Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F00484g1.5ON99399348370.0
Kwal_33.130051.5ON970102811171e-136
NCAS0B091101.5ON10206606592e-71
KAFR0D001401.5ON10416606559e-71
SAKL0C00462g1.5ON11773496003e-63
ZYRO0F18480g1.5ON96010385865e-62
TDEL0C069701.5ON9416165741e-60
Smik_3.141.5ON11133945488e-57
Ecym_10081.5ON11183475372e-55
KLLA0C00484g1.5ON9253265271e-54
KNAG0C002201.5ON11613455097e-52
NDAI0A001401.5ON10913585078e-52
YCL061C (MRC1)1.5ON10963395061e-51
Skud_3.31.5ON11523725052e-51
Kpol_2002.81.5ON9853474925e-50
Suva_3.1521.5ON11403364873e-49
CAGL0B00330g1.5ON11363094651e-46
AFR745W1.5ON10183074542e-45
TPHA0E040101.5ON9653334481e-44
TBLA0A075701.5ON12523724072e-39
TDEL0F030501.142ON500116820.50
KLTH0E10296g8.442ON154088762.9
SAKL0C08558g3.149ON47161753.0
KLLA0F22451g3.149ON451127726.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F00484g
         (993 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...  1867   0.0  
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   434   e-136
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   258   2e-71
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   256   9e-71
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   235   3e-63
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   230   5e-62
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   225   1e-60
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   215   8e-57
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   211   2e-55
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   207   1e-54
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   200   7e-52
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   199   8e-52
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   199   1e-51
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   199   2e-51
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   194   5e-50
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   192   3e-49
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   183   1e-46
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   179   2e-45
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   177   1e-44
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   161   2e-39
TDEL0F03050 Chr6 complement(553599..555101) [1503 bp, 500 aa] {O...    36   0.50 
KLTH0E10296g Chr5 (927506..932128) [4623 bp, 1540 aa] {ON} conse...    34   2.9  
SAKL0C08558g Chr3 (785340..786755) [1416 bp, 471 aa] {ON} simila...    33   3.0  
KLLA0F22451g Chr6 (2098204..2099559) [1356 bp, 451 aa] {ON} simi...    32   6.9  

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 993

 Score = 1867 bits (4837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 930/993 (93%), Positives = 930/993 (93%)

Query: 1   MDLIDNLRARNRGSGTAKKVKERGCDSLPLVTGTGFLFGNSVLRRVKSRLGDDENHEADS 60
           MDLIDNLRARNRGSGTAKKVKERGCDSLPLVTGTGFLFGNSVLRRVKSRLGDDENHEADS
Sbjct: 1   MDLIDNLRARNRGSGTAKKVKERGCDSLPLVTGTGFLFGNSVLRRVKSRLGDDENHEADS 60

Query: 61  TKSPIDNGCCDLSQTQVVGLAYDGEDLEQDFADSTARIEGKSWAGPTNKPNYPKDKRRVS 120
           TKSPIDNGCCDLSQTQVVGLAYDGEDLEQDFADSTARIEGKSWAGPTNKPNYPKDKRRVS
Sbjct: 61  TKSPIDNGCCDLSQTQVVGLAYDGEDLEQDFADSTARIEGKSWAGPTNKPNYPKDKRRVS 120

Query: 121 SNNSTVERRIPRSELESTEVNTQLISPHQVKEIDELETQLLLPDVDLHPTNQSSNNTILD 180
           SNNSTVERRIPRSELESTEVNTQLISPHQVKEIDELETQLLLPDVDLHPTNQSSNNTILD
Sbjct: 121 SNNSTVERRIPRSELESTEVNTQLISPHQVKEIDELETQLLLPDVDLHPTNQSSNNTILD 180

Query: 181 GTITQISGFGETCHDNAIQATSKDVSDTSTFVPITTKTKYSNSSLSFNANDPEEESNTIA 240
           GTITQISGFGETCHDNAIQATSKDVSDTSTFVPITTKTKYSNSSLSFNANDPEEESNTIA
Sbjct: 181 GTITQISGFGETCHDNAIQATSKDVSDTSTFVPITTKTKYSNSSLSFNANDPEEESNTIA 240

Query: 241 MSPADATERDRTIRKRFDAQSFIESFDDETDELQSCAASNASETEAPVLKQLEDGEKNAN 300
           MSPADATERDRTIRKRFDAQSFIESFDDETDELQSCAASNASETEAPVLKQLEDGEKNAN
Sbjct: 241 MSPADATERDRTIRKRFDAQSFIESFDDETDELQSCAASNASETEAPVLKQLEDGEKNAN 300

Query: 301 NLKKPTHFESNRENNPNKDSSSIKIFPTMFEENKADASAIILXXXXXXXXXXXXKKPSFK 360
           NLKKPTHFESNRENNPNKDSSSIKIFPTMFEENKADASAIIL            KKPSFK
Sbjct: 301 NLKKPTHFESNRENNPNKDSSSIKIFPTMFEENKADASAIILSSSSEEEEDYESKKPSFK 360

Query: 361 AAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGID 420
           AAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGID
Sbjct: 361 AAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGID 420

Query: 421 YDKITEEKNSIESLLERELARNKKIRLREIEQERQNERKDFGEQSSAFDYSNXXXXXXXX 480
           YDKITEEKNSIESLLERELARNKKIRLREIEQERQNERKDFGEQSSAFDYSN        
Sbjct: 421 YDKITEEKNSIESLLERELARNKKIRLREIEQERQNERKDFGEQSSAFDYSNDELEEEPS 480

Query: 481 XXXXXXNQSSSPVSLHSGIVCADDAVECAANRMQDLKQTIKPNEEEDAIRKSGLRKHKKF 540
                 NQSSSPVSLHSGIVCADDAVECAANRMQDLKQTIKPNEEEDAIRKSGLRKHKKF
Sbjct: 481 DEEIDENQSSSPVSLHSGIVCADDAVECAANRMQDLKQTIKPNEEEDAIRKSGLRKHKKF 540

Query: 541 CLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLNQIEQEQVGEHVGAHIENDLTTTGRNKNL 600
           CLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLNQIEQEQVGEHVGAHIENDLTTTGRNKNL
Sbjct: 541 CLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLNQIEQEQVGEHVGAHIENDLTTTGRNKNL 600

Query: 601 IKPSSRSSSFQVEDNSHEDMNPGVXXXXXXXXXXXXXXXXXXXXXXXQSKASRIIDYEAE 660
           IKPSSRSSSFQVEDNSHEDMNPGV                       QSKASRIIDYEAE
Sbjct: 601 IKPSSRSSSFQVEDNSHEDMNPGVIRELIEKHKRKELLREAKLEKLHQSKASRIIDYEAE 660

Query: 661 ESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKI 720
           ESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKI
Sbjct: 661 ESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKI 720

Query: 721 LHDIETGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEAKLLAENPKSK 780
           LHDIETGGFRKRGRNA              KYHSRRKELLRQKVSAQGEAKLLAENPKSK
Sbjct: 721 LHDIETGGFRKRGRNALDLELSDDDDEELLKYHSRRKELLRQKVSAQGEAKLLAENPKSK 780

Query: 781 AFFETIVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSF 840
           AFFETIVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSF
Sbjct: 781 AFFETIVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSF 840

Query: 841 LTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPTRNSSNMLIDD 900
           LTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPTRNSSNMLIDD
Sbjct: 841 LTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPTRNSSNMLIDD 900

Query: 901 QEDLLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLN 960
           QEDLLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLN
Sbjct: 901 QEDLLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLN 960

Query: 961 APKKVAHQQSRKRGHKPAAGFGIFASNSESFES 993
           APKKVAHQQSRKRGHKPAAGFGIFASNSESFES
Sbjct: 961 APKKVAHQQSRKRGHKPAAGFGIFASNSESFES 993

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
           YCL061C (MRC1) - protein involved in replication
           checkpoint [contig 123] FULL
          Length = 970

 Score =  434 bits (1117), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 351/1028 (34%), Positives = 525/1028 (51%), Gaps = 95/1028 (9%)

Query: 1   MDLIDNL-RARNRGSGTAKKVKERGCDSLPLVTGTGFLFGNSVLRRVKSRL---GDDE-N 55
           MDLID L   R + SG  KK+     +S P V GTGFLF NS+  +VK R+    D+E N
Sbjct: 1   MDLIDQLSNPRTKRSGFVKKLHLFDDESCPTVGGTGFLFENSIFNQVKKRIKATDDNEIN 60

Query: 56  HEADSTKSP-IDNGCCDLSQTQVVGLAYDGEDLEQDFADSTARIEGKSWAGPTNKPNYPK 114
           H A +T S  I    C   +TQ +   YDGE+LE DF  + A             P+ PK
Sbjct: 61  HNAPTTASTEILKDTC---ETQAIERPYDGEELETDFVLAKA-------------PSEPK 104

Query: 115 DKRRVSSNNSTVERRIPRSELESTEVNTQLISPHQVKEIDELETQLL--------LPDVD 166
           D    +S +S+  R   +++ E T      +  H  KE D   TQL+        + D D
Sbjct: 105 DNEVRASQSSS--RLKFQAQQEFTASGETRLDNH--KEADIANTQLIGDSISSTSICDED 160

Query: 167 LHPTNQSSNNTILDGTITQISGFGETCHDNAIQATSKDVSDTSTFVPITTKTKYSNSSLS 226
           L  T ++S+N ++    TQ      +     +QATS+D    +   P     + S   + 
Sbjct: 161 LE-TQKTSSNDMITSLTTQKIDLSHSPIKGTLQATSRD---DNLEPPTVDDREKSEGIMH 216

