Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F00506g1.6ON33233215550.0
Kwal_33.130111.6ON33431913990.0
SAKL0C00484g1.6ON33931813700.0
Ecym_10091.6ON33633513300.0
YCL059C (KRR1)1.6ON31631113250.0
Smik_3.151.6ON31631113220.0
NCAS0B091001.6ON32732813190.0
Skud_3.41.6ON31631413150.0
NDAI0A001501.6ON31731813140.0
Suva_3.1531.6ON31631213080.0
Kpol_2002.91.6ON33832213090.0
CAGL0B00352g1.6ON33731613090.0
KNAG0C002301.6ON34931112951e-180
KLLA0C00506g1.6ON33031112861e-179
AFR744W1.6ON34331112761e-177
TDEL0C069601.6ON35031412741e-177
TPHA0E040001.6ON31631712651e-176
TBLA0A049401.6ON31631712601e-175
KAFR0D001501.6ON34427212521e-173
ZYRO0F18458g1.6ON31431412361e-171
SAKL0G03740g5.482ON266146930.003
Ecym_45525.482ON271146920.004
TDEL0A034605.482ON272146920.004
Kpol_543.135.482ON268146920.005
ZYRO0D11440g5.482ON269146920.005
Kwal_47.188645.482ON271146920.005
KLTH0G02574g5.482ON271146910.006
CAGL0K09460g5.482ON261146900.008
Suva_8.1975.482ON274148890.009
NCAS0A119605.482ON270146890.011
TPHA0J028205.482ON268146880.016
KLLA0C06446g5.482ON274146880.016
AAR002W1.420ON178171850.021
KAFR0E036005.482ON276146860.023
Skud_15.3105.482ON276148850.033
YOR145C (PNO1)5.482ON274148850.035
NDAI0A043105.482ON274146850.038
Smik_15.3265.482ON274148840.052
KNAG0C046105.482ON277146830.058
TBLA0D018905.482ON271146780.27
KAFR0B030308.309ON46756702.9
AGL183C8.309ON50724693.6
KNAG0G023508.309ON49724677.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F00506g
         (332 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   603   0.0  
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   543   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   532   0.0  
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   516   0.0  
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   514   0.0  
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   513   0.0  
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   512   0.0  
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   511   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   510   0.0  
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   508   0.0  
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   508   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   508   0.0  
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   503   e-180
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   499   e-179
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   496   e-177
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   495   e-177
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   491   e-176
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   489   e-175
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   486   e-173
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   480   e-171
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    40   0.003
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    40   0.004
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    40   0.004
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    40   0.005
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    40   0.005
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    40   0.005
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    40   0.006
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    39   0.008
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    39   0.009
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    39   0.011
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    39   0.016
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    39   0.016
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    37   0.021
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    38   0.023
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    37   0.033
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    37   0.035
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    37   0.038
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    37   0.052
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    37   0.058
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    35   0.27 
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   2.9  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    31   3.6  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    30   7.0  

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/332 (89%), Positives = 297/332 (89%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQQPRKIDLQIESGEYFLT                       NKERA
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 301 KDYVAPIEKGYEGSSKKRRHEVQESPKKKTKV 332
           KDYVAPIEKGYEGSSKKRRHEVQESPKKKTKV
Sbjct: 301 KDYVAPIEKGYEGSSKKRRHEVQESPKKKTKV 332

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/319 (82%), Positives = 275/319 (86%), Gaps = 1/319 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           MPSTHNKDKPWDTPDIDKWKIEEFKPEDN SG+PF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+I+CVLDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPP QQPRK+DLQIESGEYFL+                       +KERA
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 301 KDYVAPIEKGYEGSSKKRR 319
           KDYVAP EK Y GS+ KRR
Sbjct: 301 KDYVAPSEKEY-GSTAKRR 318

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/318 (81%), Positives = 273/318 (85%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           MPSTHNKDKPWDTP+IDKWKIEEFKPEDN SG+PFAEESSFMTLFPKYREAYLKSVWNDV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+IAC LDLVEGSM+VKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRP+LAEEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQ PRK+DL+IESGEYFL+                        +ERA
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 301 KDYVAPIEKGYEGSSKKR 318
           KDYVAP E  Y+ + KKR
Sbjct: 301 KDYVAPEEAEYKSTLKKR 318

