Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F00440g1.3ON34134116480.0
SAKL0C00418g1.3ON3643349201e-122
KAFR0D001101.3ON3653329121e-121
NCAS0B091301.3ON3673328811e-117
KNAG0C001801.3ON3593318491e-112
Skud_3.11.3ON3603318451e-111
Suva_3.1501.3ON3613318451e-111
NDAI0A001201.3ON3773418441e-111
TBLA0A049201.3ON3603328311e-109
KAFR0F04430singletonON3433388281e-109
Smik_3.121.3ON3603318231e-108
YCL064C (CHA1)1.3ON3603318211e-108
KAFR0I00130singletonON3443388181e-107
Kpol_2002.61.3ON3503338141e-107
NCAS0A15330singletonON3473407941e-104
TPHA0E040401.3ON3573357921e-103
Ecym_10061.3ON3643387811e-101
NDAI0K02950singletonON3343377731e-101
AFR747W1.3ON4263317791e-100
ZYRO0F15774gsingletonON4103377751e-100
KLLA0C00440g1.3ON3773337721e-100
CAGL0B00286g1.3ON3603387701e-100
SAKL0C13904gsingletonON3393297651e-99
Smik_9.2na 1ON3383297284e-94
ZYRO0F18524g1.3ON3353337215e-93
KNAG0D05380singletonON3343317172e-92
Scer_YGOB_SDL1 (SDL1)na 1ON3373277093e-91
TDEL0D06540singletonON3373286921e-88
Skud_9.2na 1ON3393276833e-87
KLLA0E01805gsingletonON3223346736e-86
KNAG0A01150singletonON2312205101e-62
YIL167W (SDL1)singletonOFF2101924932e-60
YIL168WsingletonOFF1271242273e-22
SAKL0F11858g7.367ON5622741879e-15
KLLA0E19779g7.367ON5672641736e-13
KAFR0K017007.367ON5792631711e-12
CAGL0I05126g7.367ON5712791692e-12
NCAS0A142307.367ON5692791657e-12
TDEL0C018007.367ON5692751631e-11
ZYRO0B02772g7.367ON5692741612e-11
ACR232C7.367ON5602591551e-10
YER086W (ILV1)7.367ON5762641551e-10
NDAI0A018107.367ON5702741541e-10
TPHA0F031307.367ON5682641542e-10
Smik_5.2257.367ON5762641532e-10
Skud_5.2057.367ON5762641532e-10
Suva_5.1997.367ON5762641523e-10
TBLA0C050707.367ON5752661513e-10
KNAG0C036907.367ON5772791505e-10
Ecym_47087.367ON5702831471e-09
Kwal_33.148227.367ON5622891461e-09
Kpol_530.167.367ON5662591434e-09
KLTH0B04884g7.367ON5732751391e-08
SAKL0A10626gsingletonON3202611301e-07
YKL218C (SRY1)na 2ON3262861122e-05
Skud_11.2na 2ON3262851103e-05
Smik_11.3na 2ON26987850.034
AEL161Wna 3ON356255860.036
TDEL0D01810na 3ON352255760.51
Kwal_0.5na 3ON388255760.55
KLTH0H10846gna 3ON349260712.0
Ecym_6283na 3ON356312693.7
TPHA0D037406.311ON231761686.8
SAKL0G14366g5.142ON72237678.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F00440g
         (341 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   639   0.0  
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   358   e-122
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   355   e-121
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    343   e-117
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   331   e-112
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   330   e-111
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   330   e-111
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   329   e-111
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   324   e-109
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              323   e-109
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   321   e-108
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   320   e-108
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   319   e-107
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   318   e-107
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            310   e-104
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   309   e-103
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   305   e-101
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             302   e-101
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   304   e-100
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   303   e-100
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   301   e-100
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   301   e-100
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   299   e-99 
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      285   4e-94
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   282   5e-93
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   280   2e-92
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   277   3e-91
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            271   1e-88
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      267   3e-87
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   263   6e-86
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   201   1e-62
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   194   2e-60
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...    92   3e-22
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    77   9e-15
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    71   6e-13
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    70   1e-12
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    70   2e-12
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    68   7e-12
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    67   1e-11
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    67   2e-11
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    64   1e-10
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    64   1e-10
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    64   1e-10
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    64   2e-10
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    64   2e-10
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    64   2e-10
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    63   3e-10
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    63   3e-10
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    62   5e-10
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    61   1e-09
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    61   1e-09
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    60   4e-09
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    58   1e-08
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    55   1e-07
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    48   2e-05
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    47   3e-05
Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON} YKL...    37   0.034
AEL161W Chr5 (329283..330353) [1071 bp, 356 aa] {ON} Non-synteni...    38   0.036
TDEL0D01810 Chr4 complement(358357..359415) [1059 bp, 352 aa] {O...    34   0.51 
Kwal_0.5 s0 (2543..3709) [1167 bp, 388 aa] {ON} YGR012W - Hypoth...    34   0.55 
KLTH0H10846g Chr8 (931560..932609) [1050 bp, 349 aa] {ON} simila...    32   2.0  
Ecym_6283 Chr6 complement(534562..535632) [1071 bp, 356 aa] {ON}...    31   3.7  
TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {...    31   6.8  
SAKL0G14366g Chr7 (1238951..1241119) [2169 bp, 722 aa] {ON} simi...    30   8.2  

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/341 (91%), Positives = 313/341 (91%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
           GNKLPHVF               RALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW
Sbjct: 61  GNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA
Sbjct: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV             SRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT
Sbjct: 181 IVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD
Sbjct: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSKKILQ 341
           ILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSKKILQ
Sbjct: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSKKILQ 341

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  358 bits (920), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 173/334 (51%), Positives = 229/334 (68%), Gaps = 2/334 (0%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M S + KTPLL   F +S   L   PQF++K E  QPSGSFKSRGIG++IT+ A +I SE
Sbjct: 1   MTSFYSKTPLLRRIFPSSV--LSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESE 58

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
           GNK  HVF               RA S+PC+VVVP +T+ RMV KI   GA+V V+G +W
Sbjct: 59  GNKTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHW 118

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
            +AD++L  S++   + ++ + +YAHPFD+P+IWEGHS+IVDEI++SL+ Q+I    +K 
Sbjct: 119 GDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKG 178

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCS+              +H L   IPIIGVE+KGCEVF+ SLK GK   F+ ITS+AT
Sbjct: 179 IVCSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVAT 238

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+GT +I KKTLENAL+Y+TKSVVL+D +++ TCL FAD+TNI+PEPACGA+LH GY P 
Sbjct: 239 SLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPH 298

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDLASL 334
           +L   L     PED+II+I CGGS+T+  DL  +
Sbjct: 299 LLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQM 332

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  355 bits (912), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 171/332 (51%), Positives = 226/332 (68%), Gaps = 1/332 (0%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQ-PQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRS 59
           M   + KTPLL  +F  + +R  N  PQF LK E LQPSGSFKSRGIG +I KQA++I  
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 60  EGNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRN 119
           +G K P VF               + LS+PC+VVVP +T  RM++KI + GA V + G  
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 120 WKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIK 179
           WKEAD++LK+S+++  N +    IY HPFD+PLIWEGHSSIVDEI+D+L+EQK+   NIK
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 180 AIVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIA 239
            IVCSV              RHKLV KIP++GVE++GC VFN+SLKLGK  EFE ITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 240 TSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYP 299
           TS+ T SIS KT ENAL+Y T+SV++ D ++I TCL++  + N++ EPACGA++HL Y  
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 300 DILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
           DIL  AL +  T +D +++I CGGS+ +  D+
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDM 332

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  343 bits (881), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 170/332 (51%), Positives = 220/332 (66%), Gaps = 1/332 (0%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQ-PQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRS 59
           M   + KTPLL  +F A S +     PQF LK E LQPSGSFKSRGIG +I K AI+I+ 
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 60  EGNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRN 119
            GNK P VF               + LS+PC+VVVP +T  RMV+KI   GA V + G +
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 120 WKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIK 179
           WKEAD +LK S+++  + + T+ IY HPFD+P IWEGHS++VDEI+D+L EQ I L  IK
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 180 AIVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIA 239
            IVCSV              +HKL  KIPI+GVE+KGC VFN+SLKLGK  EF  ITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 240 TSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYP 299
           TS+GT SIS +T E A +YHT+SVV+ D ++I TCL++  + N++ EPACGA+LHL Y  
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 300 DILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
           +IL  AL    + +D+I++I CGGS+ +  DL
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDL 332

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  331 bits (849), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 165/331 (49%), Positives = 218/331 (65%), Gaps = 5/331 (1%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M   + KTPLL  +F        N PQ  LK E LQPSGSFKSRGIG +I K A++I+  
Sbjct: 1   MSLVYNKTPLLRQFFPGK-----NLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKI 55

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
           G +  HVF               + LS+PC+VVVP +T  RMV+KI N GA+V V G +W
Sbjct: 56  GERRAHVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHW 115

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEAD+ LK++++S  +   T+ IY HPFD+P IWEGH+++VDEI+++L  QKI  +N+K 
Sbjct: 116 KEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKG 175

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV              +H L  KIPI+GVE++GC V N+SL L K  EFE ITSIAT
Sbjct: 176 IVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIAT 235

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+GT SISK+T E A +Y+T+SVV+ D ++I TCL++  + N++ EPACGAALHL Y  D
Sbjct: 236 SLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVD 295

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
           IL +AL    TP DVI++I CGGS+ +  DL
Sbjct: 296 ILEKALGHSLTPNDVILVIACGGSSNTLKDL 326

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  330 bits (845), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/331 (48%), Positives = 218/331 (65%), Gaps = 5/331 (1%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M   + KTPLL  +F + S       QF LK E LQPSGSFKSRGIG +I K AI+I+ +
Sbjct: 1   MSIVYNKTPLLRQFFPSKS-----PAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKD 55

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
           G + P VF               + LS+PC+VVVP +T  RMV+KI N GA+V V G  W
Sbjct: 56  GRRSPQVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYW 115

