Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F00396g1.2ON1081085557e-75
Kwal_YGOB_matalpha21.121ON110681484e-13
Kwal_33.12995singletonOFF110681484e-13
Kwal_YGOB_HMalpha21.2ON110681484e-13
Kwal_33.matalpha2singletonOFF110681484e-13
Suva_3.135singletonON119571234e-09
Suva_3.74singletonON119571234e-09
Suva_3.751.121ON119571234e-09
YCR096C (HMRA2)singletonOFF119571234e-09
Skud_102.1singletonON185571212e-08
Smik_95.1singletonON185571212e-08
Suva_3.1471.2ON210571212e-08
YCR039C (MATALPHA2)1.121ON210571212e-08
YCL067C (HMLALPHA2)1.2ON210571212e-08
Smik_3.1421.121ON228591212e-08
Skud_3.1181.121ON210571213e-08
NCAS0B091401.2ON205761203e-08
NDAI0A001101.2ON211601194e-08
Kpol_2002.31.2ON223511186e-08
TDEL0C070001.2ON237591179e-08
KAFR0D007201.121ON206591161e-07
KLLA0C00374g1.2ON223701161e-07
Ecym_11151.121ON230571125e-07
Ecym_10021.2ON230571125e-07
TBLA0A076001.2ON230451125e-07
TBLA0A070501.121ON261451126e-07
ZYRO0F15818g1.121ON225491082e-06
ZYRO0F18568g1.2ON225491082e-06
KNAG0C001601.2ON203661063e-06
TPHA0E040701.2ON231491039e-06
TPHA0E036101.121ON231491039e-06
CAGL0B00264g1.2ON210601012e-05
CAGL0B01265g1.121ON186611002e-05
Kpol_1036.566.170ON26561870.001
NDAI0I013206.170ON40969870.002
Kwal_27.110926.170ON22977860.002
KAFR0A043706.170ON40967820.007
KNAG0M005006.170ON29890810.008
ZYRO0G22044g6.170ON20196790.014
NCAS0D035706.170ON25754790.017
CAGL0H02959g6.170ON25945790.018
KNAG0F022106.170ON32471780.024
KNAG0C027705.567ON32159770.027
Smik_7.1816.170ON27458770.030
AFL049C6.170ON257107770.031
Suva_7.1726.170ON27058750.055
Smik_4.7285.567ON34635750.067
YDR451C (YHP1)5.567ON35335740.070
TBLA0D013905.567ON28635740.074
Skud_4.7275.567ON34837740.075
Skud_7.1816.170ON27443730.10
YGL096W (TOS8)6.170ON27658720.13
Suva_2.6265.567ON35737720.15
KLTH0H05236g6.170ON23443710.17
TPHA0B025806.170ON26478700.24
CAGL0C01551g6.170ON22143700.27
ZYRO0C17050g3.391ON39773690.43
KLLA0B10450g6.170ON38943690.43
Ecym_22476.170ON34943680.44
NCAS0H011306.170ON28043680.46
NDAI0F021706.170ON38343680.49
TDEL0F018106.170ON25662680.52
YPL177C (CUP9)6.170ON30690670.60
SAKL0A05610g6.170ON32043660.86
Suva_16.1326.170ON29257651.1
Skud_16.1036.170ON29557651.2
Smik_6.3746.170ON29457641.9
KAFR0G036506.170ON17743632.3
Kwal_55.212935.468ON61565632.3
SAKL0E06402g2.337ON49146623.5
ZYRO0A07194g2.337ON49785623.9
TBLA0B070702.337ON64569614.4
Kwal_23.34942.337ON46658614.6
NCAS0C013108.682ON25725614.8
KLTH0F09636g2.337ON48455615.4
TDEL0A043205.567ON33036605.5
TBLA0C037406.170ON29343605.5
AFL202C2.337ON48176605.9
KAFR0C056005.567ON38453606.2
Kwal_47.184505.567ON37045606.5
Ecym_33782.337ON49178598.3
Suva_4.1402.337ON55789599.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F00396g
         (108 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...   218   7e-75
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    62   4e-13
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    62   4e-13
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    62   4e-13
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    62   4e-13
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...    52   4e-09
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...    52   4e-09
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...    52   4e-09
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...    52   4e-09
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)        51   2e-08
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)          51   2e-08
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...    51   2e-08
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...    51   2e-08
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...    51   2e-08
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...    51   2e-08
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...    51   3e-08
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...    51   3e-08
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...    50   4e-08
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...    50   6e-08
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    50   9e-08
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...    49   1e-07
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    49   1e-07
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...    48   5e-07
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...    48   5e-07
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...    48   5e-07
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...    48   6e-07
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...    46   2e-06
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...    46   2e-06
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...    45   3e-06
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...    44   9e-06
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...    44   9e-06
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...    44   2e-05
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...    43   2e-05
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    38   0.001
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    38   0.002
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    38   0.002
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    36   0.007
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    36   0.008
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    35   0.014
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    35   0.017
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    35   0.018
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    35   0.024
KNAG0C02770 Chr3 complement(539538..540503) [966 bp, 321 aa] {ON...    34   0.027
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    34   0.030
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    34   0.031
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    33   0.055
Smik_4.728 Chr4 complement(1282412..1283452) [1041 bp, 346 aa] {...    33   0.067
YDR451C Chr4 complement(1361120..1362181) [1062 bp, 353 aa] {ON}...    33   0.070
TBLA0D01390 Chr4 (348236..349096) [861 bp, 286 aa] {ON} Anc_5.56...    33   0.074
Skud_4.727 Chr4 complement(1281176..1282222) [1047 bp, 348 aa] {...    33   0.075
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    33   0.10 
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    32   0.13 
Suva_2.626 Chr2 complement(1112880..1113953) [1074 bp, 357 aa] {...    32   0.15 
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    32   0.17 
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    32   0.24 
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    32   0.27 
ZYRO0C17050g Chr3 complement(1324189..1325382) [1194 bp, 397 aa]...    31   0.43 
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    31   0.43 
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    31   0.44 
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    31   0.46 
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    31   0.49 
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    31   0.52 
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    30   0.60 
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    30   0.86 
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    30   1.1  
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    30   1.2  
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    29   1.9  
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    29   2.3  
Kwal_55.21293 s55 complement(772006..773853) [1848 bp, 615 aa] {...    29   2.3  
SAKL0E06402g Chr5 (521232..522707) [1476 bp, 491 aa] {ON} simila...    28   3.5  
ZYRO0A07194g Chr1 complement(587457..588950) [1494 bp, 497 aa] {...    28   3.9  
TBLA0B07070 Chr2 complement(1677335..1679272) [1938 bp, 645 aa] ...    28   4.4  
Kwal_23.3494 s23 complement(318582..319982) [1401 bp, 466 aa] {O...    28   4.6  
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    28   4.8  
KLTH0F09636g Chr6 complement(834845..836299) [1455 bp, 484 aa] {...    28   5.4  
TDEL0A04320 Chr1 complement(765442..766434) [993 bp, 330 aa] {ON...    28   5.5  
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    28   5.5  
AFL202C Chr6 complement(56150..57595) [1446 bp, 481 aa] {ON} Syn...    28   5.9  
KAFR0C05600 Chr3 complement(1115478..1116632) [1155 bp, 384 aa] ...    28   6.2  
Kwal_47.18450 s47 (830833..831945) [1113 bp, 370 aa] {ON} YML027...    28   6.5  
Ecym_3378 Chr3 complement(718342..719817) [1476 bp, 491 aa] {ON}...    27   8.3  
Suva_4.140 Chr4 complement(258729..260402) [1674 bp, 557 aa] {ON...    27   9.8  

