                 TD N++ QLELISGFSL
Sbjct: 61  ESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 98.6 bits (244), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 1   MARKGSGKK-PRSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISELNEREHNTKRTPAL 59
           M  KG  KK P S    SK VI+KHQKIRTKLKVEQANKE FLISELN+RE   +++  L
Sbjct: 1   MGLKGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNKREDTKRQSSPL 60

Query: 60  ESLKVSDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
           ESLK S L++D                 TD N++ QLELISGFSL
Sbjct: 61  ESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 57.8 bits (138), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 19  GVIRKHQKIRTKLKVEQANKESFLISELN-EREHNTKRTPALESLKVSDLIEDRXXXXXX 77
           G I+K QK RT+++VEQ NK+ FL+S+LN     +TK     ++L+   L +D+      
Sbjct: 19  GGIKKSQKKRTRIQVEQLNKQEFLLSDLNMTNAGSTKTKEKPKTLQAKALAQDQKKDKET 78

Query: 78  XXXXXXXXXXTDNNIIEQLELISGFSL 104
                     T++N++ QLE+ISGFSL
Sbjct: 79  RDKLEKQRKDTNDNMLAQLEMISGFSL 105

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 50.4 bits (119), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 12/105 (11%)

Query: 5   GSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKES-----FLISELNEREHNTKRTPAL 59
           G GKK +  R +S  V     K RTKL+VE+ NK S      L+ E   +E   ++T + 
Sbjct: 16  GVGKKVQKRRSISTAV-----KKRTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTES- 69

Query: 60  ESLKVSDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
            +LK  DLI+D+                T++N+++Q+E+ISGFSL
Sbjct: 70  -TLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 46.2 bits (108), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 12/105 (11%)

Query: 5   GSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKES-----FLISELNEREHNTKRTPAL 59
           G GKK +  R +S       ++ RTKL+VE+ NK S      L+ E   +E   KR  A 
Sbjct: 16  GVGKKVQKKRPISTA-----ERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKR--AK 68

Query: 60  ESLKVSDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
            +LK  +L++D+                T+++++EQ+E+ISGFSL
Sbjct: 69  STLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 43.9 bits (102), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 8/103 (7%)

Query: 5   GSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISELNEREHNTKRTPALES--- 61
           G GKK +  R +S       ++ RTKL+VE+ NK S  +     RE +T+    L++   
Sbjct: 16  GVGKKVQKKRSISTA-----ERKRTKLQVEKLNKSSETMIPTLLREASTQEPAKLKAETT 70

Query: 62  LKVSDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
           LK  +LI+D+                T++++++Q+E+ISGFSL
Sbjct: 71  LKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 42.7 bits (99), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 59/105 (56%), Gaps = 12/105 (11%)

Query: 5   GSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKES-----FLISELNEREHNTKRTPAL 59
           G GKK +  R +S   ++     RTKL+VE+ NK S      L+ E ++++ + K+T + 
Sbjct: 16  GVGKKQQKKRPISTAEMK-----RTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRS- 69

Query: 60  ESLKVSDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
            +L+  +L++D+                T++++++Q+E+ISGFSL
Sbjct: 70  -TLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 41.2 bits (95), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 61/113 (53%), Gaps = 18/113 (15%)

Query: 1   MARKGS-GKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFL---ISELNEREHNTK-- 54
           M +KG+ GKK +      K VI + +K R K+K+E+ NKE  L   I +LN    N +  
Sbjct: 8   MRKKGNVGKKSKR-----KNVISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSE 62

Query: 55  --RTPALESLKV-SDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
             +  ALES K+  D ++DR                TD+++++Q+EL++GFSL
Sbjct: 63  GNKERALESQKLQQDNVKDR----ETIAKIEASKKETDDSMLKQIELMTGFSL 111

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 40.4 bits (93), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 26  KIRTKLKVEQANKESFLISELNE--REHNTKRTPALESLKVSDLIEDRXXXXXXXXXXXX 83
           K RTK KVE+ + +  L SE+ +  R  ++K +    SL   +L +DR            
Sbjct: 32  KKRTKSKVEKLDAKGLLPSEIFKLNRSASSKTSNGSSSLLARNLEQDRKMDQDTRDKANA 91

Query: 84  XXXXTDNNIIEQLELISGFSL 104
               TDNNI++Q+E+ISGFSL
Sbjct: 92  KKKETDNNILQQIEMISGFSL 112

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 36.2 bits (82), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 50/103 (48%), Gaps = 2/103 (1%)

Query: 4   KGSGKKP-RSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISEL-NEREHNTKRTPALES 61
           K SGK P R    V    I    K R KL+VE+ NK+  L+S++ N    + +    + +
Sbjct: 11  KKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNVNT 70

Query: 62  LKVSDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
           L    L +D+                T++++I Q+E+ISGFSL
Sbjct: 71  LSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 34.3 bits (77), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 55/106 (51%), Gaps = 4/106 (3%)