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEAD FLK +I++  +    + IY HPFD+P IWEGHSS+VDEI+  LK Q+I +  +K 
Sbjct: 116 KEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKG 175

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV              R+ L  KIPI+GVE+ GC VFN+SL++G+  +F+ ITSIAT
Sbjct: 176 IVCSVGGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+GT  IS +T E A +Y+TKSVV+ D+++I TCL++  + N++ EPACGAALHLGY+ +
Sbjct: 236 SLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTE 295

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
           IL +AL S    +D++I+I CGGS+ +  DL
Sbjct: 296 ILEKALGSKLAADDIVIIIACGGSSNTVQDL 326

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  330 bits (845), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 220/331 (66%), Gaps = 5/331 (1%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M   + KTPLL  +F   S       QF LK E LQPSGSFKSRGIG +I K AI+I+  
Sbjct: 1   MSIVYNKTPLLRQFFPGKS-----LAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKN 55

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
           G + P VF               + LS+PC+VVVP +T  RMV+KI N GA+V V G  W
Sbjct: 56  GKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFW 115

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEAD +LK ++++  +    + IY HPFD+P IWEGHSS+VDEI+  LK Q++ ++ +K 
Sbjct: 116 KEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKG 175

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV              RH L  KIPI+GVE+KGC VFN+SL++G+  +F+ ITSIAT
Sbjct: 176 IVCSVGGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIAT 235

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+GT +IS +T E A +Y+TKSVV+ D+++I TCL+++ + N++ EPACGAALHLGY+ D
Sbjct: 236 SLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTD 295

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
           IL  AL++    +D++++I CGGS+ +  DL
Sbjct: 296 ILETALDTKLAADDIVLIIACGGSSNTVQDL 326

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  329 bits (844), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/341 (47%), Positives = 222/341 (65%), Gaps = 6/341 (1%)

Query: 1   MKSAFVKTPLLAHYF------AASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQA 54
           M   + KTPLL  +F      ++++  +   PQF +K E LQPSGSFKSRGIG +I K A
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 55  IKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVH 114
           + I   G K P VF               + LS+PC+VVVP +T  RMV+KI + GA V 
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 115 VYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKID 174
           + G +WKEAD FLK SI++  + +  + IY HPFD+PLIWEGH+++VDEI+DSL +Q I 
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 175 LKNIKAIVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFED 234
           +  +K IVCSV              ++ L  KIPI+GVE+KGC VFN+SLKL K  EF  
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 235 ITSIATSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALH 294
           ITSIATS+GT +ISKKT E A +Y T+SVV+ D+ +I TCL++  + N++ EPACGA++H
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 295 LGYYPDILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLF 335
           L Y+ DIL ++L      +D+I++I CGGS+ + +DL SL 
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLL 341

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  324 bits (831), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 218/332 (65%), Gaps = 6/332 (1%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M   + KTPLL  +F  S       PQF LK E +QPSGSFKSRGIG +I K   KI S 
Sbjct: 1   MSIVYNKTPLLRQFFRGSP-----IPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSS 55

Query: 61  G-NKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRN 119
             NK P VF               R LSIPC+VVVP +T  RMV KI + GA+V V G +
Sbjct: 56  NLNKRPQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGH 115

Query: 120 WKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIK 179
           W EAD +L+  +I+  + +  + IY HPFD+PLIWEGHS+++DEII+SL EQ ID++N+K
Sbjct: 116 WSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVK 175

Query: 180 AIVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIA 239
           AI CS+              ++ L  KIPIIGVE+ GC+VFN+SLKL KL +F  I +IA
Sbjct: 176 AITCSIGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIA 235

Query: 240 TSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYP 299
           TS+GT++IS KT ENAL+Y+TKSVV+ + ++I TCLR+  + N + EPACGAALHL Y  
Sbjct: 236 TSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNT 295

Query: 300 DILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
            ++  AL++  T +D+II+I CGGS+ +  +L
Sbjct: 296 GLIENALDTTLTKDDIIIVIACGGSSNTVQEL 327

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  323 bits (828), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 161/338 (47%), Positives = 218/338 (64%), Gaps = 1/338 (0%)

Query: 1   MKSAFVKTPLLAHYF-AASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRS 59
           M + + KTPLL  YF  A+     + PQ   K E  QP  SFKSRGIG +I K A K+  
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 60  EGNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRN 119
           EG K   VF               R LSIPC+VVVP ST  RMV+KI + GA+V V G  
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 120 WKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIK 179
           WKEAD++L+ S+I+  + S+ + +Y HPFD PLIWEGHS+I+DEI++SL ++ +    +K
Sbjct: 121 WKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVK 180

Query: 180 AIVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIA 239
            +VCS+              RH L  KIP+I VE++GC VFN+ L+LGK  EFE I+SIA
Sbjct: 181 GVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIA 240

Query: 240 TSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYP 299
           TS+G+ SIS KT E A +YH+K VVL D +++ TCLR+++++N+I EPAC A++HL Y  
Sbjct: 241 TSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNV 300

Query: 300 DILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSK 337
           DIL +ALN   + +DVII+I CGGSAT+  D+    +K
Sbjct: 301 DILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAK 338

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  321 bits (823), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 214/331 (64%), Gaps = 5/331 (1%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M   + KTPLL  +F   S       QF LK E LQPSGSFKSRGIG +I K AI+I+ +
Sbjct: 1   MSIVYNKTPLLRQFFPGKS-----PAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKD 55

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
           G K P +F               + LS+PC+VVVP +T  RMV+KI N GA+V V G  W
Sbjct: 56  GKKSPQIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYW 115

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEAD FLK  ++   +    + IY HPFD+P IWEGHSS+VDE++  L+ Q+I +  +K 
Sbjct: 116 KEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKG 175

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV              R+ L  KIPI+GVE+ GC VFN+SL++G+  +F+ ITSIAT
Sbjct: 176 IVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+GT  IS +T + A +Y+T+SVV+ D+++I TCL++  + N++ EPACGAALHLGY  +
Sbjct: 236 SLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTE 295

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
           IL +AL S    +D++I+I CGGS+ +  DL
Sbjct: 296 ILERALGSKLAADDIVIIIACGGSSNTIQDL 326

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  320 bits (821), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 158/331 (47%), Positives = 213/331 (64%), Gaps = 5/331 (1%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M   + KTPLL  +F   ++      QF LK E LQPSGSFKSRGIG +I K AI+I+ +
Sbjct: 1   MSIVYNKTPLLRQFFPGKAS-----AQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKD 55

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
           G + P VF               + LS+PC+VVVP +T  RMV KI N GA+V V G  W
Sbjct: 56  GKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYW 115

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEAD FLK ++++  +    + IY HPFD+P IWEGHSS++DEI+  LK Q I +  +K 
Sbjct: 116 KEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKG 175

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV              R+ L  +IPI+GVE+ GC VFN+SLK+G+  +F+ ITSIAT
Sbjct: 176 IVCSVGGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIAT 235

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+GT  IS +T E A +Y+T+SVV+ D+++I TCL++  + N++ EPACGAALHLGY   
Sbjct: 236 SLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTK 295

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
           IL  AL S    +D++I+I CGGS+ +  DL
Sbjct: 296 ILENALGSKLAADDIVIIIACGGSSNTIKDL 326

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  319 bits (818), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 154/338 (45%), Positives = 222/338 (65%), Gaps = 1/338 (0%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQ-PQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRS 59
           M   + KTPL+   F  +  R  +  PQ ++K E+LQPSGSFKSRGIG ++ ++A++I+ 
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 60  EGNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRN 119
              K P VF               + LS+PC+VVVP +T  RM++KI + GA+V ++G  
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 120 WKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIK 179
           WK ADK++K S+++  N  + + IY HP D PLIWEG+S IVDE+++SL+EQKID   +K
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 180 AIVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIA 239
           AIVCSV              R+KL  KIPI+GVE+ G  VFN+ LK GK  EFE I+++A
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 240 TSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYP 299
           TS+G+ SI+KKT E A++Y  + V++ D E++ TCLR+  + N+I EPACGAA+HL Y+ 
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 300 DILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSK 337
           DIL +AL++    +DV+I+I CGGS+ S +D+     K
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKK 338

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  318 bits (814), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 223/333 (66%), Gaps = 5/333 (1%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M   + KTPLL H+F        N PQF LK E LQPSGSFKSRGIG +I K AI+I+  
Sbjct: 1   MSLVYNKTPLLKHFFPGK-----NLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKI 55

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
             K P+VF               + LS+PC+VVVP +T  RMVQKI   GA V + G +W
Sbjct: 56  NVKKPYVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHW 115

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEAD FLK++I++  N  + + IY HPFD+PLIWEGHS++VDEI+++  +QK ++KN+KA
Sbjct: 116 KEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKA 175

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV              ++ L  KIP++GVE++GC VFN+SLKL K  EF  I++IAT
Sbjct: 176 IVCSVGGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIAT 235

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+GT +IS +  + A +Y+TKSVV+ D++++ TCL+F  + N++ EPACGAA+HLGY+ D
Sbjct: 236 SLGTANISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTD 295

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDLAS 333
           +L  AL +  T +D ++++ CGGS+ +  +L +
Sbjct: 296 LLETALGTKLTCDDAVLIVACGGSSNTVKELET 328

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  310 bits (794), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 151/340 (44%), Positives = 214/340 (62%), Gaps = 8/340 (2%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M   + KTPLL   F  +  ++P+ PQ  +K E LQPSGSFKSRGIG++I K A++++  
Sbjct: 1   MSLVYNKTPLLRRVFP-TGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQL 59

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
           G K  HVF               ++L +PC+VVVP ST +RMV+KI N+G EV V G +W
Sbjct: 60  GGKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHW 119

Query: 121 KEADKFLKESIISGHNPSRTQV---IYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKN 177
           KEAD FLK S+I    PS  ++   IY HPFDHP +WEGHS++VDEI+D+ + Q + L  
Sbjct: 120 KEADSFLKNSVI----PSVDRIEEPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNK 175