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/335 (75%), Positives = 280/335 (83%), Gaps = 6/335 (1%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNKDKPWDTPDIDKWKIEEFKPEDN SG+PFAEESSFMTLFPKYREAYLKS WNDV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH++AC L+LVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNF SNK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+P+LA++DWSRFLPMFKKRN+AR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFKKRNIAR--KKPK 238

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQ PRK+DL+IE+GEYFL+                        KERA
Sbjct: 239 KIKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298

Query: 301 KDYVAPIEKGYEGS--SKKRRHEVQ--ESPKKKTK 331
           +DY+AP EK Y+ +  S+KR  E Q  E P+K+ K
Sbjct: 299 EDYIAPDEKEYKNALNSQKRYGEDQPSEGPQKRKK 333

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/311 (80%), Positives = 265/311 (85%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDT DIDKWKIEEFK EDN SG PFAEESSFMTLFPKYRE+YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNIACVLDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM+NIHPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQ PRK+DL+IESGEYFL+                        +ERA
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 301 KDYVAPIEKGY 311
           KD++AP E+ Y
Sbjct: 301 KDFIAPEEEAY 311

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/311 (80%), Positives = 265/311 (85%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDT DIDKWKIEEFK EDN SG PFAEESSFMTLFPKYRE+YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNIACVLDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQ PRK+DL+IESGEYFL+                        +ERA
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 301 KDYVAPIEKGY 311
           KD++AP E+ Y
Sbjct: 301 KDFIAPEEETY 311

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  512 bits (1319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/328 (75%), Positives = 271/328 (82%), Gaps = 5/328 (1%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDTPD+DKW IEEFKPEDN SG+PFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KHN+ CVLDLVEGSMTVKTTR+T+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+P+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVAR-KKPKK 239

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 +YTPFPPAQ PRK+DL+IESGEYFL+                         ER 
Sbjct: 240 VRKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERN 299

Query: 301 KDYVAPIEKGYEGS----SKKRRHEVQE 324
           K+Y+AP E+ Y+ S     KKR+ E +E
Sbjct: 300 KNYIAPEEETYKSSLKKEHKKRKSESEE 327

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  511 bits (1315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/314 (79%), Positives = 265/314 (84%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN++KPWDT DIDKWKIEEFK EDN SG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNIACVLDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM+NIHPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQ PRK+DL+IESGEYFL+                        +ERA
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 301 KDYVAPIEKGYEGS 314
           KD+ AP E+ Y+ S
Sbjct: 301 KDFTAPEEESYKPS 314

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  510 bits (1314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/318 (77%), Positives = 266/318 (83%), Gaps = 1/318 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDT +I+KWKIEEFKPEDN SG+PFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+ HN+ACVLDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM+NIHPIYHIKELMIKRELAK+P+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVAR-KKPKK 239

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 +YTPFPPAQ PRK+DL+IESGEYFL+                         ER 
Sbjct: 240 VKKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERN 299

Query: 301 KDYVAPIEKGYEGSSKKR 318
           KDYVAP E  Y+ S+K +
Sbjct: 300 KDYVAPSEPTYKSSNKSK 317

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/312 (78%), Positives = 264/312 (84%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDT D+DKW IEEFK EDN SG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNI+CVLDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQ PRK+DL+IESGEYFL+                        +ERA
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 301 KDYVAPIEKGYE 312
           K++VAP E+ Y+
Sbjct: 301 KNFVAPQEEAYK 312

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/322 (77%), Positives = 269/322 (83%), Gaps = 5/322 (1%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNKDKPWDT DIDKWK+EEFKPEDN SG+PFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALDK +IAC LDLVEGSMTVKTTR+T+DP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVVEDCM+N+HPIYHIKELMIKRELAKRP+LA+EDWSRFLPMFKKRNVA       
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVA-RKKAAK 239

