Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F00374g1.1ON24924912381e-174
Kwal_33.matalpha1singletonOFF2442494072e-48
Kwal_33.12992singletonOFF2442494072e-48
Kwal_YGOB_matalpha11.120ON2442494072e-48
Kwal_YGOB_HMalpha11.1ON2442494072e-48
KLLA0C00352g1.1ON2612582253e-21
Ecym_10031.1ON2632172042e-18
Ecym_11141.120ON2632172042e-18
YCR040W (MATALPHA1)1.120ON1751641484e-11
YCL066W (HMLALPHA1)1.1ON1751641484e-11
ZYRO0F18590g1.1ON2001851433e-10
ZYRO0F15840g1.120ON2001851433e-10
Smik_92.1singletonON1561651404e-10
TBLA0A070401.120ON2011871382e-09
TBLA0A075901.1ON2011871382e-09
Suva_3.1481.1ON175641353e-09
NCAS0B091501.1ON1501481334e-09
Suva_69.2singletonON145561325e-09
Skud_71.1singletonON155611317e-09
Skud_3.1191.120ON174611311e-08
Kpol_2002.21.1ON2091891258e-08
KNAG0C001501.1ON1451501221e-07
TDEL0C070101.1ON2051831171e-06
KAFR0D007101.120ON172491132e-06
CAGL0B01243g1.120ON143521122e-06
CAGL0B00242g1.1ON1841271133e-06
TPHA0E036201.120ON1951771108e-06
TPHA0E040801.1ON1951771108e-06
NDAI0A001001.1ON135101720.52
CAGL0K04807g2.35ON79641750.53
TPHA0B040801.127ON200960711.8
Kwal_27.119458.518ON58349702.0
ABL168C2.35ON79858684.2
Suva_9.255singletonON48469666.4
Ecym_73922.479ON143456666.4
Kpol_1060.186.297ON318100649.2
ZYRO0F11440g7.336ON52363649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F00374g
         (249 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...   481   e-174
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...   161   2e-48
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...   161   2e-48
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...   161   2e-48
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...   161   2e-48
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    91   3e-21
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    83   2e-18
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    83   2e-18
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    62   4e-11
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    62   4e-11
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...    60   3e-10
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...    60   3e-10
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    59   4e-10
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...    58   2e-09
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...    58   2e-09
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    57   3e-09
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      56   4e-09
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        55   5e-09
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    55   7e-09
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    55   1e-08
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...    53   8e-08
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    52   1e-07
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....    50   1e-06
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    48   2e-06
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    48   2e-06
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    48   3e-06
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...    47   8e-06
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...    47   8e-06
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    32   0.52 
CAGL0K04807g Chr11 complement(467118..469508) [2391 bp, 796 aa] ...    33   0.53 
TPHA0B04080 Chr2 (964764..970793) [6030 bp, 2009 aa] {ON} Anc_1....    32   1.8  
Kwal_27.11945 s27 (1012266..1014017) [1752 bp, 583 aa] {ON} YBR1...    32   2.0  
ABL168C Chr2 complement(84646..87042) [2397 bp, 798 aa] {ON} Syn...    31   4.2  
Suva_9.255 Chr9 (415666..417120) [1455 bp, 484 aa] {ON} YKR101W ...    30   6.4  
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    30   6.4  
Kpol_1060.18 s1060 (45327..46283) [957 bp, 318 aa] {ON} (45327.....    29   9.2  
ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly...    29   9.9  

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score =  481 bits (1238), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/249 (94%), Positives = 235/249 (94%)

Query: 1   MNSTKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVRS 60
           MNSTKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVRS
Sbjct: 1   MNSTKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVRS 60

Query: 61  KKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVRQQE 120
           KKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVRQQE
Sbjct: 61  KKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVRQQE 120

Query: 121 LSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWXXXXXXXXXXXXXXDSECMAKR 180
           LSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLW              DSECMAKR
Sbjct: 121 LSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWLEENYQQSYEESELDSECMAKR 180