Query: 178 IKAIVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITS 237
           +KAIVCSV              ++ L  KIP+I +E+ GC  FN+ LK  K  E   ITS
Sbjct: 176 VKAIVCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITS 235

Query: 238 IATSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGY 297
           +ATS+G   ++ K  EN  RY + SVVL D ++++TCL++A++ NII EPACGA+LH+ Y
Sbjct: 236 VATSLGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAY 295

Query: 298 YPDILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSK 337
              ++ +AL      +D+I++I CGGSA +  DL + + +
Sbjct: 296 NTKLIEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQ 335

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  309 bits (792), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 150/335 (44%), Positives = 215/335 (64%), Gaps = 6/335 (1%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M   + KTPLL H F        N PQ  LK E  QPSGSFKSRGIG +I   +++I+  
Sbjct: 1   MSQVYNKTPLLRHLFPGK-----NLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKN 55

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
             K P VF               + LS+PC+VVVP +T  RMV+KI   GA V V G +W
Sbjct: 56  SKKSPEVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHW 115

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEAD +LK +++S  +    + IY HPFD+  IWEGH++++DEI+++  +Q I ++ +KA
Sbjct: 116 KEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKA 175

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV              +H L  KIP++GVE+ GC VFN+SLK+GK+ +FE I +IAT
Sbjct: 176 IVCSVGGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIAT 235

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+GT +IS +T E A +Y+TKS+V+ D +++ TCL+F  ++N++ EPACGAALH+GY  D
Sbjct: 236 SLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMD 295

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL-ASL 334
           IL ++L      +D++++I CGGS+ +  +L ASL
Sbjct: 296 ILEKSLGKKLATDDIVLIIACGGSSNTVQELEASL 330

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  305 bits (781), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 155/338 (45%), Positives = 210/338 (62%), Gaps = 5/338 (1%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M S +VKTPLL   F   + ++   PQF++K EF QPSGSFKSRGIG +I  +  +IR +
Sbjct: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
             K PHVF               + + IPC+VVVP ST  R+++KI   GA +   G  +
Sbjct: 61  PAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120

Query: 121 KEADKFLKESIISGHNPS----RTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLK 176
            EAD +LK+ +    N +    +   IY HPF+HPLIW GHS IV+EI++SL+ + I   
Sbjct: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180

Query: 177 NIKAIVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDIT 236
            +K IVCSV              RH L + IPIIGVE++GCEV + SL  GKL  F+   
Sbjct: 181 RVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240

Query: 237 SIATSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLG 296
           S+ATS+   +I+K+TL  A +Y TKS+VL + E++ TCLRF DE+NI+ EPACGA LHLG
Sbjct: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300

Query: 297 YYPDILYQALNSDFTPEDVIIMIGCGGSATSYNDLASL 334
           Y+P IL++ L    + ED++I+I CGGSAT+  DL  L
Sbjct: 301 YHPAILHKELGP-LSSEDIVILIACGGSATTLADLREL 337

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  302 bits (773), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 148/337 (43%), Positives = 213/337 (63%), Gaps = 5/337 (1%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M   + KTPLL   F ++       P+  LK E LQPSGSFKSRGIG +I +   K++ +
Sbjct: 1   MSFIYNKTPLLRQTFDSAKI----GPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQD 56

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
           GNK  HVF               R+L +PC+VVVP+ST  RMV KI   GA V + G +W
Sbjct: 57  GNKTAHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHW 116

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEAD FL++S+    N ++ Q IY HPFD P+IWEGHS+I+DEI+ +L+ +KI ++ +K 
Sbjct: 117 KEADDFLRKSMKEMDN-TQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKG 175

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           I+CSV              RH L   IP+I VE+KGC+V N SLK G   +   ITS+AT
Sbjct: 176 IICSVGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVAT 235

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+G+  IS    ENA++Y+++S+ L D++++ TCL++ D+ ++  EPACGA++HL Y P 
Sbjct: 236 SLGSTYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPG 295

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSK 337
           I+  AL +  +  D++I++ CGGS+ + +DL SL SK
Sbjct: 296 IVESALGTALSNHDIVIVVLCGGSSCTLHDLESLNSK 332

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  304 bits (779), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 151/331 (45%), Positives = 209/331 (63%), Gaps = 2/331 (0%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M S + KTPL+ H FA  + R    P+ MLK EF QPSGSFKSRGIG +I K+  KIR  
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
            +  PHVF               R L +PC+VVVPE+T  RMV++I + GA+V   G   
Sbjct: 129 SSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KE+D +L+  ++   N  +   IYAHPFD+PLIWEGH+++VDE++++L  Q + L+++K 
Sbjct: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV              +H L   IP++ VE++GCEV + SL LG+     +  S+AT
Sbjct: 249 IVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSM-NPKSVAT 307

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+ T+ ++  TL  A +Y TKSVVL    ++ TCL FA+E+NI+ EPACGAALHLGY+P+
Sbjct: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
           IL + L    TP+DV+I+I CGGS  +  DL
Sbjct: 368 ILERELGP-LTPQDVVIVIACGGSTMNLADL 397

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  303 bits (775), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 151/337 (44%), Positives = 214/337 (63%), Gaps = 5/337 (1%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M S + KTPLL   F  +++      Q  +K E LQPSGSFKSRGIG++I+K+A  I+ +
Sbjct: 47  MPSIYNKTPLLKQIFNHATS-----AQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGD 101

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
           G K PHVF               + L++PC+VV+P +T  RM  KI   GA V V G +W
Sbjct: 102 GRKSPHVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHW 161

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEAD  LK  + +  N +  + IY HPFD+P IWEGH+SIVDEII SLK +   L  +K 
Sbjct: 162 KEADSHLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKG 221

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV              ++ L +KIP++ VE+KGC V N+SL++G+  EF  + S+AT
Sbjct: 222 IVCSVGGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVAT 281

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+ T+ IS +TL+   +Y +KS+VL D+E++ TCL++A+  N+I EPACGA+LHLGY+P 
Sbjct: 282 SLCTSQISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQ 341

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSK 337
           ++ +AL  +   +DVII+I CGGS+ +  DL    +K
Sbjct: 342 LIERALGKNLDKDDVIIVIACGGSSNTILDLEESLAK 378

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  301 bits (772), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 155/333 (46%), Positives = 212/333 (63%), Gaps = 6/333 (1%)

Query: 5   FVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIR-SEGNK 63
           F KTPLL H F  S       PQ +LK EFLQPSGSFKSRGIG++I+ +  +I+ S   K
Sbjct: 25  FSKTPLLKHQFKRSKG-----PQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEK 79

Query: 64  LPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEA 123
           + HVF                 L++PC+VVV  +T  R+++KI + GA+V V+G +WKEA
Sbjct: 80  IGHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEA 139

Query: 124 DKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVC 183
           D F+KE ++   +  + + IY+HPFD+PLIWEGHS +VDEI+D L   KI +  IK IVC
Sbjct: 140 DSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVC 199

Query: 184 SVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIG 243
           S               R+ L  KIPI+ VE+KG +V ++SL++G   EFE I+S ATS+G
Sbjct: 200 SFGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLG 259

Query: 244 TNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPDILY 303
           T +IS    +N  R+ +KS V++D E+ISTCL+F+++TNI+ EP CGA L+ GY  D L 
Sbjct: 260 TATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQ 319

Query: 304 QALNSDFTPEDVIIMIGCGGSATSYNDLASLFS 336
             L SD   +D +I+IGCGGS+TS  DL  L S
Sbjct: 320 NILGSDIKDDDYVILIGCGGSSTSLEDLKELSS 352

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  301 bits (770), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/338 (44%), Positives = 212/338 (62%), Gaps = 10/338 (2%)

Query: 3   SAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEG- 61
           S + KTPL+   F       P+ PQ  LK E  QPSGSFKSRGIG++I+KQ+ +I   G 
Sbjct: 2   SVYNKTPLIRQIF-------PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGL 54

Query: 62  NKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWK 121
            K P VF               + L++PC+VV+P +T  RM  KI   GA V V G  WK
Sbjct: 55  GKKPMVFASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWK 114

Query: 122 EADKFLKESIISGHNPSRTQV--IYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIK 179
           EAD +LK++I+S        V  IY HPFD+P IWEGH+S+VDEI++  K + I L  IK
Sbjct: 115 EADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIK 174

Query: 180 AIVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIA 239
           AIVCSV              ++ L  KIPI+GVE+KGC VFN+SL++ K+  F+ ITSIA
Sbjct: 175 AIVCSVGGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIA 234

Query: 240 TSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYP 299
           TS+GT  IS +  + A RY TKSVVL+DQ+++ TCLR+  + N++ EPACGAA+HL Y+ 
Sbjct: 235 TSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHT 294

Query: 300 DILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSK 337
           +IL + L +    +D+++++ CGGS+ +  D+ S+  +
Sbjct: 295 EILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQR 332

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  299 bits (765), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 144/329 (43%), Positives = 206/329 (62%), Gaps = 4/329 (1%)

Query: 3   SAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGN 62
           S + KTPLL      +       P+F LK EFLQP GSFKSRGIGY++ K   K R +G 
Sbjct: 6   SFYNKTPLLPRVLTTTDG----APRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGG 61

Query: 63  KLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKE 122
           K   VF               +  SI C+VVVP +T +RMV+KI   GAEV VYG++W  
Sbjct: 62  KSLAVFSSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGM 121

Query: 123 ADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIV 182
           AD++L+E ++   + S+   +Y HPFD+P+IW+GHS+IVDE++  LKE+ + +  +KAIV
Sbjct: 122 ADEYLREVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIV 181

Query: 183 CSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSI 242
           CSV               H+L  +IPI+ +E+KGC+V N SL  G     E +TS+A+S+
Sbjct: 182 CSVGGGGLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSL 241

Query: 243 GTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPDIL 302
            +  IS+K  ENA +Y +KS++L D ++I TCL FAD+  I+ EPACGA+L+  Y+P++L
Sbjct: 242 ASPYISEKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELL 301

