Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F00462g1.4ON45145122240.0
Kwal_33.130031.4ON4494647084e-88
SAKL0C00440g1.4ON4624853937e-42
Suva_3.1511.4ON4211961756e-13
Smik_3.131.4ON4252161749e-13
YCL063W (VAC17)1.4ON4232161722e-12
TDEL0C069801.4ON4262441641e-11
KLLA0C00462g1.4ON4604451571e-10
ZYRO0F18502g1.4ON4502331525e-10
Skud_3.21.4ON4262201472e-09
Kpol_2002.71.4ON4742291364e-08
CAGL0B00308g1.4ON4302331293e-07
TBLA0A075801.4ON5132361277e-07
KAFR0D001201.4ON3991951133e-05
KNAG0C001901.4ON4422101133e-05
NDAI0A001301.4ON4782411124e-05
NCAS0B091201.4ON4332311124e-05
TPHA0E040201.4ON5402111044e-04
Ecym_10071.4ON462122741.3
NDAI0H002604.15ON193974741.6
TDEL0E007803.69ON33684704.6
NOTE: 1 genes in the same pillar as KLTH0F00462g were not hit in these BLAST results
LIST: AFR746C

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F00462g
         (451 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...   861   0.0  
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...   277   4e-88
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   155   7e-42
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...    72   6e-13
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)    72   9e-13
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...    71   2e-12
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...    68   1e-11
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...    65   1e-10
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...    63   5e-10
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)       61   2e-09
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....    57   4e-08
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...    54   3e-07
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...    54   7e-07
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    48   3e-05
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...    48   3e-05
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...    48   4e-05
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...    48   4e-05
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...    45   4e-04
Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to ...    33   1.3  
NDAI0H00260 Chr8 (39847..45666) [5820 bp, 1939 aa] {ON}                33   1.6  
TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.6...    32   4.6  

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/451 (93%), Positives = 421/451 (93%)

Query: 1   MEQLQEIXXXXXXXXXXXXXXXXXCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQL 60
           MEQLQEI                 CLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQL
Sbjct: 1   MEQLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQL 60

Query: 61  YSLYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQEIAKNDENFISYSMRESPNSMS 120
           YSLYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQEIAKNDENFISYSMRESPNSMS
Sbjct: 61  YSLYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQEIAKNDENFISYSMRESPNSMS 120

Query: 121 VQSICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQERLLGS 180
           VQSICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQERLLGS
Sbjct: 121 VQSICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQERLLGS 180

Query: 181 SPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHENRLNFFKDRQRLSISFIEDEED 240
           SPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHENRLNFFKDRQRLSISFIEDEED
Sbjct: 181 SPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHENRLNFFKDRQRLSISFIEDEED 240

Query: 241 VSDEATVISAGSLQSAYIFETDIKSSPFKSQIGEKEIRIPKAGYLAVGEKSKGFNNLLSA 300
           VSDEATVISAGSLQSAYIFETDIKSSPFKSQIGEKEIRIPKAGYLAVGEKSKGFNNLLSA
Sbjct: 241 VSDEATVISAGSLQSAYIFETDIKSSPFKSQIGEKEIRIPKAGYLAVGEKSKGFNNLLSA 300

Query: 301 TPSAPQIGITEVDYKPNFGFSHQPGVEREASQSKKMLSQLVSQGNKTKCKNWFNECDGLG 360
           TPSAPQIGITEVDYKPNFGFSHQPGVEREASQSKKMLSQLVSQGNKTKCKNWFNECDGLG
Sbjct: 301 TPSAPQIGITEVDYKPNFGFSHQPGVEREASQSKKMLSQLVSQGNKTKCKNWFNECDGLG 360

Query: 361 KPISXXXXXXXXXXXXXSETGLRSVNNTTSAKLLMPPRKRKEKQAAHGSCSIFIHGSSRS 420
           KPIS             SETGLRSVNNTTSAKLLMPPRKRKEKQAAHGSCSIFIHGSSRS
Sbjct: 361 KPISNTLRLLNNLVLVTSETGLRSVNNTTSAKLLMPPRKRKEKQAAHGSCSIFIHGSSRS 420

Query: 421 KFVTAPQQTKLHFKVSHGALQEALNTDLDFK 451
           KFVTAPQQTKLHFKVSHGALQEALNTDLDFK
Sbjct: 421 KFVTAPQQTKLHFKVSHGALQEALNTDLDFK 451