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score =  218 bits (555), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 108/108 (100%), Positives = 108/108 (100%)

Query: 1   MSHISVSSLLNLPVFQASHQEKATSPITSQSCLVASGKQRKFNATAKKRLERWFCSNIQY 60
           MSHISVSSLLNLPVFQASHQEKATSPITSQSCLVASGKQRKFNATAKKRLERWFCSNIQY
Sbjct: 1   MSHISVSSLLNLPVFQASHQEKATSPITSQSCLVASGKQRKFNATAKKRLERWFCSNIQY 60

Query: 61  PYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPILNS 108
           PYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPILNS
Sbjct: 61  PYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPILNS 108

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
          (matalpha2) - mating type alpha2 protein [contig MAT]
          FULL
          Length = 110

 Score = 61.6 bits (148), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 34 VASGKQR--KFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRR 91
           A G Q+  K+       LE WF  N  +PY  + QI  LS+ TNLS KQI+NWMSNRRR
Sbjct: 29 AARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRR 88

Query: 92 KSRKESID 99
          KS+K  ID
Sbjct: 89 KSKKNPID 96

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
          (HMRA2) - Regulatory protein MATa2p (no known
          function); sequence is the same as the last 119
          residues of MATalpha2p [contig 123] FULL
          Length = 110