Query: 303 YQALNSDFTPEDVIIMIGCGGSATSYNDL 331
              +  + T +DVI++I CGGSA +Y DL
Sbjct: 302 PLYIGKELTEDDVIVVIACGGSAVTYKDL 330

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  285 bits (728), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 207/329 (62%), Gaps = 4/329 (1%)

Query: 3   SAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGN 62
           S + KTPL+   F    +     P F +K + LQP GSFKSRGIG++I K+  +  +EG+
Sbjct: 4   SHYEKTPLIRQVF----DNGKTNPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGS 59

Query: 63  KLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKE 122
               VF               R +++ C+VVVP++T +RMV+KI + GA+V ++G +W E
Sbjct: 60  GKLVVFSSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGE 119

Query: 123 ADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIV 182
           AD++LK+ +++      ++ +Y HPFD  +IWEGHS+IVDEI+  L+E+ I    +K +V
Sbjct: 120 ADEYLKQEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLV 179

Query: 183 CSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSI 242
           CSV              R++L  KIPI+ VE+ GC+V N SLK G     E +TS+ATS+
Sbjct: 180 CSVGGGGLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSL 239

Query: 243 GTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPDIL 302
           G+  I+    E+ + Y  KSVVL+DQ+++ TCLR+AD+ N I EPACGA+LHL Y+P+IL
Sbjct: 240 GSPYIAPFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEIL 299

Query: 303 YQALNSDFTPEDVIIMIGCGGSATSYNDL 331
            +AL    + +DV+I+I CGGS  +Y DL
Sbjct: 300 EKALGQKLSEDDVVIIIACGGSCMTYEDL 328

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  282 bits (721), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 145/333 (43%), Positives = 204/333 (61%), Gaps = 10/333 (3%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M + + KTPLL       +      PQ  +K E LQP GSFKSRGIG +I+     ++SE
Sbjct: 1   MNNWYYKTPLLRQILNWKTTT--ELPQIFIKYENLQPGGSFKSRGIGNLIS-----LKSE 53

Query: 61  GNKL-PHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRN 119
              +  HV                + + +PC+VVVP ST  RMVQKI N GAEV + G +
Sbjct: 54  NGLVKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSH 113

Query: 120 WKEADKFLKESII-SGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNI 178
           WKEAD +L+++ I S  N   ++ +Y HPFD P +WEGHS++V EIID+L+EQ I ++N+
Sbjct: 114 WKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENV 173

Query: 179 KAIVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSI 238
           + IVCSV               H L  KIP+I VE+ GC V N+SL  G+    + ITS+
Sbjct: 174 RGIVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSL 233

Query: 239 ATSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYY 298
           ATS+G+  I +   ENA+RY  KS+VL D+++I TCLR+  +   I EPACGA+LH+GY+
Sbjct: 234 ATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYH 293

Query: 299 PDILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
           P++L   L   F+ +D+I++I CGGS T++ DL
Sbjct: 294 PELLENFLGG-FSKDDIIVIIACGGSTTTFKDL 325

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  280 bits (717), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 141/331 (42%), Positives = 200/331 (60%), Gaps = 7/331 (2%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M + + KTPLL    +       + P F+ K E +QP GSFK RG+ ++I K+  +I+SE
Sbjct: 1   MPALYNKTPLLPKNLSGG-----DGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSE 55

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
           G K PHVF                 LSIPC+VVVP  T  RMV+KI    AEV V G NW
Sbjct: 56  GKKPPHVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNW 115

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEAD +L+ ++I+ +N    Q IY +PFD PL+WEGHS+++DEI+++L ++ I L  +K 
Sbjct: 116 KEADDYLRGTVIASNN--AVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKG 173

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV               H+L   IP++ VE+KGC+V   SL   K      I SIAT
Sbjct: 174 IVCSVGGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIAT 233

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+G++ +S +  +NA+++ ++SVVL D ++++TC R+ D+ N I EPACGA +H  Y+  
Sbjct: 234 SLGSSYVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYK 293

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
           IL +AL    TP D+II+I CGGS  +  DL
Sbjct: 294 ILEKALGQKLTPSDIIIIIVCGGSCVTIQDL 324

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  277 bits (709), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 140/327 (42%), Positives = 202/327 (61%), Gaps = 5/327 (1%)

Query: 5   FVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKL 64
           + KTPL+  +     N       F +K E LQP GSFKSRGIG++I K   +  SEG+  
Sbjct: 6   YEKTPLIRQFL----NNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGK 61

Query: 65  PHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD 124
             VF               R++++ CSVVVP++T  RMV+KI + GA+V ++G +W EAD
Sbjct: 62  LAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEAD 121

Query: 125 KFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCS 184
           ++L+  + +  +   ++ +Y HPFD+  IWEGHS+IVDEII+ LKE  I L  +KA+VCS
Sbjct: 122 EYLRHEM-AQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCS 180

Query: 185 VXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGT 244
           V              R++L  KIP++ VE+ GC+V N SLK G     E +TS+ATS+ +
Sbjct: 181 VGGGGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLAS 240

Query: 245 NSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPDILYQ 304
             I+    E+  +Y  KSVVL+DQ++++TCLR+AD+ N I EPACGA+LHL Y+P+IL  
Sbjct: 241 PYIASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILED 300

Query: 305 ALNSDFTPEDVIIMIGCGGSATSYNDL 331
            L      +D++I+I CGGS  +Y DL
Sbjct: 301 ILEQKIYEDDIVIIIACGGSCMTYEDL 327

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  271 bits (692), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 139/328 (42%), Positives = 198/328 (60%), Gaps = 4/328 (1%)

Query: 7   KTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPH 66
           K+PLL   F  S     + PQF LK E LQPSGSFKSRGIGY+I  +A + RS      H
Sbjct: 6   KSPLLNRRFKESEK---DGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSDVH 62

Query: 67  VFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKF 126
           VF               + L++ C+VVVP +T   M+ +I N G++V V+G +W  AD +
Sbjct: 63  VFSSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMADTY 122

Query: 127 LKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVX 186
           LKE ++    PS  + +Y HPFD PL+WEGHS ++DEI++ L+EQ   ++++K I+CSV 
Sbjct: 123 LKE-VVMKKVPSNVEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICSVG 181

Query: 187 XXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNS 246
                        RH    KIPII VE+ G +    SL  GK     ++TSIA+S+G+  
Sbjct: 182 GGGLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGSPY 241

Query: 247 ISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPDILYQAL 306
           I++ + E A+RY T+S V TD+E + T LRF  ETNI+ EPAC A++ L Y+ D L + L
Sbjct: 242 IAQDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNKLL 301

Query: 307 NSDFTPEDVIIMIGCGGSATSYNDLASL 334
           +   + +D++I+I CGGSAT+ +DL  L
Sbjct: 302 SCKLSSKDIVIVIVCGGSATTISDLEML 329

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  267 bits (683), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 133/327 (40%), Positives = 201/327 (61%), Gaps = 4/327 (1%)

Query: 5   FVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKL 64
           + +TPL+   F    N     P+  +K E LQP GSFKSRGIG++I +   +  ++G+  
Sbjct: 6   YERTPLIHQVF----NNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGK 61

Query: 65  PHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD 124
             VF                ++++ C+VVVP++T +RM++KI N GA+V ++G +W EAD
Sbjct: 62  LAVFSSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEAD 121

Query: 125 KFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCS 184
           ++L++ ++   +   ++ +Y HPFD   IWEGHS+IVDE++  L+E+ I L  IKA+VCS
Sbjct: 122 EYLRQELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCS 181

Query: 185 VXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGT 244
           V              R+ L  KI +I VE+ GC+V N SL  G     E ++SIATS+G+
Sbjct: 182 VGGGGLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGS 241

Query: 245 NSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPDILYQ 304
             I+    E+   Y  KSVVL+DQ++++TCLR+AD+ N I EPACGA+LHL Y+ +IL  
Sbjct: 242 PYIAPFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILEN 301

Query: 305 ALNSDFTPEDVIIMIGCGGSATSYNDL 331
           AL    + +D++I+I CGGS  +Y DL
Sbjct: 302 ALEQKLSDDDIVIIIACGGSCMTYEDL 328

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  263 bits (673), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 133/334 (39%), Positives = 198/334 (59%), Gaps = 13/334 (3%)

Query: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60
           M    +KTPLL          L   P F+LK E LQP GSFKSRGI ++I      I   
Sbjct: 1   MDQLTIKTPLLPF-----REPLNGGPTFLLKYENLQPGGSFKSRGISHLIKTTMDSISDP 55

Query: 61  GNKLPHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120
            N+L  V+                 L +PC+V+VP+ST  RM++KI + GA+V ++G +W
Sbjct: 56  ENELA-VYSSSGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHW 114

Query: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180
           KEAD +L+E ++     S +  +Y HPFD+P+IW+GHS+++DEII+ L E   D+ ++K 
Sbjct: 115 KEADTYLREYVM--RQSSYSNTLYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKG 172

Query: 181 IVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240
           IVCSV              RH L   IP+  +E+ GC+V + SL  G+    + I+SIAT
Sbjct: 173 IVCSVGGGGLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIAT 232

Query: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300
           S+G+  I   + + A+++ +KS+VL D+ ++ TCLRF DET+I+ EPACGA+LH  Y P+
Sbjct: 233 SLGSTEICADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPE 292

Query: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDLASL 334
           +L         P+D++++I CGGS  +Y+DL S 
Sbjct: 293 LL-----GPLGPDDIVVVILCGGSCNTYDDLKSF 321

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  201 bits (510), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 90/220 (40%), Positives = 144/220 (65%), Gaps = 2/220 (0%)

Query: 112 EVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQ 171
           EV V+  N KEAD +L+  +I  +     Q IY +PFD PLIWEGHS+I+DEI+++L ++
Sbjct: 4   EVFVHVANLKEADYYLQNVVIDLY--KDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQE 61