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score =  277 bits (708), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 177/464 (38%), Positives = 257/464 (55%), Gaps = 31/464 (6%)

Query: 1   MEQLQEIXXXXXXXXXXXXXXXXXCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQL 60
           MEQL +I                 C+ +QRRLYES   DQCLS++SS+ + QYY Y+GQL
Sbjct: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQL 60

Query: 61  YSLYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQEIAK--NDENFISYSMRESPNS 118
             LY KAQ L D ++ +    L +  Q AIE L  +++ +    N+      ++ +SP+ 
Sbjct: 61  NCLYIKAQSLKD-MMGNRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDSPSC 119

Query: 119 MSVQSICSFQPKPLKILQRRQAQLE-SPTKRSFRPSMSLLDNRGDETNLATASDRSQERL 177
           +S  S+ SFQPKPLKI++RR AQ   SPTK      M+       ++   + +D++ + +
Sbjct: 120 LSPASVSSFQPKPLKIIERRLAQTNTSPTKVCTATVMA-------KSFCRSGTDKNSDYI 172

Query: 178 LGSSPSSIHFFRPSHTNA--------DTLFIRSAKSCDAGLNRRSNPHENRLNFFKDRQR 229
               P  I      +TN+        +  FIR  KSC  GLN+ SNPHENRL+FF+DRQR
Sbjct: 173 ----PDEIGKTNSCNTNSPCTNEAKKEPKFIRVVKSCGTGLNKHSNPHENRLSFFRDRQR 228

Query: 230 LSISFIEDEEDVSDEATVISAGSLQSAYI---FETDIKSSPFKSQIGEKEIRIPKAGYLA 286
           LSISFIED+E +SDE T+ S   L ++++   F    K  P ++    + +   + G  A
Sbjct: 229 LSISFIEDDEYLSDEETITSGSPLNASFLLNDFAKVAKGRPNQTLASSRHVENNERG--A 286

Query: 287 VGEKSKGFNNLLSATPSAPQIGITEVDYKPNFGFSHQPGVEREASQSKKMLSQLVSQGNK 346
                  F +L+       QIG+T +D +P+FG    P  + E ++SK++LS  V +  +
Sbjct: 287 QTAAVSPFVSLVPKKTCTAQIGLTSIDIRPDFGPCFSPK-KFETTESKEILSHFVIKEPR 345

Query: 347 TKCKNWFNECDGLGKPISXXXXXXXXXXXXXSETGLRSVNNTTSAKLLMPPRKR-KEKQA 405
           TK  +W   CD    P               SETG R+V+ TTS KL+ P RK   +++ 
Sbjct: 346 TKSHSWLKGCDK-SVPFLQTFKIFNNQVLVTSETGCRNVDRTTSTKLITPSRKHFAQREL 404

Query: 406 AHGSCSIFIHGSSRSKFVTAPQQTKLHFKVSHGALQEALNTDLD 449
           +  +CSI +HGSS S+FV APQQ +LHFKVS+ AL+EALNTDL+
Sbjct: 405 SDRTCSILVHGSSGSRFVNAPQQQELHFKVSYEALREALNTDLN 448

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  155 bits (393), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 159/485 (32%), Positives = 226/485 (46%), Gaps = 62/485 (12%)

Query: 1   MEQLQEIXXXXXXXXXXXXXXXXXCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQL 60
           ME L EI                  ++RQ+RLYE    DQ   +   T + +Y   + QL
Sbjct: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQP-DNGLLTKLQEYQTCLAQL 59

Query: 61  YSLYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQEIAKNDENFISYSMR--ESPNS 118
            SL+ +++ L D +  +D ++  S    +I +L+ EFQ+I        +   R  +SP S
Sbjct: 60  NSLHIRSEHLRDRIASTDHRA--SQDGDSIGHLVTEFQKITTKLNELAATQDRAYQSPGS 117

Query: 119 MSVQSICSFQPKPLKILQRRQAQ-LESPTKRSFRPSMSLLDNRG----DETNLATASDRS 173
            S +S+ SF+PKPLKIL+R + Q   SPTKR   P   +   R     D+  + +   +S
Sbjct: 118 QSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHSKS 177

Query: 174 QE-----RLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLN---RRSNPHENRLNFFK 225
                   +  SSP SI   R         F R AKSCDAGLN   RR    +NRLNFFK
Sbjct: 178 TSLPGSPSMAASSPVSIQQER---------FPRHAKSCDAGLNKQQRRRQDSDNRLNFFK 228