Query: 2   ARKGSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFL-ISELNEREHNTKR--TPA 58
           AR+  G + +  +   K VI + ++ + KL VE+ N+++   + ELN+     KR  +  
Sbjct: 7   ARQAGGNRIKKIKS-RKNVISQSERKKNKLIVEKFNQQTITNVQELNKDLKKDKRRLSKT 65

Query: 59  LESLKVSDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
             +L+   L+ D+                T++++++Q+E+ISGFSL
Sbjct: 66  KNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 33.1 bits (74), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 19  GVIRKHQKIRTKLKVEQANKESFL---ISELNEREHNT--KRTPAL---ESLKVSDLIED 70
            VI++  + + K+KV   NKES L   +SELN +  +   ++  +L    SL   DL+ D
Sbjct: 30  NVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLLND 89

Query: 71  RXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
           +                 +++++ Q+E+ISGF  
Sbjct: 90  QKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 31.2 bits (69), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 4/98 (4%)

Query: 7   GKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISELNEREHNTKRTPALESLKVSD 66
            K+ ++     +G I K  K R KL+VE+ +K   L++EL       K       L+ + 
Sbjct: 8   AKRSKNGASAKQGKISKADKKRAKLQVEKLDKRGVLLAELTAAAPAAKTGV----LQAAS 63

Query: 67  LIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
           L +D+                 D  +++QLE I+GFSL
Sbjct: 64  LAQDQRSDAQAQQQRAQERSNVDKKVVQQLEAIAGFSL 101

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 30.8 bits (68), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%)

Query: 61  SLKVSDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLELISGFSL 104
           SL V  L +D+                TD +++ Q+E+ISGFSL
Sbjct: 83  SLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 30.0 bits (66), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 6/66 (9%)

Query: 42  LISELNER---EHNTKRTPALESLKVSDLIEDRXXXXXXXXXXXXXXXXTDNNIIEQLEL 98
           +I ELN+    E   KR  AL+   ++ L++D+                T++++++QLEL
Sbjct: 59  IIQELNDNKIAEEPKKRQTALD---MNCLVKDQKRDKKVREHIEKINSETNSDMLKQLEL 115

Query: 99  ISGFSL 104
           +SGFSL
Sbjct: 116 MSGFSL 121

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 29.3 bits (64), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 28  RTKLKVEQANKESFLIS----ELNEREHNTKRTPALES-LKVSDLIEDRXXXXXXXXXXX 82
           + K +VE+ NK+  L+     +L ++++ +K+   L+S L    L++D+           
Sbjct: 38  KAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQKKDKEIRNKIR 97

Query: 83  XXXXXTDNNIIEQLELISGFSL 104
                TD++I +Q+E+ISGF+ 
Sbjct: 98  AEQKATDDSIEKQIEMISGFTF 119

>TPHA0D01440 Chr4 complement(296591..299176) [2586 bp, 861 aa] {ON}
           Anc_8.704 YPL174C
          Length = 861

 Score = 28.5 bits (62), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 34/74 (45%), Gaps = 14/74 (18%)

Query: 8   KKPRSTRDVS--KGVIRKHQKIRTKLKVEQANKESFLISELNEREHN----------TKR 55
           K   ST DV   KGVI K Q     L+ + ANKE+    E  E E N           K 
Sbjct: 82  KSEGSTNDVKRLKGVIEKLQDKVLSLQSQLANKETAKFLEWYEDEINHLNLSIEKLSLKE 141

Query: 56  TPALESLKVSDLIE 69
           T  L  LK+SDLIE
Sbjct: 142 TDYL--LKISDLIE 153

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 27.3 bits (59), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/17 (70%), Positives = 14/17 (82%)

Query: 88  TDNNIIEQLELISGFSL 104
           T+  I +QLELISGFSL
Sbjct: 100 TEKKIEDQLELISGFSL 116

>TPHA0A05940 Chr1 (1343597..1345819) [2223 bp, 740 aa] {ON}
           Anc_3.540 YER041W
          Length = 740

 Score = 27.7 bits (60), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 10/72 (13%)

Query: 9   KPRSTRDVSKGVIRKHQKIRTKLKVEQ---------ANKESFLISELNEREHNTKRTPAL 59
           KP +T +    VI+ H+++R KL VE+         ++ +S ++ E N+  +  K +P  
Sbjct: 592 KPYTTNEDDSPVIQPHKEVRRKLFVEEIEDDYYHWSSDSDSPIVYEQNDIVNKIKLSPKK 651

Query: 60  E-SLKVSDLIED 70
           E +  V DL ED
Sbjct: 652 ERNHAVIDLTED 663

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,496,893
Number of extensions: 252731
Number of successful extensions: 896
Number of sequences better than 10.0: 32
Number of HSP's gapped: 884
Number of HSP's successfully gapped: 32
Length of query: 104
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 30
Effective length of database: 44,996,115
Effective search space: 1349883450
Effective search space used: 1349883450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)