Query: 172 KIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTE 231
            I++ ++K I+CS               ++ L + IP++ VE+KGC+V N SL   K  +
Sbjct: 62  NIEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQ 121

Query: 232 FEDITSIATSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGA 291
            + ITSIA S+G++ +S+K  +N ++YH+KS+VL D + + TC ++ D+   + EPACGA
Sbjct: 122 LDSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGA 181

Query: 292 ALHLGYYPDILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331
           ++H  Y+ ++L +AL+    P+DVII+I CGGS  ++ DL
Sbjct: 182 SVHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDL 221

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  194 bits (493), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 127/192 (66%)

Query: 140 TQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXS 199
           ++ +Y HPFD+  IWEGHS+IVDEII+ LKE  I L  +KA+VCSV              
Sbjct: 9   SKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLD 68

Query: 200 RHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYH 259
           R++L  KIP++ VE+ GC+V N SLK G     E +TS+ATS+ +  I+    E+  +Y 
Sbjct: 69  RNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYG 128

Query: 260 TKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPDILYQALNSDFTPEDVIIMI 319
            KSVVL+DQ++++TCLR+AD+ N I EPACGA+LHL Y+P+IL   L      +D++I+I
Sbjct: 129 CKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIII 188

Query: 320 GCGGSATSYNDL 331
            CGGS  +Y DL
Sbjct: 189 ACGGSCMTYEDL 200

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score = 92.0 bits (227), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 72/124 (58%), Gaps = 4/124 (3%)

Query: 5   FVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKL 64
           + KTPL+  +     N       F +K E LQP GSFKSRGIG++I K   +  SEG+  
Sbjct: 6   YEKTPLIRQFL----NNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGK 61

Query: 65  PHVFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD 124
             VF               R++++ CSVVVP++T  RMV+KI + GA+V ++G +W EAD
Sbjct: 62  LAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEAD 121

Query: 125 KFLK 128
           ++L+
Sbjct: 122 EYLR 125

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 113/274 (41%), Gaps = 27/274 (9%)

Query: 19  SNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXX 78
           S+RL    Q  LK E L P  SFK RG   MI K       E  K   V           
Sbjct: 74  SSRLNANVQ--LKREDLLPVFSFKLRGAYNMIAKL-----DESQKTQGVIACSAGNHAQG 126

Query: 79  XXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD----KFLKESIISG 134
                + L+IP ++V+P ST +   Q +  LG++V +YG ++ EA     K  +E  ++ 
Sbjct: 127 VAYASKHLNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLTEERGLTN 186

Query: 135 HNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXX 194
                       PFDHP +  G  +I  EI+     Q  +   IKA+ C+V         
Sbjct: 187 ----------IPPFDHPYVIAGQGTIAMEIL----RQVHNASKIKAVFCAVGGGGLITGV 232

Query: 195 XXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLEN 254
                R  +   I +IGVE+      ++SLK GK     ++ + A       I ++T   
Sbjct: 233 GAYLKR--IAPHIKVIGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRV 290

Query: 255 ALRYHTKSVVLTDQEIISTCLRFADETNIIPEPA 288
           A     + V++   EI +      ++T  I EP+
Sbjct: 291 AKDVVDEVVLVNTDEICAAVKDIFEDTRSIVEPS 324

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 105/264 (39%), Gaps = 17/264 (6%)

Query: 30  LKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSIP 89
           LK E L P  SFK RG   MI K       E  K   V                  ++IP
Sbjct: 88  LKREDLLPVFSFKLRGAYNMIAKL-----DETQKNAGVIACSAGNHAQGVAFSSNHMNIP 142

Query: 90  CSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFD 149
            ++V+P ST +   Q +  LGA+V +YG ++ EA     E          T +    PFD
Sbjct: 143 ATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEAK---LECARLAEERGMTDI---PPFD 196

Query: 150 HPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLVHKIPI 209
           HP +  G  +I  EI+  ++       NI A+ C+V              R  +   I +
Sbjct: 197 HPYVIAGQGTIAMEILRQVQNG----SNIGAVFCAVGGGGLISGIGSYLKR--IAPHIKV 250

Query: 210 IGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVLTDQE 269
           IGVE+      + SLK GK T    + + A       I ++T         + +++   E
Sbjct: 251 IGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLIGEETFRVCQDVVDEVILVNTDE 310

Query: 270 IISTCLRFADETNIIPEPACGAAL 293
           I +      ++T  I EP+   A+
Sbjct: 311 ICAAVKDVFEDTRSIVEPSGALAV 334

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 108/263 (41%), Gaps = 25/263 (9%)

Query: 30  LKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSIP 89
           LK E L P  SFK RG   MI K    +R++G     V                + L IP
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG-----VIACSAGNHAQGVAYAAKKLGIP 154

Query: 90  CSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD----KFLKESIISGHNPSRTQVIYA 145
            ++V+P ST +   Q +  LG++V +YG ++ EA     K  +E  ++            
Sbjct: 155 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLSEERGLTN----------I 204

Query: 146 HPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLVH 205
            PFDHP +  G  ++  EI+     Q  +   I A+   V              R  +  
Sbjct: 205 PPFDHPYVIAGQGTVAMEIL----RQVHNANKINAVFVPVGGGGLIAGVGAYLKR--IAP 258

Query: 206 KIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVL 265
            I +IGVE+      ++SL+ GK TE   + + A       I ++T   A     + V++
Sbjct: 259 HIKVIGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEVVDEIVLV 318

Query: 266 TDQEIISTCLRFADETNIIPEPA 288
              E+ +      ++T  I EP+
Sbjct: 319 NTDELCAAIKDVFEDTRSILEPS 341

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 112/279 (40%), Gaps = 27/279 (9%)

Query: 19  SNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXX 78
           S+RL    Q  LK E L P  SFK RG   MI K     R++G     V           
Sbjct: 83  SSRLNTNVQ--LKREDLLPVFSFKLRGAYNMIAKLDDTQRNQG-----VIACSAGNHAQG 135

Query: 79  XXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD----KFLKESIISG 134
                R L IP ++V+P ST +   Q +  LG++V +YG ++ EA     K  +E  ++ 
Sbjct: 136 VAYAARHLDIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN 195

Query: 135 HNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXX 194
                       PFDHP +  G  ++  EI+     Q  +   I A+   V         
Sbjct: 196 ----------IPPFDHPYVIAGQGTVAMEIL----RQVYNSNKIGAVFVPVGGGGLIAGV 241

Query: 195 XXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLEN 254
                R  +   I IIGVE+      ++SL+  K T    + + A       I ++T   
Sbjct: 242 GAYLKR--VTPHIKIIGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRV 299

Query: 255 ALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAAL 293
           A     + V++   EI +      ++T  I EP+   A+
Sbjct: 300 AREVVDEIVLVNTDEICAAVKDVFEDTRSIVEPSGALAV 338

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 113/279 (40%), Gaps = 27/279 (9%)

Query: 19  SNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXX 78
           S+RL    Q  LK E L P  SFK RG   MI K     R++G     V           
Sbjct: 81  SSRLNTNVQ--LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQG 133

Query: 79  XXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD----KFLKESIISG 134
                + L IP ++V+P ST +   Q +  LG++V +YG ++ EA     K  +E  ++ 
Sbjct: 134 VAYAAKHLGIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN 193

Query: 135 HNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXX 194
                       PFDHP +  G  ++  EI+     Q  +   I A+   V         
Sbjct: 194 ----------IPPFDHPYVIAGQGTVAMEIL----RQVHNANKIGAVFVPVGGGGFIAGV 239

Query: 195 XXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLEN 254
                R  +   I +IGVE+      ++SLK  K T    + + A       I ++T   
Sbjct: 240 GAYLKR--IAPHIKVIGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRV 297

Query: 255 ALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAAL 293
           A +   + V++   EI +      ++T  I EP+   A+
Sbjct: 298 AQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALAV 336

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 111/275 (40%), Gaps = 19/275 (6%)

Query: 19  SNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXX 78
           S+RL    Q  LK E L P  SFK RG   MI K     +++G     V           
Sbjct: 81  SSRLNTNVQ--LKREDLLPVFSFKLRGAYNMIAKLDDSQKNQG-----VIACSAGNHAQG 133

Query: 79  XXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPS 138
                + +SIP ++V+P ST +   Q +  LG++V +YG ++ EA     E         
Sbjct: 134 VAFAAKHMSIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK---AECTRLSEERG 190

Query: 139 RTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXX 198
            T +    PFDHP +  G  ++  EI+  ++        I A+                 
Sbjct: 191 LTNI---PPFDHPYVIAGQGTVAMEILRQVRNS----AKIGAVFVPCGGGGLVAGIGAYL 243

Query: 199 SRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRY 258
            R  +   I IIGVE+      ++SLK GK T    + + A       I ++T   A   
Sbjct: 244 KR--IAPHIKIIGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDV 301

Query: 259 HTKSVVLTDQEIISTCLRFADETNIIPEPACGAAL 293
             + V++   EI +      ++T  I EP+   A+
Sbjct: 302 VDEVVLVGTDEICAAIKDIFEDTRGIVEPSGALAV 336

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 114/274 (41%), Gaps = 27/274 (9%)

Query: 19  SNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXX 78
           S+RL    Q  LK E L P  SFK RG   MI K     +++G     V           
Sbjct: 81  SSRLNTNVQ--LKREDLLPVFSFKLRGAYNMIAKLDENQKNQG-----VIACSAGNHAQG 133

Query: 79  XXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD----KFLKESIISG 134
                R ++IP ++V+P ST +   Q +  LG++V +YG ++ EA     K  +E  ++ 
Sbjct: 134 VAYAARHMNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN 193

Query: 135 HNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXX 194
                       PFDHP +  G  ++  EI   L++    LK I A+   V         
Sbjct: 194 ----------IPPFDHPYVIAGQGTVAMEI---LRQVHNSLK-IGAVFVPVGGGGLIAGI 239