Query: 226 DRQRLSISFIEDEEDV-SDEATVISAGSLQSAYIFETDIKSSPFK------SQIGEKEI- 277
           + QRLSISF +DE D  SDE TVIS    ++   F+   K+ P +      S +  KE+ 
Sbjct: 229 ENQRLSISFFDDEIDYSSDEDTVISVSPPETTS-FKGFPKAEPLRRYNSHESVLSRKEVL 287

Query: 278 --RIP-KAGYLAVGEKSKGFNNLLSATPSAPQIGITEVDYKPNFGF-----SHQPGVERE 329
              +P +AG+ ++     G NN     P A  + I +   KP +       SH    E  
Sbjct: 288 PAALPARAGWFSLWA---GRNN--KPKPMAESVSIND---KPVYSTAALLRSHSKTTE-- 337

Query: 330 ASQSKKMLSQLVSQGNKTK--CKNWFNECDGLGKPISXXXXXXXXXXXXXSETGLRSVNN 387
              SK +L+Q VS   K K    +WF   +   + I              SETGL+  N+
Sbjct: 338 --TSKDLLAQFVSAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNS 395

Query: 388 TTSAKLL--MPPRKRKE--KQAAHGSCSIFIHGSSRSKFVTAPQQTKLHFKVSHGALQEA 443
             SAK +    P KR    ++  H   S  I G + S+FV+ P +  L+ KVS+ AL EA
Sbjct: 396 KPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSPPNEPVLNNKVSYDALHEA 455

Query: 444 LNTDL 448
           L T+ 
Sbjct: 456 LCTEF 460

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 107/196 (54%), Gaps = 28/196 (14%)

Query: 52  QYYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSVQ--QRAIENLIQEFQEIAKNDENFIS 109
           QY +Y+ QL SLY +++ + D +     + L++ +   + IE+L+ EFQ+I     +  +
Sbjct: 51  QYNQYMSQLNSLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLAT 110

Query: 110 YSMR---ESPNSMSVQS-ICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETN 165
              +   +SP S S +S + SFQP+PLKI++R++  + +P+K    P  S++ N  ++  
Sbjct: 111 VPNKASNDSPQSQSTRSSLDSFQPRPLKIIERQRLCVVTPSK---PPKKSVVFNPINDVE 167

Query: 166 LATASDRSQERLLGSSPSSIHFFRP--SHTNADTLFIRSAKSCDAGLNRRSNPHENRL-- 221
             + ++      L  SP      +P  +HT      +R+AKS D GLN+   P       
Sbjct: 168 CPSKTNS-----LPCSPKK----QPGKAHT------LRAAKSHDTGLNKSKKPSSTDAYE 212

Query: 222 NFFKDRQRLSISFIED 237
           +FFK++QRLS++F ++
Sbjct: 213 SFFKNKQRLSLTFFDE 228

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 112/216 (51%), Gaps = 27/216 (12%)

Query: 26  LERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSV 85
           ++RQ+R       DQ L DK S    QY +Y+ QL SLY +++ + D +     + L + 
Sbjct: 28  IQRQQRSSVCQTTDQELLDKVS---KQYNQYMSQLNSLYVRSESVRDKLSKEQQRRLITE 84

Query: 86  --QQRAIENLIQEFQEIAKNDENFISYS---MRESPNSMSVQS-ICSFQPKPLKILQRRQ 139
             + + IE+L++EFQ+I        +       +SP S S +S + SFQP+PLKI++R++
Sbjct: 85  DNEHQRIEDLVREFQDITLRLNELATAPNEVANDSPQSQSTRSSLESFQPRPLKIIERQR 144

Query: 140 AQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLF 199
             + +P+K    P  S+  N  ++ +  + ++        S P S     P    A    
Sbjct: 145 LCMVTPSK---PPKKSVGFNPINDVDCPSKTN--------SLPCS-----PKKQPAKNHT 188

Query: 200 IRSAKSCDAGLNRRSNPH--ENRLNFFKDRQRLSIS 233
           +R+AKS D GLN+   P   +   +FFK+RQRLS++
Sbjct: 189 LRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLT 224

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 112/216 (51%), Gaps = 27/216 (12%)