 Score = 61.6 bits (148), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 34 VASGKQR--KFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRR 91
           A G Q+  K+       LE WF  N  +PY  + QI  LS+ TNLS KQI+NWMSNRRR
Sbjct: 29 AARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRR 88

Query: 92 KSRKESID 99
          KS+K  ID
Sbjct: 89 KSKKNPID 96

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
          ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 61.6 bits (148), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 34 VASGKQR--KFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRR 91
           A G Q+  K+       LE WF  N  +PY  + QI  LS+ TNLS KQI+NWMSNRRR
Sbjct: 29 AARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRR 88

Query: 92 KSRKESID 99
          KS+K  ID
Sbjct: 89 KSKKNPID 96

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
          (matalpha2) - mating type alpha2 protein [contig MAT]
          FULL
          Length = 110

 Score = 61.6 bits (148), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 34 VASGKQR--KFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRR 91
           A G Q+  K+       LE WF  N  +PY  + QI  LS+ TNLS KQI+NWMSNRRR
Sbjct: 29 AARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRR 88

Query: 92 KSRKESID 99
          KS+K  ID
Sbjct: 89 KSKKNPID 96

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score = 52.0 bits (123), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L
Sbjct: 53  LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score = 52.0 bits (123), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L
Sbjct: 53  LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score = 52.0 bits (123), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L
Sbjct: 53  LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score = 52.0 bits (123), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L
Sbjct: 53  LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L
Sbjct: 119 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 175

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L
Sbjct: 119 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 175

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L
Sbjct: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L
Sbjct: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L
Sbjct: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPILNS 108
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L+ 
Sbjct: 162 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSG 220

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score = 51.2 bits (121), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L
Sbjct: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score = 50.8 bits (120), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 35  ASGKQRKFNATAKKR---LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRR 91
            S + R+ +  AK++   LE W+  ++  PY NK  +  L + T+LS  QI+NW+SNRRR
Sbjct: 127 TSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRR 186

Query: 92  KSRKESIDSLLEPILN 107
           K +  SI   +  ILN
Sbjct: 187 KEKSLSIAPEIVDILN 202

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score = 50.4 bits (119), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 49  RLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPILNS 108
           RLE W+ ++IQ PY +   +  L + T LS  QI+NW+SNRRRK +  SI   +  I+N+
Sbjct: 148 RLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPDIVEIINT 207

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score = 50.1 bits (118), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%)

Query: 48  KRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESI 98
           K LERW+  N++ PY +   I  L K T+LS  QI+NW+SNRRRK +  +I
Sbjct: 157 KLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITI 207

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 49.7 bits (117), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%)

Query: 48  KRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           ++LE WF  NI  PY N+  + +L   T+LS  QI+NW+SNRRRK +   I   +  +L
Sbjct: 167 EKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLL 225

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score = 49.3 bits (116), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%)

Query: 36  SGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSR 94
           S +  +F+    K LERW+ ++I  PY N+     L   T LS  QI+NW+SNRRRK +
Sbjct: 132 SYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLISKTGLSRVQIKNWVSNRRRKEK 190

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 49.3 bits (116), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%)

Query: 38  KQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKES 97
           K ++F  +  + LE W+  N + PY  +  +  +SKNT L+  QI+NW++NRRRK +   
Sbjct: 154 KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITE 213

Query: 98  IDSLLEPILN 107
           + S +  ILN
Sbjct: 214 VSSDIRNILN 223

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score = 47.8 bits (112), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE W+ +NI+ PY N   I  L + T  S  Q++NW++N+RRK +  +I   L  +L
Sbjct: 172 LESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score = 47.8 bits (112), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106
           LE W+ +NI+ PY N   I  L + T  S  Q++NW++N+RRK +  +I   L  +L
Sbjct: 172 LESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score = 47.8 bits (112), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (68%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSR 94
           LE+WF  N  +PY +   + +L+  ++LS  Q++NW+SNRRRK R
Sbjct: 182 LEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score = 47.8 bits (112), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (68%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSR 94
           LE+WF  N  +PY +   + +L+  ++LS  Q++NW+SNRRRK R
Sbjct: 182 LEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESI 98
           LE WF  NI++PY     +  L   T LS  QI+NW+SNRRRK +  +I
Sbjct: 157 LESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTI 205

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESI 98
           LE WF  NI++PY     +  L   T LS  QI+NW+SNRRRK +  +I
Sbjct: 157 LESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTI 205

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 40/66 (60%)

Query: 41  KFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDS 100
           +F++ + + LE W+  + + PY +K  +  L   T LS  QI+NW+SNRRRK +   +  
Sbjct: 136 RFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSP 195