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQQPRK+DL+IESGEYFL+                        KER+
Sbjct: 240 PKKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERS 299

Query: 301 KDYVAPIEKGYEG----SSKKR 318
           KDYVAP+E+ Y+     SSKKR
Sbjct: 300 KDYVAPMEEEYKSTITKSSKKR 321

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/316 (77%), Positives = 264/316 (83%), Gaps = 1/316 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M ST+NKDKPWDT DIDKWKIEEFKPEDN SG PFAEESSFMTLFPKYREAYLKS+WNDV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+I C LDLVEGSMTVKTTR+T+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V+NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVV DCM+N+HPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVAR-KKPSK 239

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQ PRK+DLQIESGEYFL+                       ++ER 
Sbjct: 240 VKAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299

Query: 301 KDYVAPIEKGYEGSSK 316
           KDY+AP E  Y+ S K
Sbjct: 300 KDYIAPKEDEYKSSHK 315

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  503 bits (1295), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 243/311 (78%), Positives = 258/311 (82%), Gaps = 1/311 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNKDKPWDT DIDKW IEEFKPEDN SG PFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALD H+IAC LDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           TACDVIKIGN V+NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVVEDCM N+HPIYHIKELMIKRELAK+P+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVAR-KKPKK 239

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQ PRK+DL+IESGEYFL                        ++ER 
Sbjct: 240 IKKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299

Query: 301 KDYVAPIEKGY 311
           KDY AP EK Y
Sbjct: 300 KDYTAPKEKAY 310

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  499 bits (1286), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 241/311 (77%), Positives = 261/311 (83%), Gaps = 2/311 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNKDKPWDT ++DKW IEEFKPEDN SG+PFAEESSFMTLFPKYREAYLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TR+LD H+IAC L+LVEGSMTVKTTR+TYDPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+P+LAEEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFKKRNVAR--KKPK 238

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 +YTPFPPAQ PRK+DL+IESGEYFL+                         ERA
Sbjct: 239 KIKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERA 298

Query: 301 KDYVAPIEKGY 311
           KD++AP E  Y
Sbjct: 299 KDFIAPKETDY 309

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  496 bits (1276), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/311 (77%), Positives = 260/311 (83%), Gaps = 2/311 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M ST NKDKPWDTPD+DKW IEEF PED+ SG+PFAEESSFMTLFPKYRE YLKS+W +V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+IAC L+LVEGSM+VKTTR+TYDPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V++KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRP+LAEEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVAR--KKPK 238

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQ PRK+DL+IE+GEYFL+                        KERA
Sbjct: 239 KIKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERA 298

Query: 301 KDYVAPIEKGY 311
           KDY+AP E  Y
Sbjct: 299 KDYIAPAEPEY 309

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  495 bits (1274), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 239/314 (76%), Positives = 262/314 (83%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDT DIDKW++EEFKPEDN SG+PFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+ H+IACVLDL+EGSMTVKTTR+T+DPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVED MRN+HPIY IKELMIKRELAKRP+LAEEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVAR-KKPKK 239

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQQPRKIDL+IESGEYFL+                        + R+
Sbjct: 240 IRAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARS 299

Query: 301 KDYVAPIEKGYEGS 314
           KDY+AP E  Y+ S
Sbjct: 300 KDYIAPKEDVYKSS 313

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  491 bits (1265), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 237/317 (74%), Positives = 262/317 (82%), Gaps = 1/317 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNK+KPWDT DIDKWK+E+FKPEDN SGMPF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALDKH++AC L+LV+GSMTV TTR+TYDP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVVED MRN+HPIYHIKELMIKRELAK+P+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVAR-KKSKK 239

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPP+Q PRK+DL+IESGEYFL+                       + ER+
Sbjct: 240 PKREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299

Query: 301 KDYVAPIEKGYEGSSKK 317
           K+Y+AP E+ Y  S +K
Sbjct: 300 KNYIAPKEEKYVSSIEK 316

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  489 bits (1260), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/317 (74%), Positives = 265/317 (83%), Gaps = 1/317 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDTPDI+KW+I+EFKPEDN SG+PF EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T++LDK+++AC LDL+EGSMTVKTTR+TYDPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKREL+KRP+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVAR-KKSKK 239