Query: 26  LERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSV 85
           ++RQ+R       DQ   DK S    QY +Y+ QL SLY +++ + D +     + L + 
Sbjct: 28  IQRQQRSSICQTTDQESLDKLS---QQYNQYMSQLNSLYVRSESVRDKLSKEQQRRLITE 84

Query: 86  --QQRAIENLIQEFQEIAKNDENFISY---SMRESPNSMSVQS-ICSFQPKPLKILQRRQ 139
             + + IE+L++EFQ+I        +    +  +SP S S +S + SFQP+PLKI++R++
Sbjct: 85  DNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSPQSQSTRSSLGSFQPRPLKIIERQR 144

Query: 140 AQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLF 199
             + +P+K    P  S+  N  +E +  + ++        S P S     P    A    
Sbjct: 145 LCMVTPSK---PPKKSVGFNPINEVDCPSKTN--------SLPCS-----PKKQPARNRT 188

Query: 200 IRSAKSCDAGLNRRSNPHENRL--NFFKDRQRLSIS 233
           +R+AKS D GLN+   P  +    +FFK+RQRLS++
Sbjct: 189 LRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLT 224

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 120/244 (49%), Gaps = 39/244 (15%)

Query: 25  CLERQRRLYESGFPDQCLSDKSSTNMA-QYYEYIGQLYSLYTKAQKLSDTVILSDSKSLS 83
            ++RQ+ L E       L D S   +  QY  YI QL SL  +++ + D +     + +S
Sbjct: 24  WIQRQQHLRE-------LEDSSIDKLGNQYNVYIAQLNSLCVRSEYVRDKLNKERERRMS 76

Query: 84  SVQQRA-IENLIQEFQEI-AKNDENFISYSMRESPNSMSVQS-ICSFQPKPLKILQRR-- 138
            +  R  IE+L+ EFQ+I  K +E   S S+  +P+S S +S + SFQP+PLK+ +R   
Sbjct: 77  IINDRKYIEDLVFEFQDITVKLNELAQSQSIDSTPSSKSTRSSLGSFQPRPLKLTERHGP 136

Query: 139 --QAQLESPTK-RSFRPSMSLLDNRGDETNLATASDRSQERLLGSSPSSIHFFRPSHTNA 195
             +A  ESP K +S   S+         + L  + + +  + L S P S     P     
Sbjct: 137 NVKALRESPLKNKSVIKSVKF-------SGLHDSKEEAVSKCL-SLPGS-----PVRVTG 183

Query: 196 DTLFIRSAKSCDAGLNRRSNPHE------NRLNFFKDRQRLSIS----FIEDEEDVSDEA 245
            T  IR AKS D GLN ++          +  + F++ QRLSI+    F ED +  SD+ 
Sbjct: 184 PTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVFDDFDEDADSTSDQD 243

Query: 246 TVIS 249
           TVIS
Sbjct: 244 TVIS 247

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 109/445 (24%), Positives = 180/445 (40%), Gaps = 72/445 (16%)

Query: 50  MAQYYEYIGQLYSLYTKAQKLSDTVI--LSDSKSLSSVQQRAIENLIQEFQEIAKN-DEN 106
           + +YY ++ +L SL  +A+ + +++     D   +  ++   +E LI EFQ+I  + +E 
Sbjct: 44  VQEYYSFLARLSSLKLRAEHVQESLRHQRKDPNDVC-IEYETLEKLIYEFQDITMSLNEV 102

Query: 107 FISY-SMRESPNSMSVQSICSFQPKPLKILQRRQAQL--ESPTKRSFRPSMSLLDNRGDE 163
             +Y S  +S  S S +       K LKI++R +  L   SP K+S      L   + +E
Sbjct: 103 ARAYQSPTKSARSGSSKESSVIPLKTLKIIERNRDSLIGTSPMKKS------LSQLKKEE 156

Query: 164 TNLATASDRSQERLLGSSPSSIHFFR--------PSHTNADTLF-----------IRSAK 204
            N +  + R+  R        +H           P     DTL            +R AK
Sbjct: 157 HNQSLPAKRNV-RFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAK 215

Query: 205 SCDAGLNRRSNPHENRLNFFKDRQRLSISFIED-EEDVSDEATVISAGSLQSAYIFETDI 263
           S D GLN R+  + +   FFK++ RLS+S  +D   D SDE TVIS      +Y    + 
Sbjct: 216 SYDVGLNGRAKKNAD-WEFFKNKNRLSLSVFDDVNTDASDEETVISVSPPNISYYLSQNE 274