Query: 227 FNANDPEEESNTIAMSPADATERDRTIRKRFDAQSFIESFDDETDELQSCAASNASETEA 286
            N    E E +   +    +  +   + +++ AQ F++ FD+++D          SE E 
Sbjct: 217 TNEAHIEIEDDHSNIISKSSKSKPMVLDEKYGAQKFVDEFDEDSD---------VSECE- 266

Query: 287 PVLKQLEDGEKNANNLKKPT---HFESNRENNPNKDSSSIKIFPTMFEENKADASAIILX 343
              K+  + E   +NL++ +   +   N   + ++  + ++++ T+ ++   DA+++   
Sbjct: 267 ---KEASNPEAEKSNLRETSERRNLSLNVLPSISEGFAPLQLYHTILKQRLTDANSVEFS 323

Query: 344 XXXXXXXXXXXKKPSFKAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANK 403
                      +  S KAAILDLKAR+SKK QSL +  SK T   +S + LF+SLRKAN+
Sbjct: 324 SSDDEKSSEA-RSLSSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANR 382

Query: 404 SQILDYRKEKYQSKGIDYDKITEEKNSIESLLERELARNKKIRLREIEQERQ-------- 455
            Q++++R      +G+D  +I +EK S+ESLLERELARNKK++  EI++           
Sbjct: 383 DQLVEHRNGLLLLRGVDLAEIAKEKESVESLLERELARNKKVKQEEIQKGEDSSSDSSSD 442

Query: 456 ----NERKDFGEQSSAFDYSNXXXXXXXXXXXXXXNQSSSPVSLHSGIVCADDAVECAAN 511
               +     G  S + D SN              ++S     +  G + +   +     
Sbjct: 443 EFCNDSSTSLGSHSDSADDSN-----GYDDYNQEVDESVDTEVVDLGPLKSKHELSVKTT 497

Query: 512 RMQDLKQTIKPNEEEDAIRKSGLRKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGSNIGNL 571
            +  ++   + +EE+D +  +  +K +++ LID+D+E  S      +IDLGAYG NI   
Sbjct: 498 NLTIVRA--ESDEEDDPLNVTKKKKVRRWNLIDSDDEALSNDEQKTVIDLGAYGENI--- 552

Query: 572 NQIEQEQVGEHVGAHI---ENDLTTTGRNKNLIKPSSRSSSFQVE---DNSHEDMNPGVX 625
             +  E++ E  GA +    + +      +N  K   R  +   E   D   E  NP + 
Sbjct: 553 --LGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNP-II 609

Query: 626 XXXXXXXXXXXXXXXXXXXXXXQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLE 685
                                 +SKA+ +ID+EAEESDDEW G+GG DGE  D +DS+L+
Sbjct: 610 KNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGYDSELD 669

Query: 686 KMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIETGGFRKRGRNAXXXXXXXXX 745
           +MIDDYSN++ D   +RK+ +EEE   DK MV++ILHDIE GGFRKRGR A         
Sbjct: 670 RMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYAMDLTLSDDE 729

Query: 746 XXXXXKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFETIVEDIRSKGALEDEGPPPVR 805
                +YH+RRKELL ++ S   E  +LA NPKSKAFF++I ED   KG     G   ++
Sbjct: 730 DDDLLRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFED-DLKG-----GIANLK 783

Query: 806 GFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTH-VP 864
            + S  +P +   D     ++T +SE FVQ+TLSFL S E  +E+G    +    T    
Sbjct: 784 EYQSHASPLKAAKDEISGKRETRISEQFVQKTLSFLKSKE--DEQGDAEFVSVADTQESS 841

Query: 865 SFNTEETQDIFALKQNSSIKSLSAPTRNSSNMLIDDQEDLLSRKRACSFFARFTKRVDAN 924
           S +  E  D + LKQ S IKS SAP R+S  + + +++ +LS K   +   RF + VD N
Sbjct: 842 SGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGVLSGKANTTLVERFVRSVDTN 901

Query: 925 EKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKVAHQQSRKRGHKPAAGFGIF 984
           EKFEEG+KTV+SLNSYK+AGSS+ASIT+LGKAR L A K+  H +S   G K       F
Sbjct: 902 EKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHARSAPHGQKIMTSHQFF 961

Query: 985 ASNSESFE 992
           AS+ +SFE
Sbjct: 962 ASDGQSFE 969

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  258 bits (659), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 233/660 (35%), Positives = 341/660 (51%), Gaps = 68/660 (10%)

Query: 360  KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419
            KA +L+LKARLSKK      P     S  +S  +LF +L++A++ QILD+++E  +++G 
Sbjct: 402  KATLLNLKARLSKKK-----PVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGF 456

Query: 420  DYDKITEEKNSIESLLERELARNKKIRLREIEQER---QNERKDFGEQSSAF-----DYS 471
              + I +EK  +E+LLE E+ RNK+IR+RE ++E+   +NE  DF   ++       D  
Sbjct: 457  KLEDIEKEKEIVENLLEEEIKRNKRIRMREKQKEKSLSENEDADFDLSANELEDEEEDGV 516

Query: 472  NXXXXXXXXXXXXXXNQSSSPVSLHSGIVCADDAVECAANRMQDLKQTIKPNE----EED 527
            N              ++ S  V L +G   AD+  E  ANR  D       NE    +ED
Sbjct: 517  NDSDNIANSQISDEEDEDSDSV-LDNGNHVADE--EGDANREADNSSISSKNEISDEDED 573

Query: 528  AIRKSGLRKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLN----QIEQEQVGEHV 583
            +I +   RK K    I  + +D + +N  N IDLG YG N+ N N    Q E  +  E  
Sbjct: 574  SIFQLT-RKEKHPVRIIQESDDENEINKINTIDLGVYGGNLDNPNPLSSQTEPNEDDEDE 632

Query: 584  GAHIENDLTTTGRNKNLIKPSSRSSSFQVEDNSHEDMNPGVXXXXXXXXXXXXXXXXXXX 643
             +  EN   T      LI    +      + N+                           
Sbjct: 633  KSTYENKEITEEERHALILAEKKRIQLIEKKNA------------------------ART 668

Query: 644  XXXXQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRK 703
                +   +++ + EAEES+DEWHGIGG DGE  D++DS++EKMIDDYS S F+  E+R+
Sbjct: 669  KEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQ 728

Query: 704  RQIEEEISEDKSMVNKILHDIETGGFRKRGRNAXXXXXXXXXXXXXX--KYHSRRKELLR 761
                E    D +M+ KIL+DI+ GGFRKR R                  +YH R++EL++
Sbjct: 729  MLALENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRKRELMK 788

Query: 762  QKVSAQGEAKLLAENPKSKAFFETIVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSD-- 819
            +++   G+ K L +NPKSKAFFE++VEDI  +     +     +  + ++  EEK  D  
Sbjct: 789  KRMLEIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQEEKEQDVT 848

Query: 820  --SDKKGKKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFAL 877
               DK  KK V+SE FVQ+TLSFL SG   EE   E +L          + E  +D+F+L
Sbjct: 849  PGVDK--KKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAK------EQHGENVEDLFSL 900

Query: 878  KQNSSIKSLSAPTRNSSNMLIDDQEDL----LSRKRACSFFARFTKRVDANEKFEEGKKT 933
            KQ S+IK    P++ ++  LI++ E++    L   +  S    F+ R D NEKF++G KT
Sbjct: 901  KQRSTIKEFRNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKT 960

Query: 934  VRSLNSYKVAGSSKASITYLGKARKLNAPKKVAHQQSRKRGHKPAAGFGIFASNSESFES 993
            V     YK  GSSKASITYLGK+RKL  PKK  +++      KP     +F+S+ ESFE+
Sbjct: 961  VTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPTRS-SLFSSHDESFEN 1019

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 10/54 (18%)

Query: 29 PLVTGTGFLFGNSVLRRVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAY 82
          P V G GF+FGN+++ ++++RL   EN E   T  P        +QTQ++   Y
Sbjct: 42 PPVIGNGFIFGNALIDKIRNRLDGKENKE--DTPVP--------TQTQMIDNLY 85

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  256 bits (655), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 220/660 (33%), Positives = 337/660 (51%), Gaps = 80/660 (12%)

Query: 360  KAAILDLKARLSKKSQSLLIPRSKVTSNF-SSHQILFASLRKANKSQILDYRKEKYQSKG 418
            KA + D+KARLSKK      P  K++++  ++   LF  L+KA++ QI++++KE  + KG
Sbjct: 436  KATVFDIKARLSKKR-----PIVKISNDSKTTLHTLFNKLQKASRQQIIEHQKEVIEKKG 490

Query: 419  IDYDKITEEKNSIESLLERELARNKKIRLREIEQERQNERKDFGEQSSAFDYSNXXXXXX 478
            ++ + I +EK  +E+LLE+E+ RNKKIR RE  +ER+ +  D  +  +  D+ +      
Sbjct: 491  LNLEDIEKEKKIVENLLEQEINRNKKIRQRE--KEREKQLADAQDDENDLDFDHSANELD 548

Query: 479  XXXXXXXXNQSSSPVSLHSGIVCADDAVECAANRMQDLKQTIKPNEEEDAIRKSGLRKHK 538
                       S      S I   +D  + +  + +  K+ +   + +  I    +  + 
Sbjct: 549  ----------ESELSGEESAIDSDNDYDDFSLEKTKRSKKKVIVEDSDTEIEDEKMSHNA 598

Query: 539  KFCLIDTDEEDGSVLNSGNIIDLGAYGSN--IGNLNQIEQEQVGEHVGAHIENDLTTTGR 596
            +      +E+D S+  + N I+LG YG N  +  +    ++Q G++     E     +G 
Sbjct: 599  QI----REEKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQSGKNFKVSRE-----SGD 649