Query: 101 LLEPIL 106
           +++ +L
Sbjct: 196 VIQDLL 201

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score = 44.3 bits (103), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 32/49 (65%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESI 98
           LE W+  + + PY N+I I  L   T+LS  Q++NW+SNRRRK +  +I
Sbjct: 167 LEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITI 215

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score = 44.3 bits (103), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 32/49 (65%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESI 98
           LE W+  + + PY N+I I  L   T+LS  Q++NW+SNRRRK +  +I
Sbjct: 167 LEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITI 215

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%)

Query: 35  ASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSR 94
           AS +  +F     + LE W+ ++I  PY +      L++ TNLS  QI+NW++NRRRK +
Sbjct: 108 ASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK 167

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%)

Query: 34  VASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKS 93
            AS +  +F     + LE W+ ++I  PY +      L++ TNLS  QI+NW++NRRRK 
Sbjct: 107 AASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQ 166

Query: 94  R 94
           +
Sbjct: 167 K 167

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 32  CLVASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRR 91
            ++ +GK+      + + L +W  +++Q PYP   +   L K T L+  Q+ NW  N RR
Sbjct: 153 GIIGAGKRSNLPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQLSNWFINVRR 212

Query: 92  K 92
           +
Sbjct: 213 R 213

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 1/69 (1%)

Query: 35  ASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSN-RRRKS 93
            SG++     T  + L  W   ++  PYP   +   L K T L+  Q+ NW  N RRRK 
Sbjct: 305 GSGRRSSLPITTVQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSNWFINVRRRKV 364

Query: 94  RKESIDSLL 102
             E+ DS +
Sbjct: 365 FNENSDSYI 373

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 23  ATSPITSQSCLVA-----SGKQRKFNATAKKR--LERWFCSNIQYPYPNKIQILSLSKNT 75
           A +P  SQ+ L A     + K R+ N   +    L  W  +++ YPYP+  +   L   T
Sbjct: 99  ARAPTPSQASLAALHTLPTSKPRRTNLPKETVDILNNWLLAHLNYPYPSPQEKRELLIKT 158

Query: 76  NLSIKQIQNWMSNRRRK 92
            LS  Q+ NW  N RR+
Sbjct: 159 GLSKVQLSNWFINVRRR 175

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 36.2 bits (82), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 35  ASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSN-RRRKS 93
            +GK+        + L  W  +++  PYP  I+   L K T L+  Q+ NW  N RRRK 
Sbjct: 268 GTGKRSNLPKETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRRRKV 327

Query: 94  RKESIDS 100
             +  DS
Sbjct: 328 FTDYFDS 334

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 35.8 bits (81), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 36/90 (40%), Gaps = 11/90 (12%)

Query: 14  VFQASHQEKATSP------ITSQSCLVASGKQRK---FNATAKKRL--ERWFCSNIQYPY 62
           V Q +H      P         + C  +SG+ RK   +N      L   RW   ++  PY
Sbjct: 144 VDQGTHPRPGPVPSPQQQQQRGEKCGGSSGRDRKQSRYNLPKDTVLILNRWLLDHLHNPY 203

Query: 63  PNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           P   +   L   T LS  Q+ NW  N RR+
Sbjct: 204 PTSQEKRELLIKTGLSKIQLSNWFINVRRR 233

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 35.0 bits (79), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 41/96 (42%), Gaps = 16/96 (16%)

Query: 6   VSSLLNLPVFQASHQEKATSPITSQSCLVASGKQRKFNATAKKR---------LERWFCS 56
           V S L LP     H+     P +    +V+SGK  K + + ++          L RW   
Sbjct: 46  VESPLGLP---GEHE--MVEPFSE--GVVSSGKNHKGSRSGRRSNLPKETVQILNRWLLD 98

Query: 57  NIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           ++  PYP   +   L   T L+  Q+ NW  N RR+
Sbjct: 99  HLGNPYPTPQEKRDLLIKTGLTKIQLSNWFINVRRR 134

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 35.0 bits (79), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSN-RRRKSRKESIDSLL 102
           L  W   ++  PYPN  +   L + T L+  Q+ NW  N RRRK   E+ DS L
Sbjct: 195 LNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRKVFNENYDSYL 248

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 35.0 bits (79), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 48  KRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           K L  W   +I  PYP   + + LS  T L+  Q+ NW  N RR+
Sbjct: 174 KILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRR 218