Query: 264 KSSPFK--------SQIGEKEIRIP--------KAGYLAVGEKSKGFNNLLSATPSAPQI 307
              P K          I  ++I  P        +  Y +V +K         A  + P I
Sbjct: 275 DQYPSKQVRRCNSHESILSRKILSPSTPANLIMRPTYQSVWQK--------KAIVTKPTI 326

Query: 308 GITEVD--YKPNFGFSHQPGVEREASQSKKMLSQLVSQGNKTKCKNWFNECDGLGKPISX 365
             +  +    P  G  H          SK MLSQ V+     K + WF+  +      S 
Sbjct: 327 SCSTSNSTASPTIGSPH---------LSKDMLSQFVTAPPSKKYRGWFSSSNSTPFASSI 377

Query: 366 XXXXXXXXXXXXSETGLRSVNNTTSAKLLMPPRKRKEKQAAHGSCSIFIHGSSRSKFVTA 425
                        E G    ++ +S + ++  R+R     ++ +  +   G + +KF+  
Sbjct: 378 FQKWFNSDSLVTKEIGNPDNSSPSSGRPIVENRQRHSSSNSYSTSIVI--GPNGAKFIRG 435

Query: 426 PQQTKLHFKVSHGALQEALNTDLDF 450
                +   VS+  LQEALNT+ +F
Sbjct: 436 LNDPLVTCTVSYNELQEALNTEFNF 460

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 111/233 (47%), Gaps = 28/233 (12%)

Query: 52  QYYEYIGQLYSLYTKAQKLSDTVI--LSDSKSLSSVQQRAIENLIQEFQ-------EIAK 102
           QY  Y+ QL SL  +++ + D +     + K     +Q  IE+L+ EFQ       E+A+
Sbjct: 47  QYNLYMAQLNSLCVRSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQ 106

Query: 103 NDENFISYSMRESPNSMSVQSICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGD 162
           N +  ++ S + S  S++     SFQP+PLKI +R +  + +  +   R +  L +    
Sbjct: 107 NQKEQVTPSSKHSNGSVN-----SFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFV 161

Query: 163 ETNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNP------ 216
           E +L      S+   L  SP  +    P       L  R AKS D GLN  S        
Sbjct: 162 EESLPELFCPSKCTSLPGSP--LKMRSPDRLPDRPL--RVAKSYDTGLNPNSRAKLKKQK 217

Query: 217 HENRLNFFKDRQRLSISFIEDEEDVSDEA----TVISAGSLQSAYIFETDIKS 265
            E  L+ FK+ QRLSI+F +D ++ SD A    TVIS   +  ++  + D++S
Sbjct: 218 EEEMLSVFKENQRLSITFCDDIDEGSDSASDQNTVISTSPIPPSHPIQYDVQS 270

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 113/220 (51%), Gaps = 27/220 (12%)

Query: 26  LERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSV 85
           ++RQ+R       DQ   DK S    QY +Y+ QL SLY +++ + D +     + L + 
Sbjct: 28  IQRQQRSSVCQTSDQESLDKLS---QQYNQYMSQLNSLYVRSESVRDKLSKEQQRRLITE 84

Query: 86  --QQRAIENLIQEFQEIAK--NDENFISYSMRE--SPNSMSVQSICSFQPKPLKILQRRQ 139
             + + IE+L+ EFQ+I    N+   + + +      +  +  S  SFQP+PLKI++R++
Sbjct: 85  DNEHQRIEDLVHEFQDITSRLNELATVPHGVSNDSPQSQSTRSSSGSFQPRPLKIIERQR 144

Query: 140 AQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLF 199
             + +P+K    P  S+  N  ++ +  + ++        S P S     P    A    
Sbjct: 145 VCMVTPSK---PPKKSVGFNPINDVDCPSKTN--------SLPCS-----PKKPPAKNRT 188

Query: 200 IRSAKSCDAGLN--RRSNPHENRLNFFKDRQRLSISFIED 237
           +R+AKS D GLN  ++ +  +   +FFK++QRLS++F ++
Sbjct: 189 LRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFDE 228

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 106/229 (46%), Gaps = 43/229 (18%)