Query: 597  NKNLIKPSSRSSSFQVEDNSHEDMNPGVXXXXXXXXXXXXXXXXXXXXXXXQSKASRIID 656
             ++   P         E   HE                             + KA  I +
Sbjct: 650  ERDEEIPEKDRIRLIEEKKQHE-----------------LERQRKQMKKRKEMKAKGITN 692

Query: 657  Y---EAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISED 713
            +   EAEES+DEWHGIGG+DGE  D++DS++EKMIDDYS + F+  E+R+   +E    D
Sbjct: 693  FLEEEAEESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETD 752

Query: 714  KSMVNKILHDIETGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEAKLL 773
              MV KIL+DI+ GGFRKR + A              +Y  +R+EL+RQK    GEA+ L
Sbjct: 753  IKMVEKILYDIKNGGFRKRRKGAMDLELSDEEDDELKQYRLKRRELMRQKRLEVGEAETL 812

Query: 774  AENPKSKAFFETIVEDIRSKGALEDEGP-----PPVRGFSSVNAPEEKNSDSDKKG---- 824
             +NPKSKAFFE++V+DI     +E + P     P   G  + +   ++N++S++      
Sbjct: 813  VKNPKSKAFFESMVDDI-----VEVKNPFAVFEPQRSGTITTDDGTQENANSNEGAASQN 867

Query: 825  --KKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSS 882
              KK +LSE FVQ+TLSFL S +  ++  P  ++ +        N E  +D+ ALK+ SS
Sbjct: 868  PSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARSMRA------EANDELIEDLTALKKQSS 921

Query: 883  IKSLSAPTRNSSNMLID-DQE------DLL-SRKRACSFFARFTKRVDANEKFEEGKKTV 934
            IKS      + S    D D+E      DLL SR    S    F+  VD N+KF+EG KTV
Sbjct: 922  IKSFKTTRASVSQEPTDFDKENDDSFDDLLNSRVGTSSIMKTFSATVDINDKFQEGVKTV 981

Query: 935  RSLNSYKVAGSSKASITYLGKARKLNAP-KKVAHQQSRKRGHKPAAGFGIFASNSESFES 993
            +   +YK   SSKASITY+GK RKL AP KKVA+  S    +  +    +F+   ESFES
Sbjct: 982  KVSKAYKSVSSSKASITYMGKMRKLVAPQKKVANLSSSDIKNTNSRTSKLFSRQDESFES 1041

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 9/61 (14%)

Query: 29 PLVTGTGFLFGNSVLRRVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAY-DGEDL 87
          P +TG GFLF N  L R+K RL  +E      T         + SQTQ++   Y  GEDL
Sbjct: 38 PALTGEGFLFDNPTLNRIKKRLDGEEKDVVQYT--------MNFSQTQLISNLYGGGEDL 89

Query: 88 E 88
          +
Sbjct: 90 D 90

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  235 bits (600), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 145/349 (41%), Positives = 199/349 (57%), Gaps = 22/349 (6%)

Query: 666  WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725
            WHG+GG DGE  D++DS+LEKM+DDY+ + FD +E+R+    E+   D+ +VNKILHDI+
Sbjct: 830  WHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIK 889

Query: 726  TGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFET 785
             GGFR+RG+ A              +YH++R+ELLRQKV   GEA  L  NPKS AFFE+
Sbjct: 890  NGGFRRRGKGALDIELSDDEDDELQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFES 949

Query: 786  IVEDIR------SKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKG-------KKTVLSEA 832
            +VED+       S G   D     +     V+   E  +  D  G       K+  +S+ 
Sbjct: 950  MVEDLVESKNPFSIGETADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQE 1009

Query: 833  FVQQTLSFLTS-GEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPTR 891
            FVQ++LSFL S  E+  E   +  L          + ++ +D+F LKQNS IK+L  P R
Sbjct: 1010 FVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPAR 1069

Query: 892  NSSNMLIDDQEDLLSRK---RACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKA 948
             SS   +D + D  S     +  S  + F+ R+D NEKF+EG KTV+   SYK  G S+A
Sbjct: 1070 TSSRT-VDLEVDGNSPANGFKLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRA 1128

Query: 949  SITYLGKARKLNAPKKVAHQQSRKRGHK-PAAG---FGIFASNSESFES 993
            SITYLGK RKLNAPK+    +    GH+ P A     G+FA N +SFE+
Sbjct: 1129 SITYLGKVRKLNAPKRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFEA 1177

 Score = 85.9 bits (211), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 77/115 (66%), Gaps = 4/115 (3%)

Query: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419
           KAA+L++KAR SK+       +   T    S + LF+SL+KANK QILD+R+E  + +G+
Sbjct: 449 KAAVLEIKARTSKRQGIKKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGL 508

Query: 420 DYDKITEEKNSIESLLERELARNKKIRLREIEQERQ---NERKDFGEQSSAFDYS 471
           + + I  EK  +E+LLE+E+ RN+KIRLRE ++E++   +E++D G     FDYS
Sbjct: 509 NLEDIEREKKEVENLLEQEIERNRKIRLREKQREKKKELDEQQDGG-YPGDFDYS 562

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 37/65 (56%), Gaps = 7/65 (10%)

Query: 29 PLVTGTGFLFGNS-VLRRVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAYDGEDL 87
          P ++   FLFGNS ++ +VKSRL    N E D  +         L QTQV+   YDGEDL
Sbjct: 40 PQLSSASFLFGNSTIVDKVKSRLNGVSNEETDGERGDA------LPQTQVIPNYYDGEDL 93

Query: 88 EQDFA 92
          EQDF 
Sbjct: 94 EQDFV 98

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
           similar to uniprot|P25588 Saccharomyces cerevisiae
           YCL061C MRC1 S-phase checkpoint protein found at
           replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 960

 Score =  230 bits (586), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 300/1038 (28%), Positives = 461/1038 (44%), Gaps = 190/1038 (18%)

Query: 29  PLVTGTGFLFGNSVLRRVKSRLGDDE---NHEADSTKSPIDNGCCDLSQTQVVGLAYDG- 84
           P + G GFLF NS + +V++RL + E   N      +         L+QTQV+   Y+G 
Sbjct: 40  PPILGNGFLFQNSTIDKVRNRLRNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEGA 99

Query: 85  EDLEQDFADSTARIEGKSWAGPTNKPNYPKDKRRVSSNNSTVERRIPRS-ELESTEVNTQ 143
           E+LE+   +   R+       P +K        + SS +    + IP +  +E  E N +
Sbjct: 100 EELEEQNKER-VRL-------PLSK--------KTSSASQEKTQVIPWAPTVEGVENNVE 143

Query: 144 LISPHQVKEIDELETQLLLPDVDLHPTNQ---SSNNTILDGTITQISGFGETCHDNAIQA 200
                Q  +I E +TQ +  ++      Q   S   T ++    +IS    T       A
Sbjct: 144 -----QGTDIHEEKTQQVPNEISYDQKTQAIQSFQQTEVEPLTQRISEPERTLDVPTYAA 198

Query: 201 TSKDVSDTSTFVPITTKTKYSNSSLSFNAND---PEEESNTIAMSPAD------------ 245
           TS+D  DT    PIT +   SNS L F A D   P+     + M   +            
Sbjct: 199 TSEDQLDTQEQNPIT-QLDISNSLL-FQATDSDIPKSPPQRLKMHDIEKELEEKRQERDH 256

Query: 246 -------ATERDRTIRKRFDAQSFIESFDDETDELQSCAASNASETEAPVLKQLEDGEKN 298
                  A E+   +++ F  ++F+++FD+E+          +SE E   L+   D EK 
Sbjct: 257 RRNIEYRAPEKPVNVKRVFSKEAFLKNFDEES----------SSEDELIELRS-RDIEK- 304

Query: 299 ANNLKKPTHFESNRENNPNKDSSSIKIFPTMFE---ENKADASAIILXXXXXXXXXXXXK 355
                K T  + +   N  + S   ++F +++E   + + D+   I             +
Sbjct: 305 -----KHTEKDKSTLENTTESSQRQRVF-SVYEYKLKGELDSKRCIQLDDDEDESDEDVE 358

Query: 356 KP---SFKAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKE 412
            P     KA +LD+KAR SK+      P SK+    ++   L  +L+KA+K QI D++ E
Sbjct: 359 VPLSRVSKATVLDIKARRSKQE-----PLSKIKQKKTTLNDLICTLKKASKKQITDHQNE 413

Query: 413 KYQSKGIDYDKITEEKNSIESLLERELARNKKIRLREIEQERQNERKDFGEQSSAFDYSN 472
             +S+G   + I ++K  IE+LLE+E+ARNK++  RE E++  N+ +D      ++   N
Sbjct: 414 LMKSRGYKLEDIEKQKEEIENLLEQEIARNKRLARRENEEDNSNDLED-----RSYGSGN 468

Query: 473 XXXXXXXXXXXXXXNQSSSPVSLHSGIVCADDAVECAANRMQDLKQTIKPNEEEDA---- 528
                         N + S +   SG   +DD  E   N   +  Q  K  E  D+    
Sbjct: 469 ESE-----------NSAFSDIEF-SGDSESDDGQEDDMNNDDERVQKEKMQEAGDSDNIS 516

Query: 529 -------------IRKSGLRKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLNQIE 575
                        I+K   + HK     D+D E    L   NIIDLG YG+N+    Q+ 
Sbjct: 517 AREDHSDEEDEDSIQKGRTKNHKMLPAEDSDSEHDDTL-PRNIIDLGPYGNNL----QVN 571

Query: 576 QEQVGEHVGAHIENDLTTTGRNKNLIKPSSRSSSFQVEDNSHEDMNPGVXXXXXXXXXXX 635
            E+  E++                   P S S+     D + E+    +           
Sbjct: 572 HEEDMENL-------------------PLSDSAEI---DAAEEEKTNELIMEKIRKIEMR 609

Query: 636 XXXXXXXXXXXXQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSR 695
                           +++++ EAEES+DEW G+GGVDG+  D+HDSDLE+MIDD++ S 
Sbjct: 610 KKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGGVDGDLSDEHDSDLEEMIDDFTKSN 669

Query: 696 FDSSEVRKRQIEEEISEDKSMVNKILHDIETGGFRKRGRNAXXXXXXXXXXXXXXKYHSR 755
            +  +VR+   +E    D+ MVNKIL+DI+ GGFRKRGRNA               Y  +
Sbjct: 670 ENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNALDLELSDDEDEDLRNYRLK 729

Query: 756 RKELLRQKVSAQGEAKLLA-ENPKSKAFFETIVEDIRSKGALEDEGPPPVRGFSSVNAPE 814
           R+EL++ K   +G+ K  A  N KSKAF E++V+DI       DE   P   F       
Sbjct: 730 RRELMK-KSRIEGKDKEKAFRNAKSKAFLESMVDDI-------DESKNP---FGDPEMDV 778

Query: 815 EKNSDSD-------KKGKKTVLSEAFVQQTLSFLTSGEVGE--EKGPENNLGSLPTHVPS 865
           E N+D D       K  +K  LS+ FVQ++LSFL++       E G +  LG        
Sbjct: 779 EDNTDVDTQENDYPKNKEKNTLSQEFVQRSLSFLSNNNSSREFELGEQITLG-------- 830

Query: 866 FNTEETQDIFALKQNSSIKSLSAPTRNSSNMLIDD------QEDLLSRK--RACSFFARF 917
              +E QD+ +LK+NSSI +L     NSS+ + +D       ED ++    +  S     
Sbjct: 831 ---DEEQDVSSLKRNSSIHAL----HNSSSPIKEDLEKENQDEDFITLPNFKPPSLIKSL 883

Query: 918 TKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKVAHQQSR--KRGH 975
               D N KF+ GKKTV    SY+  G S++SITY GK RKL  PK      S+  +   
Sbjct: 884 AGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPAS 943

Query: 976 KPAAGFGIFASNSESFES 993
           KP  G  ++ S   SF++
Sbjct: 944 KPTMG-KLWESQQNSFDT 960

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
           YCL061C
          Length = 941

 Score =  225 bits (574), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 192/616 (31%), Positives = 298/616 (48%), Gaps = 71/616 (11%)

Query: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419
           KA +L LKARLSK+      P  +     +S   L  +LR + K QILD +KE  + +G+
Sbjct: 357 KATVLKLKARLSKRR-----PPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGL 411

Query: 420 DYDKITEEKNSIESLLERELARNKKIRLREIEQERQNERKDFG-----EQSSAFDYSNXX 474
            ++ + +EK  +E+LLE+E+ARNK+IR++E E+ + N+          E+ +  +YS   
Sbjct: 412 KFEDVEKEKEIVENLLEQEIARNKRIRMKEKEKAQMNDVPSLALPNRVEEDNDSNYSVSD 471

Query: 475 XXXXXXXXXXXXNQSSSPVSLHSGIVCADDAVECAANRMQDLKQTIKPNEEEDAIRKSGL 534
                       +  S     +   + +D A              ++ + +ED IR    
Sbjct: 472 EDSVIKEDLDYSDLESDDSGSNEPKIASDSA-------------GVEIDSDEDDIRFMKG 518

Query: 535 RKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLNQIEQEQVGEHVGAHIENDLTTT 594
           + HK   L D + E+   L   + I+LGAYG N+    + E     E     + N+++ +
Sbjct: 519 KAHKISLLNDDESEEEEDLTVNSAINLGAYGDNLITTTKDEAHTSAEEHTTQLVNEISES 578

Query: 595 GRNKNLIKPSSRSSSFQVEDNSHEDMNPGVXXXXXXXXXXXXXXXXXXXXXXXQSKASRI 654
            + + + K  S+  + Q E    + M                           +S  + +
Sbjct: 579 -QYRTMEKEKSKIRA-QEEKQRLKQM--------------------------KESGVTNM 610

Query: 655 IDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDK 714
            D EAEESDDEW G+GGVDGE  DD+DSDLEKMIDD+SN+  ++ ++R+  + E    D 
Sbjct: 611 FDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQIRQLLMAENKETDL 670

Query: 715 SMVNKILHDIETGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQ-KVSAQGEAKLL 773
             VNKILHDI+ GGFRKR +N                Y  R+ EL+R+ ++    + K L
Sbjct: 671 KTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELLNYKKRKLELMRKRRLQFGADDKKL 730

Query: 774 AENPKSKAFFETIVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKGKKTVLSEAF 833
            +N +SKAFFE++VEDI     ++ + P     FS+    + + S+ DKK +  V +   
Sbjct: 731 LKNSRSKAFFESMVEDI-----IDLKDP-----FSN----QAETSEKDKKSEGLVDASNK 776

Query: 834 VQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPTRNS 893
            + T+S     +         +         S   E   D+ +LKQ+S++K+L AP+   
Sbjct: 777 QKDTISHEFVQQSLSFLSSSRDFSEFEVARVSQEGERNTDLNSLKQDSTVKTLYAPSNII 836

Query: 894 SNMLIDDQED-----LLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKA 948
           S     D E+     L       S    F   ++AN+K +EG+KTV    SY+  G +KA
Sbjct: 837 SESERADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKA 896

Query: 949 SITYLGKARKLNAPKK 964
           SITYLGK RKL APKK
Sbjct: 897 SITYLGKMRKLVAPKK 912

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  215 bits (548), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 151/394 (38%), Positives = 201/394 (51%), Gaps = 69/394 (17%)

Query: 651  ASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEI 710
             +   + EAEESDDEWHGIGG DGE  D++DSD+EKMIDDYS + F+S E+R+    E  
Sbjct: 738  VTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAENK 797

Query: 711  SEDKSMVNKILHDIETGGFR-KRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGE 769
              D  M+NKIL+DI+ GGFR KR +N+              +Y  +R+EL+R++    G+
Sbjct: 798  EMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGD 857

Query: 770  AKLLAENPKSKAFFETIVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSD---------- 819
               L +NPKSKAFFE++VEDI        E   P R      A EE N D          
Sbjct: 858  GTKLVKNPKSKAFFESMVEDIM-------EYKNPFR------AEEESNQDITSTATDLDT 904

Query: 820  -------------------SDKKGKKTVLSEAFVQQTLSFLTSGEVGE-EKGPENNLGSL 859
                                D K KK ++SE FVQ++LSFL S    E E   E     L
Sbjct: 905  LDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMDKE-----L 959

Query: 860  PTHVPSFNTEETQDIFALKQNSSIKSL------SAPTRNSSNML-----IDDQED----- 903
                   + E  +D+F LKQ+SSIKS       S  +R  + M+      +D+++     
Sbjct: 960  AKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGD 1019

Query: 904  --LLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNA 961
              L+S  +  S    F  R D N+KF+EG KTV+   SYK+ GSSKASITY+GK RKL A
Sbjct: 1020 SSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMA 1079

Query: 962  PKKVA--HQQSRKRGHKPAAGFGIFASNSESFES 993
            PK+ A   Q   +          +F S   SF+S
Sbjct: 1080 PKRKAGTDQNHHRHKKTKTKTSKLFESGQNSFDS 1113

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 7/64 (10%)

Query: 29  PLVTGTGFLFGNSVLRRVKSRL--GDDENHEADSTKSPIDNGCCDLSQTQVVGLAYD-GE 85
           P +TG GFLF N+ L RVK+RL  G     E D+     D+   D+S +Q++   Y+ GE
Sbjct: 47  PALTGNGFLFANATLNRVKNRLEGGKAPEQEHDNK----DDEDEDVSSSQLIANLYEGGE 102

Query: 86  DLEQ 89
           DLE+
Sbjct: 103 DLEE 106

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  211 bits (537), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 135/347 (38%), Positives = 199/347 (57%), Gaps = 14/347 (4%)

Query: 651  ASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEI 710
             +++++ EA+ES+DEWHG+GGVD E  D++DSDL+KMIDDY+ + FD  E+RK    E++
Sbjct: 782  VNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKILASEDL 841

Query: 711  SEDKSMVNKILHDIETGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEA 770
              DK+MVNKILHDI+TGGFRKRGR                 Y ++R    +QK+      
Sbjct: 842  QHDKNMVNKILHDIKTGGFRKRGRGELDLELSEDEDGILQSYRAKRWNEQKQKMLDSEHN 901

Query: 771  KLLAENPKSKAFFETIVED--IRSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKGKKTV 828
              +  NPKS  FFE++V++  I  + AL     PP +   S N  E K +      +K V
Sbjct: 902  TSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPPAQ---STNVLELKQN----TKQKIV 954

Query: 829  LSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSA 888
            +SE FV+QTLSFLTS E       E N+   P +     + E +D++ LK+ S+IK L+ 
Sbjct: 955  ISEHFVKQTLSFLTSDENMTNMRSEINVEK-PNNDNDIYSSEVEDLYTLKETSTIKVLN- 1012

Query: 889  PTRNSSNMLIDDQEDLLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKA 948
             T +   ++ +D++      +A S    F  R D N+KF++G K+V+  N YK  GSS+A
Sbjct: 1013 -TYSGKPIVNEDEDGAEFGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRA 1071

Query: 949  SITYLGKARKLNAPKKVAH--QQSRKRGHKPAAGFGIFASNSESFES 993
            +IT+LGK RKL  PK+ +   + S  R  K       F  N+++FE+
Sbjct: 1072 AITFLGKKRKLIIPKRSSKSPRDSAHRSIKNRLKHQAFLENTDTFEA 1118