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 34.7 bits (78), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 29  SQSCLVASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSN 88
           SQ    +S K+        + L  W  +++  PYP   + L L + T L+  Q+ NW  N
Sbjct: 233 SQRIKKSSSKRSNLPRETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFIN 292

Query: 89  RRRKSRKESID 99
            RR  RK  +D
Sbjct: 293 VRR--RKVFVD 301

>KNAG0C02770 Chr3 complement(539538..540503) [966 bp, 321 aa] {ON}
           Anc_5.567 YML027W
          Length = 321

 Score = 34.3 bits (77), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 38  KQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKE 96
           K+R+     K  L++ F  N     PNK + L L+K  N+S K IQ W  N+R+  RKE
Sbjct: 217 KRRRTTKEQKDILKKAFERNKA---PNKQEKLELAKKCNMSEKAIQVWFQNQRQYIRKE 272

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 34.3 bits (77), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 25/58 (43%)

Query: 35  ASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           A GK+          L +W   +I  PYP   +   L   T L+  QI NW  N RR+
Sbjct: 192 AHGKRTNLPKATVSILNKWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 249

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 34.3 bits (77), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 43/107 (40%), Gaps = 19/107 (17%)

Query: 3   HISVSSLLNLPVFQASHQEKATSPIT-----SQSCLVASGKQRKFNATAKKR-------- 49
           H S+S  L+ PV + +    AT P T      Q      G + K   T K+         
Sbjct: 84  HHSISHFLS-PV-EGAPAAPATEPFTVYGRDDQQEPAPDGTKGKLKETKKQHRRSNLPKE 141

Query: 50  ----LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
               L  W  ++   PYP+  +   L K T L+  Q+ NW  N RR+
Sbjct: 142 TVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRR 188

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 33.5 bits (75), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 24/58 (41%)

Query: 35  ASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
             GK+          L +W   +I  PYP   +   L   T L+  QI NW  N RR+
Sbjct: 194 GHGKRSNLPGATVHILNKWLLEHINNPYPTLQEKRELLAQTGLTKLQISNWFINARRR 251

>Smik_4.728 Chr4 complement(1282412..1283452) [1041 bp, 346 aa] {ON}
           YDR451C (REAL)
          Length = 346

 Score = 33.5 bits (75), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 61  PYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRK 95
           P PNK + + LS+  N+S K +Q W  N+R+ ++K
Sbjct: 187 PTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKK 221

>YDR451C Chr4 complement(1361120..1362181) [1062 bp, 353 aa] {ON}
           YHP1One of two homeobox transcriptional repressors (see
           also Yox1p), that bind to Mcm1p and to early cell cycle
           box (ECB) elements of cell cycle regulated genes,
           thereby restricting ECB-mediated transcription to the
           M/G1 interval
          Length = 353

 Score = 33.1 bits (74), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 61  PYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRK 95
           P PNK + + LS+  N+S K +Q W  N+R+ ++K
Sbjct: 196 PTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKK 230

>TBLA0D01390 Chr4 (348236..349096) [861 bp, 286 aa] {ON} Anc_5.567
           YML027W
          Length = 286

 Score = 33.1 bits (74), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%)

Query: 61  PYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRK 95
           P PNKI+ + LS+  N++ K +Q W  NRR+ ++K
Sbjct: 212 PNPNKIKRIQLSQQCNMTEKTVQIWFQNRRQANKK 246

>Skud_4.727 Chr4 complement(1281176..1282222) [1047 bp, 348 aa] {ON}
           YDR451C (REAL)
          Length = 348

 Score = 33.1 bits (74), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%)

Query: 59  QYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRK 95
           + P PNK + + LS+  N+S K +Q W  N+R+ ++K
Sbjct: 191 ECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKK 227

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 32.7 bits (73), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (48%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           L +W   +I  PYP   +   L   T L+  QI NW  N RR+
Sbjct: 207 LNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINARRR 249

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 32.3 bits (72), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 25/58 (43%)

Query: 35  ASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           A GK+          L +W   ++  PYP   +   L   T L+  QI NW  N RR+
Sbjct: 194 AHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 251

>Suva_2.626 Chr2 complement(1112880..1113953) [1074 bp, 357 aa] {ON}
           YDR451C (REAL)
          Length = 357

 Score = 32.3 bits (72), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 59  QYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRK 95
           + P PNK +   LS+  N+S K +Q W  N+R+ ++K
Sbjct: 196 ECPTPNKTKRTELSEQCNMSEKSVQIWFQNKRQAAKK 232