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQ PRK+DL+IESGEYFL+                        KER 
Sbjct: 240 PKKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERR 299

Query: 301 KDYVAPIEKGYEGSSKK 317
           KD++AP EK Y+ S +K
Sbjct: 300 KDFIAPSEKEYKSSLQK 316

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  486 bits (1252), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 231/272 (84%), Positives = 250/272 (91%), Gaps = 1/272 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M ST+NK+KPWDT DIDKW+ EEFKPEDN SG+PFAEESSFMTLFPKYRE+YLKSVW DV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+KH+IAC+LDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVEDCM N+HPIYHIKELMIKRELAK+P+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVAR-KKPKK 239

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLT 272
                 VYTPFPP Q PRK+DL+IESGEYFL+
Sbjct: 240 IRKEKKVYTPFPPTQLPRKVDLEIESGEYFLS 271

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  480 bits (1236), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 235/314 (74%), Positives = 258/314 (82%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNKDKPWDT +IDKW  +EFK EDN SG+PFAEESSFMTLFPKYREAYLKS+WNDV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+K+++ACVLDLVEGSMTVKTTR+T DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           TACDVIKIGN V+NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARXXXXXX 240
           KEVRRVVED M+NIHPIYHIKELMIKRELAKRP+LA EDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVAR-KKPMK 239

Query: 241 XXXXXXVYTPFPPAQQPRKIDLQIESGEYFLTXXXXXXXXXXXXXXXXXXXXXXXNKERA 300
                 VYTPFPPAQ PRK+DL+IESGEYFL                         KER 
Sbjct: 240 IRKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERR 299

Query: 301 KDYVAPIEKGYEGS 314
           KD++ P E+ Y+ S
Sbjct: 300 KDFLPPKEEDYKKS 313

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
            A       A+ +L+ DD   +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ +++  R+T DP  + K  D IK 
Sbjct: 97  PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIKA 156

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  ++ +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 157 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 216

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 217 TRIVLADAKIHILGGFTHIRMAREAV 242

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   ++ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L+ DD   +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   ++ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L+ DD   +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ WN +   L  H  +   ++L   ++ ++T  + T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  + T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L+ DD   +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 98  PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 157

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  +I +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 158 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 217

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 218 TRIVLADTKIHILGGFTHIRMAREAV 243

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W+ +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  +I +  + + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   LK+ W+ +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVSNKERFVKRR-QRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  +I +  + +   + R   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 70/171 (40%), Gaps = 38/171 (22%)

Query: 54  KSVWNDVTRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQA 113
           ++VW +V RAL +   A    L  GS +V            +  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSECTAALFPRLELGSGSV------------IAPRTLLELLRRAGGSQQA 51

Query: 114 --VKILQDDTACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D     V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 SAMGPFKGLKEVRRVVEDCMRNIHPIYHIKELMIKRELAKRP---DLAEED 219
            + G +K L  +      CM  +  I HI ++  + + A+ P   DL+E D
Sbjct: 97  PSCGHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQEQDLSELD 141

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  + T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD   +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESV 249

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  + T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD   +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  +I +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  + T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD   +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 105 PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 164

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  ++ +  + + +   +   R+ G +G T  A+E  T+
Sbjct: 165 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 224

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 225 TRIVLADSKIHILGGFTHIRMARESV 250

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RRTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDTACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD   +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESI 244

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMRNIHPIYHI 200
           L+GP GNTL+ L+  +KC I ++G      G  K  K    + E  M    P++ +
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG-----RGSVKEGKHANDLPEGAMNMEDPLHCL 201

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,485,152
Number of extensions: 1239912
Number of successful extensions: 3381
Number of sequences better than 10.0: 45
Number of HSP's gapped: 3434
Number of HSP's successfully gapped: 45
Length of query: 332
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 222
Effective length of database: 40,868,139
Effective search space: 9072726858
Effective search space used: 9072726858
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)