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 68/96 (70%), Gaps = 2/96 (2%)

Query: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419
           KAA+L++KA++SK     L   ++ + N  + + LF SL+KANK QILD+R+E  + +GI
Sbjct: 443 KAALLNIKAKISKNMN--LSKNAEQSINSPTLKQLFISLKKANKKQILDHRREITEKRGI 500

Query: 420 DYDKITEEKNSIESLLERELARNKKIRLREIEQERQ 455
             +++ +E+  +E LLE+++ RN++IRLRE ++E +
Sbjct: 501 SLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKENE 536

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 15/97 (15%)

Query: 1  MDLIDNLRARNRGSGTAKKVKERGCDSLPLV----TGTGFLFGNSVLRRVKSRLGDDENH 56
          MDL++ L  + R   T K   E+       +    +    +F N+++ +V++RL      
Sbjct: 1  MDLLNLLPGKARRKTTYKIEHEKLSQEAGYIIIKPSNAENVFANAIVDKVRNRL------ 54

Query: 57 EADSTKSP--IDNGCCDLSQTQVVGLAYDGEDLEQDF 91
             +  SP  +D     LS+T  VG  YDGE LE+DF
Sbjct: 55 -EGTISSPDRLDTLSSKLSET--VGNLYDGEALEEDF 88

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 925

 Score =  207 bits (527), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 127/326 (38%), Positives = 185/326 (56%), Gaps = 31/326 (9%)

Query: 666 WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725
           WHG+GG DGE  DD+DSDL+ MIDD+S S+FD++ +R+R   E    D+ M+NKILHDI 
Sbjct: 630 WHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDIN 689

Query: 726 TGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFET 785
           TGGFRKRGR A              ++  +R+E+++QK+    +   +  N KSKAFF++
Sbjct: 690 TGGFRKRGRGALDLELSDDEDELLRQFREKRREIMKQKLLENVDG--VVNNSKSKAFFDS 747

Query: 786 IVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSFLTSGE 845
           +VEDI  K        P V  FS        N+  +   KK V+SE FVQ +LSFL++  
Sbjct: 748 MVEDITRKSI------PAVTSFS--------NTRDEMGKKKIVISEEFVQSSLSFLSA-- 791

Query: 846 VGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPTRNSSNMLIDDQEDLL 905
                  ++++      V     + T+D+ +LKQ S+IKSL +P RN ++   DD +   
Sbjct: 792 ------KDDDINEF--EVTEAAHDATEDLESLKQRSNIKSLDSPQRNRNSAFFDDVDGTS 843

Query: 906 SRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKV 965
              +  S    F+   D N+KF+ G KTV    SY+VA  S+++IT+LGK RKL AP+  
Sbjct: 844 LDFKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQ-- 901

Query: 966 AHQQSRKRGHKPAAGFGIFASNSESF 991
             ++S     KP +   +F SNS+SF
Sbjct: 902 -GRKSTPLVRKPTS--SLFDSNSDSF 924

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  200 bits (509), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 184/345 (53%), Gaps = 31/345 (8%)

Query: 666  WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725
            WHGIGG+DGE  D++DS++EKMIDDYS +  D  E+RK  + E    D  MVNKIL DI+
Sbjct: 825  WHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIK 884

Query: 726  TGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFET 785
             G FRKRGR+               +Y  +R EL++Q++   G+ K L +N K+KAFF++
Sbjct: 885  NGNFRKRGRDTLELELSDEEDDDLRQYRQKRNELMKQRLLDLGDDKKLVKNVKTKAFFDS 944

Query: 786  IVEDIRSK----GALEDEGPPPVRGFS--------SVNAPEEKNSDSDKKGKKTVLSEAF 833
            +VEDI       G + D         +        SV+  EEK   + +KGKKTVLSE F
Sbjct: 945  LVEDIVEVKNPFGVMSDNETQDTDETTTIDTQTRESVSNKEEK--PTQEKGKKTVLSEEF 1002

Query: 834  VQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPTRNS 893
            VQ++LSFL S     E     +L  L       + ++  D++ LK+ SS+KS  +    +
Sbjct: 1003 VQRSLSFLNSNRNLTEFEQNQDLARLQ------HDDDVSDLYTLKKQSSVKSFKSVGSKN 1056

Query: 894  SNMLIDDQED-----LLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKA 948
              + +D  ++       +  R  S    F  +++ ++KF  GKKTV++  SYK  G SK 
Sbjct: 1057 EIINVDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKT 1116

Query: 949  SITYLGKARKLNAPKKVAHQQSRKRGHKPAAGFGIFASNSESFES 993
            S+TY+ K RKL APK      S K+ H       I A  S SF+S
Sbjct: 1117 SVTYMNKVRKLTAPK------SLKKLHSTGGERKISAQTSHSFKS 1155

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 394 LFASLRKANKSQILDYRKEKYQSKGIDYDKITEEKNSIESLLERELARN 442
           LF+ L+K N+ QIL ++ E   +KGI++  +  EK  +E LLE+E+ RN
Sbjct: 583 LFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEILRN 631

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 12/84 (14%)

Query: 16  TAKKVKERGCD-------SLPL-VTGTGFLFGNSVLRRVKSRLG--DDENHEADSTKSPI 65
           T KKV++   D        +P  + G GFLFGN+ + ++K+RL   D  N   D TKS  
Sbjct: 18  TYKKVQQNSTDEAAGDDDCVPTSLAGNGFLFGNATVDKIKNRLNNEDHPNSSIDVTKSSS 77

Query: 66  DNGCCDLSQTQVVGLAYD-GEDLE 88
           ++    +SQ+Q++   YD GEDLE
Sbjct: 78  EDQIP-VSQSQLLSTLYDGGEDLE 100

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  199 bits (507), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 146/358 (40%), Positives = 198/358 (55%), Gaps = 38/358 (10%)

Query: 666  WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725
            WHGIGG+DGE  D++DSD+EKMIDDYS + FD +E+R+    E    D +M+NKIL+DI+
Sbjct: 740  WHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIK 799

Query: 726  TGGFRKRGRNAXXXXXXXXXXXXXXK-YHSRRKELLRQKVSAQG-EAKLLAENPKSKAFF 783
             GGFRKR R                + YH +RKEL+R++    G + K L +NPKSKAFF
Sbjct: 800  NGGFRKRKRGGLELELSEDEDDDALREYHLKRKELMRKRRLELGDDEKKLVKNPKSKAFF 859

Query: 784  ETIVEDIR-SKGALEDEGPPPVRGFSSVN-----------APEEKNSDS-DKKGKKTVLS 830
            E++VEDI   K A  DE P        +N           A  ++N DS   K KKT++S
Sbjct: 860  ESMVEDITDDKNAFNDE-PLGETSTQEINNTQDDMKEEDAAVVKENGDSKRIKKKKTIIS 918

Query: 831  EAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPT 890
            E FVQ+TLSFL S    EE     NL     H       + +++ +LKQ SSIK   +P+
Sbjct: 919  EEFVQRTLSFLKSSREDEEFAMNENLAK-EQH-----GTKVENLLSLKQQSSIKVFQSPS 972

Query: 891  RNSSNML---------IDDQEDLLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYK 941
             NSS ++          DD++  ++  +  S    F  + D NEKF++G KTV    SY+
Sbjct: 973  NNSSKVIKLDDINNDDDDDEDSPIALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYR 1032

Query: 942  VAGSSKASITYLGKARKLNAPKKVAHQQSRKR---GHKPAAG---FG-IFASNSESFE 992
              GSSKASITYLGK+RKL AP     +  R R    +K   G    G +F++  +SFE
Sbjct: 1033 TVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVTDNNKITKGERNIGSLFSTGDDSFE 1090

 Score = 68.6 bits (166), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 115/223 (51%), Gaps = 19/223 (8%)

Query: 360 KAAILDLKARLSK-KSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKG 418
           KA IL +KARLSK KS+  +     V +N +    LF +L+K+++ QIL+ ++E  ++KG
Sbjct: 451 KATILTIKARLSKQKSKKNVQKDGTVNTNLNK---LFENLKKSSRKQILENQRELIENKG 507

Query: 419 IDYDKITEEKNSIESLLERELARNKKIRLREIEQERQNERKDFGEQSSAFDYSNXXXXXX 478
           ++++ I  EK  +E+LLE+E+ RN+KIR R  E+ER++++ +  +  S  D         
Sbjct: 508 LNFEDIEMEKELVENLLEQEIKRNQKIRQR--EKEREDKKNNANDSDSVNDSDVEFDLSA 565

Query: 479 XXXXXXXXNQSSSPVS---LHSGIVCADDAVECAANRMQDLKQTIKPNEEEDAI------ 529
                   +   S VS   +   +V     ++    + +D+   +  +EEE+        
Sbjct: 566 NEQEEQESDAELSDVSKPDIDEEVVYQRRNIDEDGIQDEDVLDNVDADEEEEEAPLQLSK 625

Query: 530 RKSGLRKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLN 572
           R +G+       +I   E+D   ++  N IDLGAYG N+   N
Sbjct: 626 RSNGVTAK----IISVSEDDEDTISKRNAIDLGAYGDNLTTAN 664

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 24  GCDSLPLVTGTGFLFGNSVLRRVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAY- 82
           G +  P + GTGFLF NS + +V++RL      E +  K+P+        +TQ++   Y 
Sbjct: 43  GGNVTPTILGTGFLFKNSTIDKVRARLSGKNYIEQE--KTPL---ASSEQETQIITNLYT 97

Query: 83  DGEDLEQDF 91
           +GEDLE+D 
Sbjct: 98  NGEDLEKDL 106

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  199 bits (506), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 134/339 (39%), Positives = 184/339 (54%), Gaps = 50/339 (14%)