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 32.0 bits (71), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           L  W  S++  PYP+  +   L   T LS  Q+ NW  N RR+
Sbjct: 117 LNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRR 159

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 31.6 bits (70), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 16  QASHQEKATSPITSQSCLVAS-GKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKN 74
           Q   + K+ S I +Q+    S GK+      +   L +W  +++  PYP   +   L + 
Sbjct: 133 QKKVRSKSFSTINTQTTSKTSIGKRSNLPKQSVDVLNKWLLNHLGNPYPTPKEKEELLEL 192

Query: 75  TNLSIKQIQNWMSNRRRK 92
           T LS  Q+ NW  N RR+
Sbjct: 193 TGLSKIQLSNWFINVRRR 210

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 31.6 bits (70), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           L +W   +I  PYP + +   L   T L+  Q+ NW  N RR+
Sbjct: 90  LNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINVRRR 132

>ZYRO0C17050g Chr3 complement(1324189..1325382) [1194 bp, 397 aa]
           {ON} similar to gnl|GLV|KLLA0D09086g Kluyveromyces
           lactis KLLA0D09086g and weakly similar to YPR085C
           uniprot|Q06822 Saccharomyces cerevisiae YPR085C Protein
           required for cell viability
          Length = 397

 Score = 31.2 bits (69), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 30/73 (41%), Gaps = 6/73 (8%)

Query: 32  CLVASGKQRKFNATAKKRLERWFCSNIQYP------YPNKIQILSLSKNTNLSIKQIQNW 85
           C + SG    FN     ++E  + S++ YP      YP K  ILS S +  + I  +   
Sbjct: 188 CGMESGFVIGFNLIDDGQVEIVYVSHVHYPNPILDLYPGKDNILSSSTDNKIGIHDLNCQ 247

Query: 86  MSNRRRKSRKESI 98
              R    R+  I
Sbjct: 248 QDERPNFERQSPI 260

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 31.2 bits (69), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 20/43 (46%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           L  W   N+  PYP       L + T L+  Q+ NW  N RR+
Sbjct: 264 LNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRR 306

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 30.8 bits (68), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           L  W   +   PYP+  +   L K T L+  Q+ NW  N RR+
Sbjct: 238 LNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRR 280

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 30.8 bits (68), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           L  W  +++Q PYP   +   L   T L+  Q+ NW  N RR+
Sbjct: 141 LNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINVRRR 183

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 30.8 bits (68), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           L  W  +++Q PYP   +   L   T L+  Q+ NW  N RR+
Sbjct: 278 LNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQLSNWFINVRRR 320

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 30.8 bits (68), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 29/62 (46%)

Query: 31  SCLVASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRR 90
           S  +++G++        + L  W   +++ PYP   +   L   T L+  Q+ NW  N R
Sbjct: 125 SGGISNGRRSNLPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINVR 184

Query: 91  RK 92
           R+
Sbjct: 185 RR 186

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 30.4 bits (67), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 10/90 (11%)

Query: 13  PVFQASHQEKATSPITSQ--SCLVASGKQRKFNATAKKRLER--------WFCSNIQYPY 62
           P+++  ++EK      ++  S  V S  +RK N+  +  L +        W  +++  PY
Sbjct: 130 PIYEIINKEKDAGAQYNRPFSDFVESKSRRKQNSGRRSNLPKETVQILNTWLLNHLNNPY 189

Query: 63  PNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           P + +   L   T L+  Q+ NW  N RR+
Sbjct: 190 PTQQEKRELLIKTGLTKIQLSNWFINVRRR 219

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 30.0 bits (66), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           L  W  +++  PYP+  +   L   T L+  Q+ NW  N RR+
Sbjct: 221 LNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVRRR 263

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%)

Query: 36  SGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           SG++        + L  W  +++  PYP + +   L   T L+  Q+ NW  N RR+
Sbjct: 149 SGRRSNLPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 205

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 29.6 bits (65), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%)

Query: 36  SGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           SG++        + L  W  +++  PYP + +   L   T L+  Q+ NW  N RR+
Sbjct: 152 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 208

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%)

Query: 36  SGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           SG++        + L  W  +++  PYP + +   L   T L+  Q+ NW  N RR+
Sbjct: 151 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 207

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 28.9 bits (63), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 21/43 (48%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           L  W  +++  PYP   +   L   T L+  Q+ NW  N RR+
Sbjct: 84  LNAWLLNHLHNPYPTSQEKRDLLIKTGLTKIQLSNWFINVRRR 126