Query: 181 SQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSLPFFEEHNRTTDWMLSSILQ 240
           SQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSLPFFEEHNRTTDWMLSSILQ
Sbjct: 181 SQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSLPFFEEHNRTTDWMLSSILQ 240

Query: 241 CDQVPYYPN 249
           CDQVPYYPN
Sbjct: 241 CDQVPYYPN 249

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score =  161 bits (407), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 134/249 (53%), Gaps = 9/249 (3%)

Query: 1   MNSTKPSFKVLI-KKKGKTLNRRLKNSS--KSYRENGANLYMSYSKPQAIPKPPNTLINL 57
           M  TKPSFKV + K+ G  L  ++   S  ++Y   G NLYMSYSK + IPKPP  ++ +
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60

Query: 58  VRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVR 117
           + S      S+   K   I K+   +   + S     KKKINPFIGFRSYYA+  KGR+R
Sbjct: 61  LGSDHGKGLSKGLSKG--IHKDQKSQTF-LGSGKCTSKKKINPFIGFRSYYARIVKGRIR 117

Query: 118 QQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWXXXXXXXXXXXXXXDSECM 177
           QQELS ILS+YW  + ++H  WEFFT+HYNR+ T MCFT W               +   
Sbjct: 118 QQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGT---AAVE 174

Query: 178 AKRSQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSLPFFEEHNRTTDWMLSS 237
                P+IED+Y       T+ T +EL      H  +Q  LN +   E++++  D +  S
Sbjct: 175 ISYGLPFIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCS 234

Query: 238 ILQCDQVPY 246
           I + D+  Y
Sbjct: 235 IQKNDEGLY 243

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score =  161 bits (407), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 134/249 (53%), Gaps = 9/249 (3%)

Query: 1   MNSTKPSFKVLI-KKKGKTLNRRLKNSS--KSYRENGANLYMSYSKPQAIPKPPNTLINL 57
           M  TKPSFKV + K+ G  L  ++   S  ++Y   G NLYMSYSK + IPKPP  ++ +
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60

Query: 58  VRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVR 117
           + S      S+   K   I K+   +   + S     KKKINPFIGFRSYYA+  KGR+R
Sbjct: 61  LGSDHGKGLSKGLSKG--IHKDQKSQTF-LGSGKCTSKKKINPFIGFRSYYARIVKGRIR 117

Query: 118 QQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWXXXXXXXXXXXXXXDSECM 177
           QQELS ILS+YW  + ++H  WEFFT+HYNR+ T MCFT W               +   
Sbjct: 118 QQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGT---AAVE 174

Query: 178 AKRSQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSLPFFEEHNRTTDWMLSS 237
                P+IED+Y       T+ T +EL      H  +Q  LN +   E++++  D +  S
Sbjct: 175 ISYGLPFIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCS 234

Query: 238 ILQCDQVPY 246
           I + D+  Y
Sbjct: 235 IQKNDEGLY 243

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score =  161 bits (407), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 134/249 (53%), Gaps = 9/249 (3%)

Query: 1   MNSTKPSFKVLI-KKKGKTLNRRLKNSS--KSYRENGANLYMSYSKPQAIPKPPNTLINL 57
           M  TKPSFKV + K+ G  L  ++   S  ++Y   G NLYMSYSK + IPKPP  ++ +
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60

Query: 58  VRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVR 117
           + S      S+   K   I K+   +   + S     KKKINPFIGFRSYYA+  KGR+R
Sbjct: 61  LGSDHGKGLSKGLSKG--IHKDQKSQTF-LGSGKCTSKKKINPFIGFRSYYARIVKGRIR 117

Query: 118 QQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWXXXXXXXXXXXXXXDSECM 177
           QQELS ILS+YW  + ++H  WEFFT+HYNR+ T MCFT W               +   
Sbjct: 118 QQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGT---AAVE 174

Query: 178 AKRSQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSLPFFEEHNRTTDWMLSS 237
                P+IED+Y       T+ T +EL      H  +Q  LN +   E++++  D +  S
Sbjct: 175 ISYGLPFIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCS 234