Query: 666  WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725
            WHGIGG DGE  DD+DSDLEKMIDDYS + F+  E+R+    E    D  M+NKIL+DI+
Sbjct: 730  WHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIK 789

Query: 726  TGGFR-KRGRNAXXXXXXXXXXXXX-XKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFF 783
             GGFR KR +N+               +Y  +R+EL+R++    G+   L +NPKS AFF
Sbjct: 790  NGGFRNKRAKNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEIGDDAKLVKNPKSSAFF 849

Query: 784  ETIVEDI---RSKGALEDEGPPPVRGFS--------SVNAPEEKNSDS----DKKGKKTV 828
            E++VEDI   ++    E+E    +   +        S+N  +   ++     D+K KK +
Sbjct: 850  ESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNKKVI 909

Query: 829  LSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPT-----HVPSFNTEETQDIFALKQNSSI 883
            +SE FVQ++LSFL S          NN     T      +   N E  +D++ LKQNSSI
Sbjct: 910  ISEDFVQKSLSFLKS----------NNYEDFETDKELSRIQHGNDEAIEDLYTLKQNSSI 959

Query: 884  KSLS-----APTRNSSNMLID-----DQED--------LLSRKRACSFFARFTKRVDANE 925
            KS +     + T  + N +ID     + ED        L+   +  S    F  R D N+
Sbjct: 960  KSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDIND 1019

Query: 926  KFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKK 964
            KF+EG KTV+ L SYK  GSSKASITY+GK RKL APK+
Sbjct: 1020 KFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKR 1058

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419
           KA IL+LKARLSK++Q L    +K       H +L  +LRKA++ QILD++KE  ++KG+
Sbjct: 438 KATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGL 497

Query: 420 DYDKITEEKNSIESLLERELARNKKIRLREIEQERQNERKDF 461
             + + +EK  +E+LLE+E+ RNK+IR +E  +E+  E  DF
Sbjct: 498 KLEDMAKEKEIVENLLEQEILRNKRIRQKEKRREKL-EENDF 538

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  199 bits (505), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 139/372 (37%), Positives = 202/372 (54%), Gaps = 54/372 (14%)

Query: 666  WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725
            WHG+GG DGE  +++DS++EKMIDDYS + F+S E+R+    E    D  M+N+IL+DI+
Sbjct: 791  WHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIK 850

Query: 726  TGGFR-KRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFE 784
             GGFR KR +N+              +Y  +R+EL+R++    G+   L +NPKSKAFFE
Sbjct: 851  NGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFE 910

Query: 785  TIVEDIRS-KGALEDEGPPPVRGFSSVNAPEEKNSDS---------------DKKGKKTV 828
            ++VEDI   K   + E        S+    + +++DS               D + KKT+
Sbjct: 911  SMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTI 970

Query: 829  LSEAFVQQTLSFLTSG-----EVGEEKG-PENNLGSLPTHVPSFNTEETQDIFALKQNSS 882
            +SE FVQ++LSFL S      E+ +E+   ++++G           E  +D+F LKQ+SS
Sbjct: 971  ISEDFVQKSLSFLRSNNYDEFEMDKERARIQHDIGD----------EGVEDLFTLKQHSS 1020

Query: 883  IKSLS-APTRNSS----NMLID-----------DQED--LLSRKRACSFFARFTKRVDAN 924
            IKS + +PT + S    N +ID           + ED  L+   +  S    F  R D N
Sbjct: 1021 IKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDIN 1080

Query: 925  EKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKVAHQQSRKRGHKPAAGF--- 981
            +KF+EG KTV+   +YK  GSSKASITY+GK RKL APKK A +      H  A      
Sbjct: 1081 DKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDHHHNHHSKAWKTQKS 1140

Query: 982  GIFASNSESFES 993
             +F S  +SF+S
Sbjct: 1141 KLFESGQDSFDS 1152

 Score = 75.1 bits (183), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 61/87 (70%)

Query: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419
           KAAIL+LKARLSK+SQ+L    +K       H  LF  LRKA++ QILD+++E  ++KG 
Sbjct: 496 KAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKGF 555

Query: 420 DYDKITEEKNSIESLLERELARNKKIR 446
             + + +EK  +E+LLE+E+ RN++IR
Sbjct: 556 KLEDMAKEKEIVENLLEQEILRNRRIR 582

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 29  PLVTGTGFLFGNSVLRRVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAYD-GEDL 87
           P +TG GFLFGN+ L RVK+RL   +  E D  +   DN   D   TQ++   YD GEDL
Sbjct: 102 PALTGNGFLFGNATLNRVKNRLEGIDVPEDD--RQIKDNENEDAVSTQLIANLYDGGEDL 159

Query: 88  EQ 89
           E+
Sbjct: 160 EE 161

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
           complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  194 bits (492), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 187/347 (53%), Gaps = 38/347 (10%)

Query: 666 WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725
           WHGIGGVDGE  D++DS++EKMIDDYS   F++ E+R++   E    D  MVN+IL+DI+
Sbjct: 656 WHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIK 715

Query: 726 TGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFET 785
            GGFRKR RNA               Y ++R++L+++K       K L  N KS AF E+
Sbjct: 716 NGGFRKR-RNALEIELSDDEDDDLKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLES 774

Query: 786 IVEDI---------RSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQ 836
           +V+DI         R    ++D   P       VN+ E  N     K KK +LSEAFVQ+
Sbjct: 775 MVDDIVEVKNPFDERDDNIMDD--TPETDAEGDVNSNELLN-----KKKKFILSEAFVQK 827

Query: 837 TLSFLTSGEVGEEKGPENNLGS-LPTHVPSFNTEETQDIFALKQNSSIKSL-SAPTRNSS 894
           +LSFL+S    EE    NNL     +H  +       D+FALK + SIKSL S P   S 
Sbjct: 828 SLSFLSSSRNLEEFEMNNNLAKEQHSHAAT-------DMFALKSHCSIKSLESLP--GSH 878

Query: 895 NMLIDDQEDLLSRKRACSFFARFTK---------RVDANEKFEEGKKTVRSLNSYKVAGS 945
           N  I  + DLL  +   + F+   +          +D + KF++G KTV+   SY+  GS
Sbjct: 879 NNSISSKLDLLHEEIVSTPFSGLKQTSVIKSFSSSIDIDSKFKDGNKTVKVSKSYRTVGS 938

Query: 946 SKASITYLGKARKLNAPKKVAHQQSRKRGHKPAAGFGIFASNSESFE 992
           +KASITYLGKARKL  PKK  H+    +  K A+   +F     SFE
Sbjct: 939 AKASITYLGKARKLVPPKKKEHKPHSHKS-KTASASRLFDEQDNSFE 984

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 135/515 (26%), Positives = 227/515 (44%), Gaps = 91/515 (17%)

Query: 1   MDLIDNLRARNRGSGTAKKVKERGCDSLPLVT---------GTGFLFGNSVLRRVKSRL- 50
            D +D L+ + R   T KKV +   +  P ++         G   LF NS L+++++RL 
Sbjct: 5   FDGLDALKGKKRT--TYKKVTDGDVEDEPKISEFNIELPGLGQSILFNNSKLKQIRNRLE 62

Query: 51  GDDENHEADSTKSPIDNGCCDLSQTQVVGLAYDG-EDLEQD----FADSTARIEGKSWAG 105
           G++ + E DS+++        ++ TQ++   Y+G EDLE+     F   T  +E  +   
Sbjct: 63  GNNNDSENDSSQAE----TQVIADTQIISNLYEGGEDLEEKEERRFLQRTQIVEDHTQII 118

Query: 106 PTNKPNYPKDKRRVSSNN-STVERRIPRSELESTEVNTQLISPHQVKEIDELETQLLLPD 164
             +     K    + SN     ++ I  S+ E T++        Q+ ++D+L   L + D
Sbjct: 119 DASVTYSSK---TIESNKMDNTQKYINASDSEPTQI--------QISKVDKL---LKITD 164

Query: 165 VDLHPTNQSSNNTILDGTI-TQI--SGFGETCHDNA-IQATSKD-------------VSD 207
                 N  S   +LD T+ TQ   + +G+T  D   +  T  D             +  
Sbjct: 165 ------NLDSQKKVLDTTLETQELETQYGKTQVDKTQVDKTQVDKTQIFPTLVADDEIKH 218

Query: 208 TSTFVPITTKTKYSNSSLSFNANDPE-EESNTIAMSPADATERDRTI-----RKRFDAQS 261
           +ST V       +SNS L  N  + + +E + I    +  TE  R I     + +F    
Sbjct: 219 SSTAVQTVDDNTHSNSELKINEIERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKND 278

Query: 262 FIESFDDETDELQSCAASNASETEAPVLKQLEDGEKNANNLKKPTHF--ESNRENNPNKD 319
           F+E FD  + E         S TE        + E +     K + F   SN EN   KD
Sbjct: 279 FLEHFDSSSSEEDEEGVVKLSSTEPETAAM--NLENSLPQFSKESKFIGLSNYENILKKD 336

Query: 320 SSSIKIFPTMFEENKADASAIILXXXXXXXXXXXXKKPSFKAAILDLKARLSKKSQSLLI 379
            +          E++ + ++ +                + KA IL +KA LS+       
Sbjct: 337 INKQNCIEFSDSEDETEVTSKV--------------SRASKATILSIKANLSRHK----- 377

Query: 380 PRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGIDYDKITEEKNSIESLLEREL 439
           P     +N ++   LF+ L+KA K+QILD++KE  + KG   ++I +EK  +E+LLE+E+
Sbjct: 378 PAQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQEI 437

Query: 440 ARNKKIRLREIEQERQNERK---DFGEQSSAFDYS 471
            RN+KIR+RE ++E   +RK   + G+Q   F  S
Sbjct: 438 ERNRKIRIREKQKEELKKRKQRIENGDQEEDFAIS 472