>Kwal_55.21293 s55 complement(772006..773853) [1848 bp, 615 aa] {ON}
           YDR386W (MUS81) - involved in DNA repair, interacts with
           Rad54 [contig 130] FULL
          Length = 615

 Score = 28.9 bits (63), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 16  QASHQEKATSPITSQSCLVASGKQRKFNATAKK----RLERWFCSNIQYPYPNKIQILSL 71
           + +H  K T  IT Q      G QRK+N TAK+     LE  F  ++   Y   ++ ++ 
Sbjct: 204 EMAHILKRTDQITFQD---EDGYQRKYNTTAKESTNCGLESEFDDSVN--YSELMETVAY 258

Query: 72  SKNTN 76
           SKN+N
Sbjct: 259 SKNSN 263

>SAKL0E06402g Chr5 (521232..522707) [1476 bp, 491 aa] {ON} similar
           to uniprot|Q755L6 Ashbya gossypii AFL202C AFL202Cp and
           weakly similar to YDL106C uniprot|P07269 Saccharomyces
           cerevisiae YDL106C PHO2 Homeobox transcription factor
           regulatory targets include genes involved in phosphate
           metabolism binds cooperatively with Pho4p to the PHO5
           promoter phosphorylation of Pho2p facilitates
           interaction with Pho4p
          Length = 491

 Score = 28.5 bits (62), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRK 95
           L+R F  N   P PN      +S  TNL  K ++ W  NRR K RK
Sbjct: 86  LKREFDVN---PNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK 128

>ZYRO0A07194g Chr1 complement(587457..588950) [1494 bp, 497 aa] {ON}
           similar to uniprot|P07269 Saccharomyces cerevisiae
           YDL106C PHO2 Homeobox transcription factor regulatory
           targets include genes involved in phosphate metabolism
           binds cooperatively with Pho4p to the PHO5 promoter
           phosphorylation of Pho2p facilitates interaction with
           Pho4p
          Length = 497

 Score = 28.5 bits (62), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 9/85 (10%)

Query: 19  HQEKATSPITSQSCLVASG------KQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLS 72
            +++ ++ IT+ S +  S       K+ +    A   L+R F +N   P P   +   LS
Sbjct: 62  QEDRKSATITANSVISNSDNSSSKPKRTRARGEALDILKREFETN---PNPTSQRRKKLS 118

Query: 73  KNTNLSIKQIQNWMSNRRRKSRKES 97
           + T L  K ++ W  NRR K RK+ 
Sbjct: 119 EMTGLPEKNVRIWFQNRRAKLRKDD 143

>TBLA0B07070 Chr2 complement(1677335..1679272) [1938 bp, 645 aa]
           {ON} Anc_2.337 YDL106C
          Length = 645

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 29  SQSCLVASGKQRKFNATAK--KRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWM 86
            QS    + +Q++  AT +    L++ F  N   P PN  +   LS++T L  K ++ W 
Sbjct: 118 DQSVNTNTHRQKRTRATGEALDLLKQEFKLN---PNPNSKRRKMLSESTGLPEKNVRIWF 174

Query: 87  SNRRRKSRK 95
            NRR K RK
Sbjct: 175 QNRRAKVRK 183

>Kwal_23.3494 s23 complement(318582..319982) [1401 bp, 466 aa] {ON}
           YDL106C (PHO2) - Homeobox-domain containing
           transcription fractor which is a positive regulator of
           PHO5 and other genes. [contig 252] FULL
          Length = 466

 Score = 28.1 bits (61), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 3/58 (5%)

Query: 38  KQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRK 95
           K+ +    A   L+R F  N   P PN      +S+ T L  K ++ W  NRR K RK
Sbjct: 56  KRTRATGEALNVLKREFDQN---PNPNAQNRKRISELTGLPEKNVRIWFQNRRAKHRK 110

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 28.1 bits (61), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%)

Query: 79  IKQIQNWMSNRRRKSRKESIDSLLE 103
           +K++ N ++N+RRK RK  I SLL+
Sbjct: 223 LKKVSNILNNKRRKGRKRPIVSLLQ 247

>KLTH0F09636g Chr6 complement(834845..836299) [1455 bp, 484 aa] {ON}
           similar to uniprot|P07269 Saccharomyces cerevisiae
           YDL106C PHO2 Homeobox transcription factor regulatory
           targets include genes involved in phosphate metabolism
           binds cooperatively with Pho4p to the PHO5 promoter
           phosphorylation of Pho2p facilitates interaction with
           Pho4p
          Length = 484