Query: 53  YYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSVQ-----------QRAIENLIQEFQEIA 101
           Y  Y+ QL SLY ++Q + D +        ++++           Q  IE+LI EFQ+I 
Sbjct: 53  YNLYMSQLNSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDIT 112

Query: 102 KNDENFISYSMRESPNSMSVQS----ICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLL 157
           +   N ++ S R   +S S  S    I SFQPKPLKI  +R   L+   K++    +  +
Sbjct: 113 RK-LNVLASSRRRCSSSKSSSSRSSSIGSFQPKPLKISLKRNKSLKEQNKKTVTFDVEEV 171

Query: 158 DNRGDETNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLN--RRSN 215
            +     N   +   S  R   SSP   H             +R AKS D GLN  R   
Sbjct: 172 TDLN--INSVISLPGSPLRNEQSSPPMNH------------HLRQAKSYDTGLNSKRSIK 217

Query: 216 PHENRLN-----FFKDRQRLSISFIE------DEEDVSDEATVISAGSL 253
           P +++++      FK+ QRLSIS  +      D  ++SD+ TVIS+ SL
Sbjct: 218 PKKSKIDSVYDSTFKNTQRLSISLFDIDTNENDITNISDQETVISSSSL 266

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 108/233 (46%), Gaps = 53/233 (22%)

Query: 52  QYYEYIGQLYSLYTKAQKLSDTVILSD----SKSLSSVQQRAIENLIQEFQEIA------ 101
           +Y E++ +L SLY ++Q + D +        +K  S +    I+ L+ EF+EI       
Sbjct: 51  KYTEFLEKLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEI 110

Query: 102 --KNDENFISYSMRESPNSMSVQS-ICSFQPKPLKILQRR---QAQLESPTKR---SFRP 152
             ++DE   + S + SP S S +S + SF PKPLKIL R    ++ + SP K+   SF P
Sbjct: 111 AQQDDE---TNSKQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCP 167

Query: 153 SMSLLDNRGDETNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGL-- 210
                       NL+     S    L SSP+  +             +  A+S   GL  
Sbjct: 168 I---------HENLSVTEYES----LPSSPNRSNLLEEQEQ-----VLHPARSFQTGLRT 209

Query: 211 NRRSNPHENRLN-FFKDRQRLSISFI-----EDEE-----DVSDEATVISAGS 252
            +   P +N+L+ +FKD+QRLS++       +D E     D SDE TVI   S
Sbjct: 210 EKARKPDKNQLDKYFKDKQRLSLTLFGSADADDGESLNNNDYSDEETVIFTSS 262

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 100/236 (42%), Gaps = 53/236 (22%)

Query: 53  YYEYIGQLYSLYTKAQKLSDT-------------VILSDSKSLSSVQQRAIE-------- 91
           Y  Y+ QL SLY +AQ + D              V  +D+ S + VQQ   E        
Sbjct: 53  YNRYMFQLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKM 112

Query: 92  NLIQEFQEIAKNDENFISYSMRESPNSMSVQSICSFQPKPLKILQRR----------QAQ 141
           N +   QE   N  + +S     S +S+S +    FQP+PLKILQR+          Q  
Sbjct: 113 NELSAIQENVTNGSSPLSNKSSHSNDSLS-KITDGFQPRPLKILQRQKHNNNQNTHPQPD 171

Query: 142 LESPTKRSFRPSMS-LLDNRGDET----NLATASDRSQERLLGSSPSSIHFF-RPSHTNA 195
           LESP K   R S + LL +   E+    N  +   ++ E L   SP  I  F  P+ + A
Sbjct: 172 LESPLKLKHRSSYNKLLSSNKKESKPYKNFNSKKSKNNELLSDISPVKIQSFEEPTFSVA 231

Query: 196 DTLFIRSAKSCDAGLNRRSNPHENRLNFFKDRQRLSISFIE--DEEDVSDEATVIS 249
           +T   R+  S D              + FK   RLSI F +  D +D  D+ T IS
Sbjct: 232 NT---RNKNSMDPL----------HYSLFKTNNRLSIQFPDGYDNDDEYDDPTCIS 274

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/195 (32%), Positives = 95/195 (48%), Gaps = 29/195 (14%)

Query: 55  EYIGQLYSLYTKAQKLSDTVILSDSKSLSS--VQQR----AIENLIQEFQEIAKNDENFI 108
           EY  QL SL  K++ +S+ ++  DS S+    ++Q+     +E+LI EF EI+      +
Sbjct: 36  EY-KQLNSLCAKSKYISN-LLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIV 93

Query: 109 SYSMRESPNSMSVQSICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLAT 168
           +++   SP S    +I SF+PKPL +L R+   LESPT+ S  P       R    NL  
Sbjct: 94  THT---SPQS----TIDSFEPKPLNLL-RKNKILESPTRSS--PVTRGRLERKISINLFP 143

Query: 169 ASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHENRLNFFKDRQ 228
               ++     S P+S      S  N  TL  R+ KS   GLN       + +N FK+  
Sbjct: 144 MHTTTK---CNSVPTSPKCKSTSTLNQRTL--RNIKSYHYGLN------GDYINPFKENN 192

Query: 229 RLSISFIEDEEDVSD 243
           RLSISF   +   +D
Sbjct: 193 RLSISFFNGDNTFND 207

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 110/210 (52%), Gaps = 29/210 (13%)

Query: 56  YIGQLYSLYTKAQKLSDTVILSDSKSLSSVQQ---RAIENLIQEFQEIAKNDENFISYSM 112
           ++ QL SL  +++ + +   L+  +++ S+++     IENL+ EFQ+IA +  N +S + 
Sbjct: 55  HLSQLNSLCLRSRYIKEK--LASERNICSIRKGRRSYIENLVYEFQDIAMS-LNELSETN 111

Query: 113 RE--SPNS-MSVQSICSFQPKPLKILQR-RQAQLESPTKRSFRPSMSLLDNRGDETNLAT 168
           R+  SP S  +  S  SF+PKPL+IL+R R    +SPTKR+   S  +   R  ET  + 
Sbjct: 112 RKNGSPVSQATTNSSDSFEPKPLRILERQRTCNAKSPTKRN---SNHIKIPR--ETEKSD 166

Query: 169 ASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLN-RRSNPHENRLNFFKDR 227
            ++   + L  S PSS    R S+ +  T  IR  KS    LN ++   H   +N F  +
Sbjct: 167 FTENVADCLHSSLPSSP--LRGSNGSQQT--IRLTKSYHESLNGQKPTSHSPLMNPFNAK 222

Query: 228 QRLSISFIED---------EEDVSDEATVI 248
            RLS+   ++         ++D SD+ TV+
Sbjct: 223 NRLSLYLFDNIDEKELTPCDDDNSDQETVM 252

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 102/241 (42%), Gaps = 50/241 (20%)

Query: 52  QYYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSVQ--QRAIENLIQEFQEIAK--NDENF 107
           QY  Y+ QL SL  + Q + D   L +   L S Q  Q+ IENL+ EF++I    ND + 
Sbjct: 54  QYNVYLAQLNSLIVRVQYIRDK-FLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLSK 112

Query: 108 ISYSMRESPNSMSVQS----ICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDE 163
            + +   S NS    S    + SF+PKPLKI++R        TK   + S ++     D 
Sbjct: 113 KNKTTSSSENSSKTASSKSSMESFEPKPLKIIKR--------TKNDQKVSNTI---NNDH 161

Query: 164 TNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHENRL-- 221
             +    +  +   L SSP     +     N   L +  ++      N   N + N +  
Sbjct: 162 DLIMQDENLQRPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRK 221

Query: 222 -------NFFKDRQRLSISFIEDEED---------------------VSDEATVISAGSL 253
                   FFK +QRLSI   ++++D                      SD+ATVIS G++
Sbjct: 222 FENDTINQFFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTI 281

Query: 254 Q 254
           +
Sbjct: 282 K 282

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 101/231 (43%), Gaps = 50/231 (21%)

Query: 50  MAQYYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSVQ---------QRAIENLIQEFQEI 100
           + QY  Y+ QL SL  + + + DT++   +  + + Q         Q+ I++L+ EFQ+I
Sbjct: 62  LEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDI 121

Query: 101 AKNDENFISYSMRESPNSMSVQS------ICSFQPKPLKILQRRQAQLESPTKRSFRPSM 154
               +     S   +P++ S +S      I SF+PKPL+I+ R         + S    +
Sbjct: 122 T---QKLSELSTVRNPSTASSRSTSTKSSIESFKPKPLRIISRSNTHSHLHQQTSLDKKV 178

Query: 155 SLLDNRGDETNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRS 214
           S      DE+N + +  RS E L              H N+ +L  R+ KS D       
Sbjct: 179 SF---NEDESNSSISHSRSMESL--------------HENSKSL--RNTKSMDVLKRSTF 219