Query: 195 XXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLEN 254
                R  +   I I+GVE+      ++S+K GK    + + S A       I ++T   
Sbjct: 240 GAYLKR--IAPHIKIVGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRV 297

Query: 255 ALRYHTKSVVLTDQEIISTCLRFADETNIIPEPA 288
           +     + V++   EI +      ++T  I EP+
Sbjct: 298 SQEVVDEIVLVNTDEICAAVKDIFEDTRSIIEPS 331

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 102/259 (39%), Gaps = 17/259 (6%)

Query: 30  LKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSIP 89
           LK E L P  SFK RG   MI+        E  K   V                R L I 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMISNL-----DEYQKSAGVIACSAGNHAQGVAFSARELGIR 136

Query: 90  CSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFD 149
             +V+P ST +     +  +GAEV +YG+++ EA K     +   H     ++    PFD
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEA-KAECARLAQLH-----KLTDIPPFD 190

Query: 150 HPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLVHKIPI 209
           HP +  G  +I  EI+     Q  +   I A+ C V              R  +   I I
Sbjct: 191 HPYVIAGQGTIATEIL----RQVHNASQIGAVFCGVGGGGLIAGIGSYLKR--IAPHIKI 244

Query: 210 IGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVLTDQE 269
           IGVE+      +++LK G+ T    +   A       + ++T   A     + V++   E
Sbjct: 245 IGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLVNTDE 304

Query: 270 IISTCLRFADETNIIPEPA 288
           + +      ++T  I EP+
Sbjct: 305 LCAAIKDIFEDTRAIVEPS 323

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 106/264 (40%), Gaps = 25/264 (9%)

Query: 29  MLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSI 88
           +LK E L P  SFK RG   MI K     R++G     V                + L I
Sbjct: 96  ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQGVAFAAKHLKI 150

Query: 89  PCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD----KFLKESIISGHNPSRTQVIY 144
           P ++V+P  T +   Q +  LG++V +YG ++ EA     K  +E  ++           
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN---------- 200

Query: 145 AHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLV 204
             PFDHP +  G  ++  EI+  ++        I A+   V              R  + 
Sbjct: 201 IPPFDHPYVIAGQGTVAMEILRQVRTA----NKIGAVFVPVGGGGLIAGIGAYLKR--VA 254

Query: 205 HKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVV 264
             I IIGVE+      ++SL+  + T    + + A       I ++T   A +   + V+
Sbjct: 255 PHIKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 265 LTDQEIISTCLRFADETNIIPEPA 288
           +   EI +      ++T  I EP+
Sbjct: 315 VNTDEICAAVKDIFEDTRSIVEPS 338

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 107/274 (39%), Gaps = 27/274 (9%)

Query: 19  SNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXX 78
           S+RL    Q  LK E L P  SFK RG   MI K     R++G     V           
Sbjct: 82  SSRLNTNVQ--LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQG 134

Query: 79  XXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD----KFLKESIISG 134
                + L+IP ++V+P ST +   Q +  LG++V +YG ++ EA     K  +E  ++ 
Sbjct: 135 VAFAAKHLNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN 194

Query: 135 HNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXX 194
                       PFDHP +  G  ++  EI+  +          K     V         
Sbjct: 195 ----------IPPFDHPYVIAGQGTVAMEILRQVHNAN------KIGAVFVPVGGGGLVA 238

Query: 195 XXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLEN 254
                  ++   I IIGVE+       +SLK G+ T    +   A       I ++T   
Sbjct: 239 GVGAYLKRIAPHIKIIGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRV 298

Query: 255 ALRYHTKSVVLTDQEIISTCLRFADETNIIPEPA 288
           A     + V++   EI +      ++T  I EP+
Sbjct: 299 AQEVVDEVVLVNTDEICAAVKDVFEDTRSIVEPS 332

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 107/264 (40%), Gaps = 17/264 (6%)

Query: 30  LKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSIP 89
           LK + L P  SFK RG   M+ K     +++G     V                + L IP
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMAKLDDTQKNQG-----VIACSAGNHAQGVAYAAKHLKIP 143

Query: 90  CSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFD 149
            ++V+P ST +   Q +  LG++V +YG ++ EA     E          T +    PFD
Sbjct: 144 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK---AECARLAEERGLTNI---PPFD 197

Query: 150 HPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLVHKIPI 209
           HP +  G  ++  EI   L++  +  K I A+   V              R  +   I I
Sbjct: 198 HPYVIAGQGTVAMEI---LRQVHMSSK-IGAVFVPVGGGGLIAGVGTYLKR--IAPHIKI 251

Query: 210 IGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVLTDQE 269
           IGVE+       +SL+ GK    E + S A       + ++T   A     + V++   E
Sbjct: 252 IGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEVVLVNTDE 311

Query: 270 IISTCLRFADETNIIPEPACGAAL 293
           I +      ++T  I EP+   A+
Sbjct: 312 ICAGIKDIFEDTRSIVEPSGALAV 335

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 106/264 (40%), Gaps = 25/264 (9%)

Query: 29  MLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSI 88
           +LK E L P  SFK RG   MI K     R++G     V                + L I
Sbjct: 96  ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQGVAFAAKHLKI 150

Query: 89  PCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD----KFLKESIISGHNPSRTQVIY 144
           P ++V+P  T +   Q +  LG++V +YG ++ EA     K  +E  ++           
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN---------- 200

Query: 145 AHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLV 204
             PFDHP +  G  ++  EI+  ++        I A+   V              R  + 
Sbjct: 201 IPPFDHPYVIAGQGTVAMEILRQVRTA----NKIGAVFVPVGGGGLIAGIGAYLKR--VA 254

Query: 205 HKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVV 264
             I +IGVE+      ++SL+  + T    + + A       I ++T   A +   + V+
Sbjct: 255 PHIKVIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 265 LTDQEIISTCLRFADETNIIPEPA 288
           +   EI +      ++T  I EP+
Sbjct: 315 VNTDEICAAVKDIFEDTRSIVEPS 338

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 106/264 (40%), Gaps = 25/264 (9%)

Query: 29  MLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSI 88
           +LK E L P  SFK RG   MI K     R++G     V                + L I
Sbjct: 96  ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQGVAFAAKHLKI 150

Query: 89  PCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD----KFLKESIISGHNPSRTQVIY 144
           P ++V+P  T +   Q +  LG++V +YG ++ EA     K  +E  ++           
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN---------- 200

Query: 145 AHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLV 204
             PFDHP +  G  ++  EI+  ++        I A+   V              R  + 
Sbjct: 201 IPPFDHPYVIAGQGTVAMEILRQVRTA----NKIGAVFVPVGGGGLIAGIGAYLKR--VA 254

Query: 205 HKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVV 264
             I +IGVE+      ++SL+  + T    + S A       I ++T   A +   + V+
Sbjct: 255 PHIKVIGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 265 LTDQEIISTCLRFADETNIIPEPA 288
           +   EI +      ++T  I EP+
Sbjct: 315 VNTDEICAAVKDVFEDTRSIVEPS 338

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 107/264 (40%), Gaps = 25/264 (9%)

Query: 29  MLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSI 88
           +LK E L P  SFK RG   MI K     R++G     V                + L I
Sbjct: 96  ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQGVAFAAKHLKI 150

Query: 89  PCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD----KFLKESIISGHNPSRTQVIY 144
           P ++V+P  T +   Q +  LG++V ++G ++ EA     K  +E  ++           
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEAKAECTKLAEERGLTN---------- 200

Query: 145 AHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLV 204
             PFDHP +  G  ++  EI+  ++     +  I A+   V              R  + 
Sbjct: 201 IPPFDHPYVIAGQGTVAMEILRQVRT----VNKIGAVFVPVGGGGLIAGIGAYLKR--IA 254

Query: 205 HKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVV 264
             I +IGVE+      ++SL+  + T    + + A       I ++T   A +   + V+
Sbjct: 255 PHIKVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 265 LTDQEIISTCLRFADETNIIPEPA 288
           +   EI +      ++T  I EP+
Sbjct: 315 VNTDEICAAVKDVFEDTRSIVEPS 338

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 104/266 (39%), Gaps = 25/266 (9%)

Query: 27  QFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRAL 86
           Q  LK E L P  SFK RG   M+ K     R +G     V                + L
Sbjct: 88  QIQLKREDLLPVFSFKMRGAYNMVAKLDETQRKQG-----VIACSAGNHAQGVAYAAKHL 142

Query: 87  SIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWK----EADKFLKESIISGHNPSRTQV 142
            IP ++V+P ST +   + +  LG++V +YG ++     E ++  +E            +
Sbjct: 143 GIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSSKGECERLCEER----------GL 192

Query: 143 IYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHK 202
           +   PFDHP +  G  ++  EI+  +K       + K     V                +
Sbjct: 193 VNIPPFDHPYVIAGQGTVAMEILRQVK------NSAKIGAVFVPVGGGGLVAGIGAYLKR 246

Query: 203 LVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKS 262
           +   I I+GVE+       +SL  GK TE   + + A       I ++T   +     + 
Sbjct: 247 IAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGTAVKMIGEETFRVSKDVVDEI 306

Query: 263 VVLTDQEIISTCLRFADETNIIPEPA 288
           V++   E+ +      ++T  I EP+
Sbjct: 307 VLVNTDELCAAVKDIFEDTRSIVEPS 332

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 113/279 (40%), Gaps = 27/279 (9%)

Query: 19  SNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXX 78
           S+RL    Q  LK E L P  SFK RG   M+ K     +++G     V           
Sbjct: 89  SSRLNTNVQ--LKREDLLPVFSFKLRGAYNMMAKLDDTQKNQG-----VIACSAGNHAQG 141

Query: 79  XXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEAD----KFLKESIISG 134
                + L IP ++V+P ST +   Q +  LG++V +YG ++ EA     K  KE  ++ 
Sbjct: 142 VAFAAKHLDIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLSKERGLTN 201

Query: 135 HNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXX 194
                       PFDHP +  G  ++  EI+     +++ + N K     V         
Sbjct: 202 ----------IPPFDHPYVIAGQGTVAMEIL-----RQVHIAN-KIGAVFVPVGGGGLVA 245