 Score = 28.1 bits (61), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEP 104
           L+R F  N   P PN      +S+ T L  K ++ W  NRR K RK   D + +P
Sbjct: 81  LKREFEEN---PNPNAQNRKRISELTGLPEKNVRIWFQNRRAKHRK--TDRIAKP 130

>TDEL0A04320 Chr1 complement(765442..766434) [993 bp, 330 aa] {ON}
           Anc_5.567 YML027W
          Length = 330

 Score = 27.7 bits (60), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 61  PYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKE 96
           P P+K +   L++  N+S K +Q W  N+R+ S+++
Sbjct: 184 PAPDKRKRQELAERCNMSEKAVQIWFQNKRQASKRQ 219

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 27.7 bits (60), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRK 92
           L  W  ++++ PYP   +   L   T L+  Q+ NW  N RR+
Sbjct: 190 LNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRR 232

>AFL202C Chr6 complement(56150..57595) [1446 bp, 481 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL106C
           (PHO2)
          Length = 481

 Score = 27.7 bits (60), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 8/76 (10%)

Query: 25  SPITSQSCLVASG-----KQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSI 79
           SP   +    A G     K+ +    A + L++ F  N   P PN      +S+ T L  
Sbjct: 45  SPGHGELAEAADGGKPKSKRTRATGEALELLKKEFDIN---PNPNAQNRKRISEQTGLPE 101

Query: 80  KQIQNWMSNRRRKSRK 95
           K ++ W  NRR K RK
Sbjct: 102 KNVRIWFQNRRAKYRK 117

>KAFR0C05600 Chr3 complement(1115478..1116632) [1155 bp, 384 aa]
           {ON} Anc_5.567 YML027W
          Length = 384

 Score = 27.7 bits (60), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%)

Query: 39  QRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRR 91
           +RK   T+ + L     S  + P P+K + L L+   N++ K +Q W  N+R+
Sbjct: 155 RRKRRRTSTQELNILQASFDKCPTPDKKERLELADRCNMTEKAVQIWFQNKRQ 207

>Kwal_47.18450 s47 (830833..831945) [1113 bp, 370 aa] {ON} YML027W
           (YOX1) - Homeobox-domain containing protein [contig 195]
           FULL
          Length = 370

 Score = 27.7 bits (60), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 61  PYPNKIQILSLSKNTNLSIKQIQNWMSNRR---RKSRKESIDSLL 102
           P P+K + + LS+   +S K IQ W  N+R   ++ +K   D+ L
Sbjct: 182 PTPDKFKRIELSERCCMSEKAIQIWFQNKRQSVKRQQKAVTDTTL 226

>Ecym_3378 Chr3 complement(718342..719817) [1476 bp, 491 aa] {ON}
           similar to Ashbya gossypii AFL202C
          Length = 491

 Score = 27.3 bits (59), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 3/78 (3%)

Query: 18  SHQEKATSPITSQSCLVASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNL 77
           SH  + ++   +        K+ +    A + L++ F  N   P PN      +S+ T L
Sbjct: 52  SHANETSAEAHAHEIGKPKSKRTRATGEALELLKKEFDIN---PNPNAQNRKRISEQTGL 108

Query: 78  SIKQIQNWMSNRRRKSRK 95
             K ++ W  NRR K RK
Sbjct: 109 PEKNVRIWFQNRRAKYRK 126

>Suva_4.140 Chr4 complement(258729..260402) [1674 bp, 557 aa] {ON}
           YDL106C (REAL)
          Length = 557

 Score = 27.3 bits (59), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 7/89 (7%)

Query: 20  QEKATSPITSQSCLVASGKQRKFNATAKKR----LERWFCSNIQYPYPNKIQILSLSKNT 75
           QE+  + +++ S     G QR     AK      L+R F  N   P P+ ++   +S   
Sbjct: 57  QERHMNDMSASSNTSDGGGQRPKRTRAKGEALDVLKRKFEMN---PTPSLVERKKISDLI 113

Query: 76  NLSIKQIQNWMSNRRRKSRKESIDSLLEP 104
            +  K ++ W  NRR K RK+  +   +P
Sbjct: 114 GMPEKNVRIWFQNRRAKLRKKQHEGNKDP 142

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.125    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,137,027
Number of extensions: 398487
Number of successful extensions: 1686
Number of sequences better than 10.0: 128
Number of HSP's gapped: 1686
Number of HSP's successfully gapped: 128
Length of query: 108
Length of database: 53,481,399
Length adjustment: 78
Effective length of query: 30
Effective length of database: 44,537,451
Effective search space: 1336123530
Effective search space used: 1336123530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)