Query: 238 ILQCDQVPY 246
           I + D+  Y
Sbjct: 235 IQKNDEGLY 243

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score =  161 bits (407), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 134/249 (53%), Gaps = 9/249 (3%)

Query: 1   MNSTKPSFKVLI-KKKGKTLNRRLKNSS--KSYRENGANLYMSYSKPQAIPKPPNTLINL 57
           M  TKPSFKV + K+ G  L  ++   S  ++Y   G NLYMSYSK + IPKPP  ++ +
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60

Query: 58  VRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVR 117
           + S      S+   K   I K+   +   + S     KKKINPFIGFRSYYA+  KGR+R
Sbjct: 61  LGSDHGKGLSKGLSKG--IHKDQKSQTF-LGSGKCTSKKKINPFIGFRSYYARIVKGRIR 117

Query: 118 QQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWXXXXXXXXXXXXXXDSECM 177
           QQELS ILS+YW  + ++H  WEFFT+HYNR+ T MCFT W               +   
Sbjct: 118 QQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGT---AAVE 174

Query: 178 AKRSQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSLPFFEEHNRTTDWMLSS 237
                P+IED+Y       T+ T +EL      H  +Q  LN +   E++++  D +  S
Sbjct: 175 ISYGLPFIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCS 234

Query: 238 ILQCDQVPY 246
           I + D+  Y
Sbjct: 235 IQKNDEGLY 243

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 91.3 bits (225), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 111/258 (43%), Gaps = 43/258 (16%)

Query: 1   MNSTKPSFKVLIKKKGKT------------LNRRLKNSSKSYRENGANLYMSYSKPQAIP 48
           M S  P+FKV + K+  +            + R+   SS+  +  G NLYMS   P +IP
Sbjct: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60

Query: 49  KPPNTLINLVRSK-KTSQSSR--KCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFR 105
            PP  L+  ++ K KT   S     L N   L   DVK           KK+IN FI FR
Sbjct: 61  APPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVK-------TKTKKKQINDFIAFR 113

Query: 106 SYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWXXXXXXX 165
           SYY++   G + Q ELS I+S++WT + +    WE   Q YN + +   F  W       
Sbjct: 114 SYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGI 173

Query: 166 XXX---XXXXDSECMAKRS-QPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSL 221
                       EC+   + +PY+E++Y+    F  ++ S    DI+             
Sbjct: 174 DKQWLYEIVQYEECLTPTTKKPYVENIYNSG--FKQRIDSPNQKDIT------------- 218

Query: 222 PFFEEHNRTTDWMLSSIL 239
             F + + + DW++  I 
Sbjct: 219 --FSQSDNSADWLVDPIF 234

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 83.2 bits (204), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 99/217 (45%), Gaps = 33/217 (15%)

Query: 1   MNSTKPSFKVLIKK-KGKTLNRRLKNSS-----------------KSYRENGANLYMSYS 42
           +N   P F+V IKK K +  +RR K SS                   Y+  G NLYM+  
Sbjct: 4   INYKTPMFRVKIKKPKTRKGSRRRKGSSVLKILEIKNQDNYNKKKGYYKCEGVNLYMTSG 63

Query: 43  KPQAIPKPPNTLINLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVL---KKKIN 99
            P+ IP+PP  L+  ++ +               +K+ +  K   YS  T +   +KKIN
Sbjct: 64  PPKKIPEPPKELLRYIKQQNFEFED---------IKQSNNNKSIAYSEETDIPKKRKKIN 114

Query: 100 PFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWX 159
            F+ FRSYY++F +G V Q ELS+IL++ W +  K+   WE F +HYN E     F  W 
Sbjct: 115 EFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWL 174

Query: 160 XXXXXXX---XXXXXXDSECMAKRSQPYIEDLYSGTG 193
                           D +   K   PY+EDLY  TG
Sbjct: 175 EKTYTSSYTPKGKVKIDDDQDEKSKHPYVEDLYLNTG 211