Query: 195 XXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLEN 254
                  ++   I IIGVE+       +SL+ G+ T    + + A       I ++T   
Sbjct: 246 GVGAYLKRIAPHIKIIGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRI 305

Query: 255 ALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAAL 293
           +     + V++   EI +      ++T  I EP+   A+
Sbjct: 306 SQDVVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALAV 344

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 111/283 (39%), Gaps = 35/283 (12%)

Query: 19  SNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMIT-------KQAIKIRSEGNKLPHVFXXX 71
           S+RL    Q  LK E L P  SFK RG   MI+       K  +   S GN    V    
Sbjct: 82  SSRLNTDVQ--LKREDLLPVFSFKLRGAYNMISHLDDVQKKCGVIACSAGNHAQGV---- 135

Query: 72  XXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESI 131
                       + L IP ++V+P ST +   Q +  LGAEV +YG N+  A        
Sbjct: 136 --------AYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYGDNFDAAK------- 180

Query: 132 ISGHNPSRTQVIYA-HPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXX 190
           +     S  + +Y   PFDHP +  G  +I  EI+  ++        I A+ C+V     
Sbjct: 181 VECSRLSEEKGLYDIPPFDHPYVIAGQGTIAMEILKQIQNS----SKIGAVFCAVGGGGL 236

Query: 191 XXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKK 250
                    R      I +IGVE+      ++S++    T    +   A       I ++
Sbjct: 237 IAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVRLIGEE 294

Query: 251 TLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAAL 293
           +   A     + +++   EI +      ++T  + EP+   A+
Sbjct: 295 SFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPSGALAV 337

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 108/289 (37%), Gaps = 25/289 (8%)

Query: 19  SNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXX 78
           S+RL    Q  LK E L P  SFK RG   M+ K A     +GNK   V           
Sbjct: 74  SSRLNTNVQ--LKREDLLPVFSFKLRGAYNMMAKLA---EGQGNK--GVIACSAGNHAQG 126

Query: 79  XXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPS 138
                R L+IP  +V+P +T +   Q +  LG +V +YG ++ EA       I       
Sbjct: 127 VAFASRHLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEA------KIECARISE 180

Query: 139 RTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXX 198
              +    PFDHP +  G  ++  EI+  +          K     V             
Sbjct: 181 ERGLTNIPPFDHPYVIAGQGTVAMEILRQVHNAS------KIGAVFVPVGGGGLVAGVAA 234

Query: 199 SRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRY 258
              ++   I I+GVE+       +SL  G  T    + + A       I ++T      +
Sbjct: 235 YLKRIAPHIKIVGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDF 294

Query: 259 HTKSVVLTDQEIISTCLRFADETNIIPEPACGAALH------LGYYPDI 301
             + V++   EI +      ++T  I EP+   A+          YPD+
Sbjct: 295 VDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALAVAGLKKYVTQIYPDV 343

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 102/259 (39%), Gaps = 17/259 (6%)

Query: 30  LKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSIP 89
           LK E L P  SFK RG   M+ K     +++G     V                + L+IP
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMAKLDDSQKNQG-----VIACSAGNHAQGIAYAAKHLNIP 141

Query: 90  CSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFD 149
            ++V+P ST +   Q +  LG++V +YG ++ EA     E          T +    PFD
Sbjct: 142 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK---AECARLAEERGLTNI---PPFD 195

Query: 150 HPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLVHKIPI 209
           HP +  G  ++  EI+  + +       I A+   V              R  +   I I
Sbjct: 196 HPYVIAGQGTVAMEILRQVHKA----NKIGAVFVPVGGGGLIAGVGAYLKR--IAPHIKI 249

Query: 210 IGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVLTDQE 269
           IGVE+       +SL+ GK      + + A       I ++T         + V++   E
Sbjct: 250 IGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEVVLVNTDE 309

Query: 270 IISTCLRFADETNIIPEPA 288
           I +      ++T  I EP+
Sbjct: 310 ICAAVKDVFEDTRSIVEPS 328

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 102/275 (37%), Gaps = 19/275 (6%)

Query: 19  SNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXX 78
           S+RL    Q  LK E L P  SFK RG   M+ K      SE  K   V           
Sbjct: 85  SSRLNTNVQ--LKREDLLPVFSFKLRGAYNMMAKL-----SEAQKNQGVIACSAGNHAQG 137

Query: 79  XXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPS 138
                R L+IP  +V+P +T +   Q +  LG +V +YG ++ EA     E         
Sbjct: 138 VAFASRHLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAK---TECTRISEERG 194

Query: 139 RTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXX 198
            T +    PFDHP +  G  ++  EI+  +          K     V             
Sbjct: 195 LTNI---PPFDHPYVIAGQGTVAMEILRQVHNAA------KIGAVFVPVGGGGLVAGVAA 245

Query: 199 SRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRY 258
              ++   I IIGVE+       +SL+ G  T    + + A       I ++T       
Sbjct: 246 YLKRIAPHIKIIGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETFRICQDL 305

Query: 259 HTKSVVLTDQEIISTCLRFADETNIIPEPACGAAL 293
               +++   EI +      ++T  I EP+   A+
Sbjct: 306 VDDVILVNTDEICAAVKDIFEDTRSIVEPSGALAV 340

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/261 (21%), Positives = 96/261 (36%), Gaps = 20/261 (7%)

Query: 27  QFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRAL 86
           +   KCE  Q  G+FK RG    + K   + R+ G     V                + L
Sbjct: 38  EVYFKCENFQRIGAFKFRGAMNTLLKLTQEQRAAG-----VVAFSSGNHAQAIALSAKLL 92

Query: 87  SIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAH 146
            +P ++V+P       V+     GA +  Y R  ++ ++      I         +    
Sbjct: 93  GVPATIVMPNDAPAAKVRATAGYGANIVRYDRYTEDREQ------IGRALAEEKGLTLVP 146

Query: 147 PFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLVHK 206
           P+DHP +  G  +   E+I+ + E  +DL         V             +  +L  +
Sbjct: 147 PYDHPDVIAGQGTAAKELIEEVGE--LDL-------LFVPLGGGGLLSGSALAAKRLSPR 197

Query: 207 IPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVLT 266
             IIGVE +       SL+ G +   +   +IA    T  + + T E         +  +
Sbjct: 198 CEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQHLGQYTFEVIHANVADILTAS 257

Query: 267 DQEIISTCLRFADETNIIPEP 287
           D E++ +   FA+   I+ EP
Sbjct: 258 DAELVDSMRFFAERMKIVVEP 278

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 113/286 (39%), Gaps = 29/286 (10%)

Query: 7   KTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPH 66
           KTP+L       ++RL  Q  F  K E  Q  G+FK RG    ++K + + RS+G     
Sbjct: 22  KTPVLTSRML--NDRLGAQIYF--KGENFQRVGAFKFRGAMNAVSKLSDEKRSKG----- 72

Query: 67  VFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKF 126
           V                + L++P ++V+PE      V      GA +  Y R + E  + 
Sbjct: 73  VIAFSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAHIIRYNR-YTEDREQ 131

Query: 127 LKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVX 186
           +   + + H           P+DHP +  G  +   E+++ + +       + A+   V 
Sbjct: 132 IGRQLAAEHG-----FALIPPYDHPDVIAGQGTSAKELLEEVGQ-------LDALF--VP 177

Query: 187 XXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNS 246
                       +   L     I GVE +       S + G +       +IA    T  
Sbjct: 178 LGGGGLLSGSALAARSLSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGAQTQH 237

Query: 247 ISKKTLENALRYHTKSVV-LTDQEIISTCLRF-ADETNIIPEP-AC 289
           + + T    +R +   ++ ++DQE++  C+ F A+   ++ EP AC
Sbjct: 238 LGEYTFA-IIRENVDDILTVSDQELVK-CMHFLAERMKVVVEPTAC 281

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/285 (20%), Positives = 108/285 (37%), Gaps = 27/285 (9%)

Query: 7   KTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPH 66
           KTP+L       ++RL  + +   K E  Q  G+FK RG    ++K + K R +G     
Sbjct: 22  KTPVLTSR--TLNDRL--EAEVYFKGENYQRVGAFKFRGAMNAVSKLSDKERKKG----- 72

Query: 67  VFXXXXXXXXXXXXXXXRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKF 126
           V                +  ++P ++++PE      V      GA +  Y R + E  + 
Sbjct: 73  VIAFSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAHIIKYNR-YTEDREH 131

Query: 127 LKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKAIVCSVX 186
           +   + + H       +   P+DHP +  G  +   E+ + + E       + A+   V 
Sbjct: 132 IGRQLAAKHG-----YVLIPPYDHPDVIAGQGTSAKELFEEVGE-------LDALF--VP 177

Query: 187 XXXXXXXXXXXXSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNS 246
                       +   L     + GVE +       S K G +   +  ++IA    T  
Sbjct: 178 LGGGGLLSGSALAARSLSPGCKVFGVEPEAGNDGQQSFKSGSIVHIDTPSTIADGAQTQH 237

Query: 247 ISKKTLENALRYHTKSVVLTDQEIISTCLRF-ADETNIIPEP-AC 289
           + + T    +R +   ++    E +  C+ F A+   ++ EP AC
Sbjct: 238 LGEYTYA-VIRENVDDILTVSDEELVECMHFLAERMKLVVEPTAC 281

>Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON}
           YKL218C (REAL)
          Length = 269

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 41/87 (47%), Gaps = 6/87 (6%)

Query: 84  RALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVI 143
           + L++P ++V+PE  S   V      GA +  Y R  ++ DK  ++        ++    
Sbjct: 33  KLLNVPATIVMPEDASTLKVAATTGYGAHITKYNRYTEDRDKIGRQL------AAKHGFA 86

Query: 144 YAHPFDHPLIWEGHSSIVDEIIDSLKE 170
              P+DHP +  G S+   ++++ + +
Sbjct: 87  LIPPYDHPDVIAGQSASAKKLLEEVGQ 113