Query: 215 NPHENRLNFFKDRQRLSISFIEDE----ED---------VSDEATVISAGS 252
             H +       RQRLSI+  +D+    ED          SD+ATVIS G+
Sbjct: 220 KNHSDFSKLLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGT 270

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 99/211 (46%), Gaps = 27/211 (12%)

Query: 51  AQYYEYIGQLYSLYTKAQKLSDTVILSDSKSLS--SVQQRAIENLIQEFQEIAKNDENFI 108
           + Y  Y+ QL SLY +++ + D  + S+  +++  ++  R IE L+ EFQ I +      
Sbjct: 64  STYDLYMSQLNSLYVRSEFIRDK-LNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLA 122

Query: 109 SYSM--RESPNSMSVQS--ICSFQPKPLKILQRRQAQLESPTK-RSFRPSMSLLDNRGDE 163
           + S   + SP   S +S  + S   KPLK++ + + ++    + ++   S++     G E
Sbjct: 123 ASSKLDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSKELELKNKEKSVTF----GKE 178

Query: 164 TNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLN------RRSNPH 217
           T ++  ++    +L+    S      P   +     +R+A S D GLN      +RSN  
Sbjct: 179 TRISLTTNGIGGKLMIKDDSDA---SPQLIDKKYKVLRNAISYDTGLNSKSKSNKRSNRE 235

Query: 218 ENRLN------FFKDRQRLSISFIEDEEDVS 242
             + N       FK++QR SIS  ED  D +
Sbjct: 236 YRKKNDAAYDSLFKNKQRFSISLFEDYVDTT 266

>Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to
           XP_452214  K. lactis KLLA0C00462g
          Length = 462

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 51/122 (41%), Gaps = 20/122 (16%)

Query: 40  QCLSDKSSTNMAQYYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQE 99
           Q   D+ +  M +Y   +  L SL  +AQ L D        S   +    ++ L  EF++
Sbjct: 62  QSCGDQRTEQMRRYQSSMAHLMSLSIRAQFLIDK--FHKGGSGYQIDLDTVKKLGSEFED 119

Query: 100 IAKN----------DENFISYSMRESPNSMSVQSICSFQPKPLKILQRRQAQLESPTKRS 149
           I+ N          D+N   +   E P          FQ +PLK+LQR +   E+ +K +
Sbjct: 120 ISHNLCFLEPNKVFDKNHTRFRSSEYP--------APFQLRPLKLLQRIRNPSENESKDN 171

Query: 150 FR 151
            R
Sbjct: 172 LR 173

>NDAI0H00260 Chr8 (39847..45666) [5820 bp, 1939 aa] {ON} 
          Length = 1939

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 4/74 (5%)

Query: 100  IAKND----ENFISYSMRESPNSMSVQSICSFQPKPLKILQRRQAQLESPTKRSFRPSMS 155
            I+K+D    E  I+YS++    S+ + S  +     + +++R    L+S T +  +  MS
Sbjct: 1438 ISKSDDSTMEEHINYSIKAVKKSVGLPSKIAASQVMILLVKRYGLDLKSYTGKMLKVCMS 1497

Query: 156  LLDNRGDETNLATA 169
            +LD+R +  N+A A
Sbjct: 1498 MLDDRNESVNMAFA 1511

>TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.69
           YNL290W
          Length = 336

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 47/84 (55%), Gaps = 8/84 (9%)

Query: 63  LYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQEIAKNDENFI--SYSMRESPNSMS 120
           +++K  KL   +IL ++ ++++  Q A+  +I+++    KN    I  +Y+ + +P  +S
Sbjct: 104 IFSKGFKL---IILDEADAMTNAAQNALRRIIEKY---TKNTRFCILANYAHKLTPALLS 157

Query: 121 VQSICSFQPKPLKILQRRQAQLES 144
             +   FQP P + L+RR  ++ S
Sbjct: 158 RCTRFRFQPLPTEALERRMNKVLS 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,360,958
Number of extensions: 1775185
Number of successful extensions: 5000
Number of sequences better than 10.0: 46
Number of HSP's gapped: 5213
Number of HSP's successfully gapped: 46
Length of query: 451
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 338
Effective length of database: 40,524,141
Effective search space: 13697159658
Effective search space used: 13697159658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)