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  192 bits (487), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 179/336 (53%), Gaps = 42/336 (12%)

Query: 666  WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725
            WHG+GG DGE  D++DS++EKMIDDYS ++F+S E+R+    E    D  M+NKIL+DI+
Sbjct: 779  WHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIK 838

Query: 726  TGGFR-KRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFE 784
             GGFR KR +N+              +Y  +R+EL+R++    G+   L +NPKSKAFFE
Sbjct: 839  NGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFE 898

Query: 785  TIVEDI---RSKGALEDEGPPPVRGFSS--------------VNAPEEKNSDSDKKGKKT 827
            ++VEDI   ++    E E    V   ++                +  E N     K KK 
Sbjct: 899  SMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKL 958

Query: 828  VLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTE-ETQDIFALKQNSSIKSL 886
            ++SE FVQ++LSFL S    E +     +      +   N E +  D+F LKQ+SSIKS 
Sbjct: 959  IISEDFVQKSLSFLKSNNYDEFE-----MDRELARIQHGNGEGDVVDLFTLKQHSSIKSF 1013

Query: 887  SAPTRNS-----SNMLIDDQE-------------DLLSRKRACSFFARFTKRVDANEKFE 928
            +    NS      N +I+ +E              L+   +  S    F  R D N+KF+
Sbjct: 1014 TNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFK 1073

Query: 929  EGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKK 964
            EG KTV+   SYK  GSSKASITY+GK RKL APK+
Sbjct: 1074 EGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKR 1109

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 67/132 (50%), Gaps = 28/132 (21%)

Query: 24  GCDSLPLVTGTGFLFGNSVLRRVKSRL-GDDENHEADSTKSPIDNGCCDLSQTQVVGLAY 82
           G ++ P +TG GFLFGN+ L RVK+RL G +E  +    K   +N   D+  TQ++   Y
Sbjct: 85  GMNAPPALTGNGFLFGNATLNRVKNRLEGRNELGQDGQDK---ENEDEDVFSTQLIANLY 141

Query: 83  D-GEDLEQDFADSTARIEGKSWAGPTNKPNYPKDKRRVSSNNSTVERRIPRSELESTEVN 141
           D GE+LE                   +K N  K+ ++V+ ++ T  +RIP S    T+ N
Sbjct: 142 DGGEELE-------------------SKSNGDKNNQKVNVSSFTQTQRIPVS---ITQQN 179

Query: 142 TQLISP-HQVKE 152
            ++  P H + E
Sbjct: 180 NEINVPIHSINE 191

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  183 bits (465), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 119/309 (38%), Positives = 174/309 (56%), Gaps = 26/309 (8%)

Query: 666  WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725
            W GIGGVDG+ F ++DS++EKMIDDYS +  D + +R++ ++E    D  +VNKIL+DI+
Sbjct: 818  WRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIK 877

Query: 726  TGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFET 785
             GGFRKRGRN               ++  +R+EL++Q++    +   L +NPKSKAFFE+
Sbjct: 878  NGGFRKRGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFES 937

Query: 786  ----IVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSFL 841
                +VED  +   L D+        +  +  +E N     K  K  +SE FVQ+TLSFL
Sbjct: 938  MIVDLVEDKNNFDDLSDQIELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFL 997

Query: 842  TSGEVGEEKGPENNLGSLPTHVPSFNTEETQ---DIFALKQNSSIKSLSAPTRNSSNMLI 898
             + E  +E              PSF   + +   D+ ALK NSS+   S  +  +S  +I
Sbjct: 998  HNDESTQE------------FQPSFIMSKEKGIGDMNALKSNSSLSFCSKLS--TSRKII 1043

Query: 899  DDQEDLL----SRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLG 954
            +D+ED++    S KR  S    F+ +   ++KF++G K+V+   SYK  G SKASITYLG
Sbjct: 1044 NDEEDVIEEFESFKRP-SIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLG 1102

Query: 955  KARKLNAPK 963
            K RKL  PK
Sbjct: 1103 KTRKLVPPK 1111

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 71/115 (61%), Gaps = 11/115 (9%)

Query: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419
           KA +L+LK RLSKK      P  KV +   S  +LF +LRKA K QI+ +RKE  +S+G+
Sbjct: 537 KATLLNLKVRLSKKK-----PVKKVHNEKDSTNLLFNNLRKATKQQIMLHRKELMESRGL 591

Query: 420 DYDKITEEKNSIESLLERELARNKKIRLREIEQERQNERKDFGEQ---SSAFDYS 471
           +++ + ++K  +E LLE+E+ RN KIR RE   +R+   +   EQ    S ++YS
Sbjct: 592 NFEDLEKQKVMVEDLLEKEIERNLKIRERE---KRKESNEPLAEQEIMESDYEYS 643

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  179 bits (454), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 112/307 (36%), Positives = 166/307 (54%), Gaps = 29/307 (9%)

Query: 666 WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725
           WHGIGG D E  +D+DS++EKMIDDYS    ++  +R    + E   D+++VNKILHDI 
Sbjct: 701 WHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDIS 760

Query: 726 TGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFET 785
           TGGFR+RG+ A              ++  +R+ELL+QK+   G+   L  NPKS AFF+T
Sbjct: 761 TGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQT 820

Query: 786 IVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSFLTSGE 845
           +V+D+                 ++ +A  ++ +D    G+K V+SE FV++TLSFL+S  
Sbjct: 821 MVDDVTEASF-----------GNTFDANIDEKTDPSAAGRKIVISEQFVKETLSFLSSKS 869

Query: 846 VGEEKGPENNLGSLPTHVPSFNT-----EETQDIFALKQNSSIK----SLSAPTRNSSNM 896
              E         +P    S ++     EE QD+  LKQNS+IK    SL  P + +   
Sbjct: 870 GDSE---------IPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGSLELPAQMAELS 920

Query: 897 LIDDQEDLLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKA 956
             D+ +   S  R  S    F    + ++KF+ G K VR L + K  G SKA+IT++G+ 
Sbjct: 921 SGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRK 980

Query: 957 RKLNAPK 963
           R+L  PK
Sbjct: 981 RRLIPPK 987

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 128/508 (25%), Positives = 210/508 (41%), Gaps = 84/508 (16%)

Query: 1   MDLIDNLRARNRGSGTAKKVK----ERGCDSLPLVTGTGFLFGNSVLRRVKSRLGDDENH 56
           M+L+D L    R   T KKV+    E+  D  P       +F +S+L RV++RL  ++ H
Sbjct: 1   MELLDGLCVSARKKTTYKKVRLGIAEQSKDE-PSSNKPAAVFRSSLLDRVRTRLNVEDGH 59

Query: 57  EADSTKSPIDNGCCDLSQTQVVGLAYDGEDLEQDFADSTARIEGKSWAGPTNKPNYPKDK 116
              S     ++G  D          YDGE+LE  F    A  +      PT     P+  
Sbjct: 60  APSSDALEPESGLTDD--------VYDGENLEVSFDVGDAEDD----CLPTQADGKPE-- 105

Query: 117 RRVSSNNSTV-ERRIPRSELESTEVNTQLISPH-QVKEIDELETQL-----LLPD----- 164
            ++  N  T  E    R ++     +  + SP  QV   DE+  QL     L P+     
Sbjct: 106 -QIEVNVGTAPEEPFSRIKIPLKLSDGGIFSPSTQVD--DEMAMQLQPTQKLPPESPALQ 162

Query: 165 -VDLHPTNQSSNNT--ILDGTI----TQI----SGFGETCHDNAIQATSKDVSDTSTFVP 213
            VD H   Q    T   +DG I    TQ+    + +G T  D+ + AT +D   T+    
Sbjct: 163 AVDTHTELQDELETGVAVDGRISLSQTQVIVSGTNYGPTRVDDEVVATQQDSMGTADAQC 222

Query: 214 ITTKTKYSNSSLSFNANDPEEES-----------NTIAMSPADATERDRTIRKR------ 256
             T+T     +  F A  P+ ++           + I    A  T+++  +  +      
Sbjct: 223 WDTQTLDCALADDFQATIPDAQTLATARHEKLFIHQIEEEIATKTQKELPMMTQAKEAPY 282

Query: 257 -------FDAQSFIESFDDETD-ELQSCAASNASETEAPVLKQLEDGEKNANNLKKPTHF 308
                  F   +F++SFDD+++ E+      +  +      +  E G +++    +P   
Sbjct: 283 IPKQKLVFTKDNFLDSFDDDSETEIHGGLDGSDRQVSYNDREHTETGPQSS----QPATG 338

Query: 309 ESNRENNPNKDSSSIKIFPTMFEENKADASAIILXXXXXXXXXXXXKKPSFKAAILDLKA 368
           E            S+ I    ++E    A  IIL                 KAA+L +KA
Sbjct: 339 EGQDTQVLYPALQSLSITSKSYQE----ARQIILDESSEDDTDVNLSSAVSKAAVLAIKA 394

Query: 369 RLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGIDYDKITEEK 428
           R SK     + P+    +  S    LFA LRKAN+ Q+L+ R+   + +GI+   + +E+
Sbjct: 395 RNSK----FITPQKIDETKSSKSNELFAKLRKANREQLLEQRRNAIERRGINMQNLEQER 450

Query: 429 NSIESLLEREL--ARNKKIRLREIEQER 454
             + +LLE+EL   R  +IR ++IE+ER
Sbjct: 451 EQLGNLLEQELERNRRIRIREKKIERER 478

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
           YCL061C
          Length = 965

 Score =  177 bits (448), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 123/333 (36%), Positives = 179/333 (53%), Gaps = 59/333 (17%)