>AEL161W Chr5 (329283..330353) [1071 bp, 356 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR012W
          Length = 356

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 48/255 (18%), Positives = 92/255 (36%), Gaps = 10/255 (3%)

Query: 31  KCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSIPC 90
           K EF+ P GS K R   Y++ +       + ++   +                R+     
Sbjct: 45  KAEFMNPGGSVKDRAALYLVEEAERAGLIDPSRPGTIVEGSAGNTAIGLAHIARSRGYNA 104

Query: 91  SVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFDH 150
              +P++ S   V  +  LG EVH         D     +    H  +    ++ + FD+
Sbjct: 105 VFYMPDTQSREKVNLLRYLGTEVHPV-PVCPSTDPLNFNNRARDHAAALDNAVWTNQFDN 163

Query: 151 PLIWEGHSSIVD-EIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLVHKIPI 209
              W+ H +    EI+  ++   ++   + A  CS              +      K  +
Sbjct: 164 EANWKAHYATTGPEILQQMRNAGLE---VDAFTCSTGTGGTFSGIARYLA-EATERKCKL 219

Query: 210 IGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVLTDQE 269
           +  +  G  V+ S +K G L    + +S    +G   I+ K LE ++     +V + D E
Sbjct: 220 VVTDPPGSVVY-SFVKTGNLE--REGSSFTEGVGQGRIT-KNLEASVDIIDDAVFVPDPE 275

Query: 270 IISTCLRFADETNII 284
            ++   R  DE  + 
Sbjct: 276 SLNMTYRLLDEEGLF 290

>TDEL0D01810 Chr4 complement(358357..359415) [1059 bp, 352 aa] {ON} 
          Length = 352

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 54/255 (21%), Positives = 88/255 (34%), Gaps = 11/255 (4%)

Query: 31  KCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKL-PHVFXXXXXXXXXXXXXXXRALSIP 89
           K EF  P GS K R   Y+I +     + +G K  P +                RA    
Sbjct: 40  KAEFQNPGGSVKDRAALYLIQEAERLGQVDGKKADPTIVEGSAGNTAIGLAHIARARGYR 99

Query: 90  CSVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFD 149
               +P + S   +  +  LGAEV+        +D     +    H       ++   FD
Sbjct: 100 SIFYMPNTQSAAKINLLKFLGAEVYPVPV-CPISDPLNFNNRARDHAARLPNAVWTDQFD 158

Query: 150 HPLIWEGHSSIVD-EIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLVHKIP 208
           +P  W+ H      EI + L        +  A  CS                     K  
Sbjct: 159 NPANWKSHYYTTGPEIYNQLINNGF---SCDAFTCSTGTGGTFTGVARYL-EETTNGKCK 214

Query: 209 IIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVLTDQ 268
           ++  +  G  ++ S +K G +    + +S    IG   I+ K LE ++     +V + D+
Sbjct: 215 LVAADPPGSVIY-SYVKKGTMD--REGSSFTEGIGQGRIT-KNLEASMDIIDDAVFIPDE 270

Query: 269 EIISTCLRFADETNI 283
           E I    R  DE  +
Sbjct: 271 ESIVMLYRLLDEEGL 285

>Kwal_0.5 s0 (2543..3709) [1167 bp, 388 aa] {ON} YGR012W -
           Hypothetical ORF [contig 75] FULL
          Length = 388

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 50/255 (19%), Positives = 90/255 (35%), Gaps = 10/255 (3%)

Query: 31  KCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSIPC 90
           K EF  P GS K R   Y+I +     + + ++   +                R+     
Sbjct: 77  KAEFQNPGGSVKDRAALYLIEQAEKSGQIDPSRPATIVEGSAGNTAIGLAHIARSKGYKS 136

Query: 91  SVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFDH 150
              +P + S   +  +  LGAEV+         D     +    H       I+   FD+
Sbjct: 137 VFYMPNTQSVAKINLLKYLGAEVYPV-PVCPITDPLNFNNRARDHAKRLDNAIWTDQFDN 195

Query: 151 PLIWEGHSSIVD-EIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLVHKIPI 209
           P  W+ H +    EI   L+   +   +  A  CS               + +   +  +
Sbjct: 196 PANWKSHYATTGPEIFQQLQSAGL---SCDAFTCSTGTGGTFTGVAKYL-KEQTNGEAKL 251

Query: 210 IGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVLTDQE 269
           +  +  G  +F S +K GK+    + +S    IG   I+ + L  +L     ++ + D+E
Sbjct: 252 VVADPPGSAIF-SYVKTGKMD--REGSSFTEGIGQGRIT-ENLRASLDLVDDAIFIPDEE 307

Query: 270 IISTCLRFADETNII 284
            I    R  DE  + 
Sbjct: 308 SIVMLFRLLDEEGLF 322

>KLTH0H10846g Chr8 (931560..932609) [1050 bp, 349 aa] {ON} similar
           to uniprot|P53206 Saccharomyces cerevisiae YGR012W
           Hypothetical ORF
          Length = 349

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 53/260 (20%), Positives = 89/260 (34%), Gaps = 20/260 (7%)

Query: 31  KCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSIPC 90
           K EF  P GS K R   Y+I +     + + ++   +                R+     
Sbjct: 38  KAEFQNPGGSVKDRAALYLIEQAEKSGQIDPSRPATIVEGSAGNTAIGLAHIARSKGYKS 97

Query: 91  SVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFDH 150
              +P + S   +  +  LGAEV+        +D     +    H       I+   FD+
Sbjct: 98  IFYMPNTQSVSKINLLKYLGAEVYPVPV-CPISDPMNFNNRARDHAKRLDNAIWTDQFDN 156

Query: 151 PLIWEGHSSIVD-EIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXX-----XXXSRHKLV 204
           P  W+ H +    EI+  L+   +   +  A  CS                    + KLV
Sbjct: 157 PANWKSHYATTGPEILQQLQSAGL---SCDAFTCSTGTGGTFTGVAKYLKEATNGQSKLV 213

Query: 205 HKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVV 264
                  V      V  S +K G++    + +S    IG   I+ K L  ++     +V 
Sbjct: 214 -------VADPPGSVIYSYIKTGEMN--REGSSFTEGIGQGRIT-KNLRESIDITDDAVF 263

Query: 265 LTDQEIISTCLRFADETNII 284
           + D+E I    R  DE  + 
Sbjct: 264 VPDEESIVMLFRLLDEEGLF 283

>Ecym_6283 Chr6 complement(534562..535632) [1071 bp, 356 aa] {ON}
           similar to Ashbya gossypii AEL161W
          Length = 356

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 62/312 (19%), Positives = 104/312 (33%), Gaps = 20/312 (6%)

Query: 31  KCEFLQPSGSFKSRGIGYMITKQAIKIRSEGNKLPHVFXXXXXXXXXXXXXXXRALSIPC 90
           K EF  P GS K R   Y+I +       + ++   +                +A     
Sbjct: 45  KAEFQNPGGSVKDRAALYLINEAESTGAIDPSRPATIVEGSAGNTAIGLAHIAKARGYKA 104

Query: 91  SVVVPESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFDH 150
              +P++ +   +  +  LG EV+         D     +    H  S    I+   FD+
Sbjct: 105 VFYMPDTQAQAKINLLRYLGTEVYPV-PPCPITDPLNFNNRARDHAKSLDNAIWTDQFDN 163

Query: 151 PLIWEGHSSIVD-EIIDSLKEQKIDLKNIKAIVCSVXXXXXXXXXXXXXSRHKLVHKIPI 209
              W+ H      EI+  ++   + L    +  CS                 K    +  
Sbjct: 164 EANWKSHYYTTGPEILQQIESAGLKL---DSFTCSTGTGGTFTGIAKYL--KKATGGVCK 218

Query: 210 IGVESKGCEVFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVLTDQE 269
           + V      V  S +K G+L    + +S    IG   I+   L+  L +   +V + D+E
Sbjct: 219 LVVADPPGSVIYSYVKTGELV--REGSSFTEGIGQGRIT-NNLQAGLDFVDDAVFVPDEE 275

Query: 270 IISTCLRFADETNIIPEPACGAALHLGYYPDILYQALNSDFTPEDVIIMIGCGGSATSYN 329
            I    R  +E  +      G  +       +    +  D  P   ++ I C  S   Y 
Sbjct: 276 SIVMVYRLIEEEGLFLGGTSGLNV-------VAAAKVAKDLPPNSNVVTILC-DSGHKYA 327

Query: 330 DLASLFSKKILQ 341
           D   LFSK  LQ
Sbjct: 328 D--RLFSKSWLQ 337

>TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {ON}
            Anc_6.311 YMR207C
          Length = 2317

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 9/61 (14%)

Query: 224  LKLGKLTEFEDITSIATSIGTNSISK---KTLENALRYHTKSVVLTDQEI-----ISTCL 275
            L++GK+ +F +I+ I+T   T  I K   KTLE+ +RY  + ++  D+ I     I T L
Sbjct: 1377 LEIGKMAKF-NISQISTGNATLHIFKGISKTLESDIRYFARGIIRKDRSINDFGSIRTYL 1435

Query: 276  R 276
            R
Sbjct: 1436 R 1436

>SAKL0G14366g Chr7 (1238951..1241119) [2169 bp, 722 aa] {ON} similar
           to uniprot|P46951 Saccharomyces cerevisiae YGR198W
           Essential protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 722

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 95  PESTSNRMVQKIWNLGAEVHVYGRNWKEADKFLKESI 131
           P  T   ++Q IW    ++++   N+KEA   LKES+
Sbjct: 535 PNQTKEYLLQAIWLFACKLYLRNGNFKEAQDALKESL 571

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,871,768
Number of extensions: 1278481
Number of successful extensions: 3621
Number of sequences better than 10.0: 76
Number of HSP's gapped: 3646
Number of HSP's successfully gapped: 76
Length of query: 341
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 231
Effective length of database: 40,868,139
Effective search space: 9440540109
Effective search space used: 9440540109
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)