Query: 666 WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725
           WHGIGGVD +  D +DS++EKMIDDYS   F+ SE+R+   +E    D ++VNKIL+DI+
Sbjct: 631 WHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKENKETDLALVNKILYDIK 690

Query: 726 TGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQK-VSAQGEAKLLAENPKSKAFFE 784
            GGFR R R                 Y ++R+ L+R+K +  +G+ K++ +NPKSKAFFE
Sbjct: 691 NGGFRTRKRRDRDLEFSDDDDDDLKAYRAKRRALMREKRLDIEGDKKIV-KNPKSKAFFE 749

Query: 785 TIVEDIRSKGALEDEGPPPVRGFSSVNAPEEK---------NSDSDKK--------GKKT 827
           +IV+DI     +E + P     F  +N   E+         + D+D+K         KK 
Sbjct: 750 SIVDDI-----IETKNP-----FDDMNTSIEQIVEKETPTVDIDNDEKLATNVTKKKKKI 799

Query: 828 VLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLS 887
           V+SE FVQ++LSFL S    +E    N       H        T D++ LK+ SSIK+L 
Sbjct: 800 VISEEFVQRSLSFLNSCREQDEFEINNQ------HNGGEKATSTADLYTLKRYSSIKTLQ 853

Query: 888 A----------------PTRNSSNMLIDDQEDLLSRKRACSFFARFTKRVDANEKFEEGK 931
           +                P+++S ++  D         R  S    F+  VD N KF+EG 
Sbjct: 854 SVTSSRSSSIASNLNEQPSQSSGSLFND--------LRKTSVLNSFSSDVDINSKFKEGT 905

Query: 932 KTVRSLNSYKVAGSSKASITYLGKARKLNAPKK 964
           K+V+  N+YK  GS++ASITY+G +R+L APKK
Sbjct: 906 KSVKVSNAYKTVGSARASITYMGTSRRLVAPKK 938

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 112/224 (50%), Gaps = 26/224 (11%)

Query: 357 PSF--KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKY 414
           PS+  KA IL+++A  SK+      P+    S+ ++  +L+ +L++A+K QI+ Y+KE  
Sbjct: 355 PSYASKAVILNIRANKSKQQ-----PKVSQKSDQTTLLMLYNNLKRASKEQIVSYQKELM 409

Query: 415 QSKGIDYDKITEEKNSIESLLERELARNKKIRLREIEQERQNERKDFGEQSSAFDYSNXX 474
           + KGI+ +++ +E   +E+LLE+E+ARN+KIR RE +++++  + D       FD S   
Sbjct: 410 EKKGINLEELEKENEIVENLLEQEIARNQKIRQREKQKQKKENQDDLNSNPEEFDLSANE 469

Query: 475 XXXXX---XXXXXXXNQSSSPVSLHSGIVCADDAVECAANRMQDLKQTIKPNEEEDAIRK 531
                          N S             +D  E A       K T+   +E  AI  
Sbjct: 470 LEDSDIPGSDFAESNNNSEKDDEEEENDEEEEDEQEDAP------KSTVDEEDEGFAI-- 521

Query: 532 SGLRKHKKFCLI-DTDEE------DGSVLNSGNIIDLGAYGSNI 568
            G RKHKK  ++ D+D E      D   + + N IDLG YG NI
Sbjct: 522 -GKRKHKKTEIVDDSDSEIEAQIVDSKEIITANTIDLGHYGDNI 564

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  161 bits (407), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 178/372 (47%), Gaps = 63/372 (16%)

Query: 651  ASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEI 710
            AS++ D EAEES+DEW GIGG DGE  D++DS++EK+IDDYS   F+  E+R + + E  
Sbjct: 873  ASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENK 932

Query: 711  SEDKSMVNKILHDIETGGFRKRGRNAXXXXXXXXXXXXXXKYHSRRKELLRQKVSAQGEA 770
              D  MVN+IL+DI+ GGFRKR RN               +Y  +R+E++++K       
Sbjct: 933  EMDIKMVNRILYDIKNGGFRKRNRNNIDLELSDDEDDELREYRIKRREIMKKKRLEVTNT 992

Query: 771  KLLAENPKSKAFFETIVEDIRSKGALEDEGP-----PPVRGFSSVNAPEEKNSD------ 819
              + +  KSKAFF ++V+DI     +E   P     P        N     N +      
Sbjct: 993  DKILKTSKSKAFFMSMVDDI-----VETSNPFMITQPSDDDSDDNNMDSISNKNHKDANN 1047

Query: 820  ----------------SDKKGKKTVLSEAFVQQTLSFLT-SGEVGEEKGPENNLGSLPTH 862
                            S    KK V+SE FV +TLSFLT S EV E +    +  S    
Sbjct: 1048 AKKDKKDKRTDDHARLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKS---Q 1104

Query: 863  VPSFNTEETQDIFALKQNSSIKSLSAPTRNSSNMLI-------------------DDQED 903
            + + N     DI +LKQ SSIK++   +  S +  +                   D+  D
Sbjct: 1105 IGTIN-----DIQSLKQKSSIKTMHVLSMMSQDTNVDLDASDKDDDDMIHHAGSFDNSFD 1159

Query: 904  --LLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNA 961
              L S  +A S    F    D N+KF++G KTV   NSYK  G  K SIT  G+ RKL A
Sbjct: 1160 DPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVA 1218

Query: 962  PKKVAHQQSRKR 973
            P K  +  ++ R
Sbjct: 1219 PVKTHNNFNKNR 1230

>TDEL0F03050 Chr6 complement(553599..555101) [1503 bp, 500 aa] {ON}
           Anc_1.142 YJL194W
          Length = 500

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 52/116 (44%), Gaps = 14/116 (12%)

Query: 183 ITQISGFGETCH------DNAIQATSKDVSDTSTF-VPITTKTKYSNSSLSFNA-NDPEE 234
           IT   G G+T        D  +  + KD+S+  T+ +P     + + SS++  A NDP  
Sbjct: 120 ITGPPGTGKTAQVEAIVRDRFVPVSDKDLSNARTYRLPNGVVERVAVSSINCIAINDPST 179

Query: 235 ESNTIAMSPADATERDRTIRKRFDAQSFIESFDDET------DELQSCAASNASET 284
             N I MS     E   T+R   D Q F+E++   T      DE+     SN ++T
Sbjct: 180 IFNKIYMSLVSNPEPGATVRTMSDLQKFLETYSGTTSFLVILDEMDKLVHSNLNDT 235

>KLTH0E10296g Chr5 (927506..932128) [4623 bp, 1540 aa] {ON} conserved
            hypothetical protein
          Length = 1540

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 359  FKAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKG 418
            F + +   + RLS+  ++LL  RSK  S F + Q+   S R +     ++  +   +S+ 
Sbjct: 1435 FDSILRGQQQRLSQLEEALLRERSKKRSPFDARQMAAGSTRTSE----IEEERNALKSRL 1490

Query: 419  IDYDKITEEKNSIESLLERELARNKKIR 446
            + YD I  ++    SLLE  L R K  R
Sbjct: 1491 VGYDNIMRDQQVKLSLLETALQREKLTR 1518

>SAKL0C08558g Chr3 (785340..786755) [1416 bp, 471 aa] {ON} similar
           to uniprot|P33895 Saccharomyces cerevisiae YOL069W NUF2
           Component of the evolutionarily conserved
           kinetochore-associated Ndc80 complex
           (Ndc80p-Nuf2p-Spc24p- Spc25p) involved in chromosome
           segregation spindle checkpoint activity and kinetochore
           clustering
          Length = 471

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 513 MQDLKQTIKPNEEEDAIRKSGLRKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLN 572
           + D+ Q I    +E  +R++GL + KK  L+ TD +  ++L+SG ++ LG   S + N  
Sbjct: 317 LYDVLQIISSELQESHLRETGLLELKK-QLVQTDTKLKNLLSSGVLVKLGILQSQLDNQR 375

Query: 573 Q 573
           Q
Sbjct: 376 Q 376

>KLLA0F22451g Chr6 (2098204..2099559) [1356 bp, 451 aa] {ON} similar
           to uniprot|P33895 Saccharomyces cerevisiae YOL069W NUF2
           Component of the evolutionarily conserved
           kinetochore-associated Ndc80 complex
           (Ndc80p-Nuf2p-Spc24p- Spc25p) involved in chromosome
           segregation spindle checkpoint activity and kinetochore
           clustering
          Length = 451

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 61/127 (48%), Gaps = 12/127 (9%)

Query: 496 HSGIVCADDAVECAANRMQDLKQTIKPNEEEDAIRKSGLRKHKKFCLIDTDEEDGSVLNS 555
           H  +  + +  +   + + D+ Q I  + +E  +R++ L   ++  L+ TD++  ++L+S
Sbjct: 276 HRKLRISMNTFQTLTHELYDVLQLISTDLQESHLREANLIDMRE-QLLQTDQKLNNILSS 334

Query: 556 GNIIDLGAYGSNIGN----LNQIEQEQVGEHVGAHIENDLTTTGRNKNL---IKPSSRSS 608
           G ++ +    S + N    L+Q+E    GE     IEN  T     +     + P  R++
Sbjct: 335 GVMVKMKILQSQLDNQKKKLHQLE----GETKAKQIENSETLQLLQRQYTDEVVPDLRAA 390

Query: 609 SFQVEDN 615
             QVE++
Sbjct: 391 EEQVEND 397

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.126    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,994,758
Number of extensions: 4830923
Number of successful extensions: 22355
Number of sequences better than 10.0: 297
Number of HSP's gapped: 23432
Number of HSP's successfully gapped: 355
Length of query: 993
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 874
Effective length of database: 39,836,145
Effective search space: 34816790730
Effective search space used: 34816790730
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 71 (32.0 bits)