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 83.2 bits (204), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 99/217 (45%), Gaps = 33/217 (15%)

Query: 1   MNSTKPSFKVLIKK-KGKTLNRRLKNSS-----------------KSYRENGANLYMSYS 42
           +N   P F+V IKK K +  +RR K SS                   Y+  G NLYM+  
Sbjct: 4   INYKTPMFRVKIKKPKTRKGSRRRKGSSVLKILEIKNQDNYNKKKGYYKCEGVNLYMTSG 63

Query: 43  KPQAIPKPPNTLINLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVL---KKKIN 99
            P+ IP+PP  L+  ++ +               +K+ +  K   YS  T +   +KKIN
Sbjct: 64  PPKKIPEPPKELLRYIKQQNFEFED---------IKQSNNNKSIAYSEETDIPKKRKKIN 114

Query: 100 PFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWX 159
            F+ FRSYY++F +G V Q ELS+IL++ W +  K+   WE F +HYN E     F  W 
Sbjct: 115 EFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWL 174

Query: 160 XXXXXXX---XXXXXXDSECMAKRSQPYIEDLYSGTG 193
                           D +   K   PY+EDLY  TG
Sbjct: 175 EKTYTSSYTPKGKVKIDDDQDEKSKHPYVEDLYLNTG 211

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 79/164 (48%), Gaps = 18/164 (10%)

Query: 1   MNSTKPSFKVLIKK----KGKTLNRRLKNS--SKSYRENGANLYMSYSKPQAIPKPPNTL 54
           M ++KP+FK+  K     +   ++++LK    ++  R +  N+     K   IP P +  
Sbjct: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60

Query: 55  INLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKG 114
           +N ++  + +  S+      +        K SI S+    KK +N F+ FR+YY++F  G
Sbjct: 61  LNKIQIHRIASGSQNTQFRQF-------NKTSIKSS----KKYLNSFMAFRAYYSQFGSG 109

Query: 115 RVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLW 158
            V+Q  LS +L+E W  +   H +W++F Q YN       F  W
Sbjct: 110 -VKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 152

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 79/164 (48%), Gaps = 18/164 (10%)

Query: 1   MNSTKPSFKVLIKK----KGKTLNRRLKNS--SKSYRENGANLYMSYSKPQAIPKPPNTL 54
           M ++KP+FK+  K     +   ++++LK    ++  R +  N+     K   IP P +  
Sbjct: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60

Query: 55  INLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKG 114
           +N ++  + +  S+      +        K SI S+    KK +N F+ FR+YY++F  G
Sbjct: 61  LNKIQIHRIASGSQNTQFRQF-------NKTSIKSS----KKYLNSFMAFRAYYSQFGSG 109

Query: 115 RVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLW 158
            V+Q  LS +L+E W  +   H +W++F Q YN       F  W
Sbjct: 110 -VKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 152

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 81/185 (43%), Gaps = 35/185 (18%)

Query: 3   STKPSFKVLIKKKGKTLNRRLKNSS--------KSYRENGANLYMSYSKPQAIPKPPNTL 54
           S +P FKV ++KKG++    L++++        K   +   N++M+ SK   IP PP  L
Sbjct: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70

Query: 55  INLVRSKKTSQSSRKCLKNDYILKELDVKKLSIY---------------------SNNTV 93
           +     +K  +   K  K+D+ +  + +    +Y                     S    
Sbjct: 71  L-----RKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGC 125

Query: 94  LKKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSM 153
            +K +N F+ FR+Y ++F  G ++Q  LS +L+  W  + +   +W+ F Q +N      
Sbjct: 126 SEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKC 184

Query: 154 CFTLW 158
            F  W
Sbjct: 185 GFVEW 189

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 81/185 (43%), Gaps = 35/185 (18%)

Query: 3   STKPSFKVLIKKKGKTLNRRLKNSS--------KSYRENGANLYMSYSKPQAIPKPPNTL 54
           S +P FKV ++KKG++    L++++        K   +   N++M+ SK   IP PP  L
Sbjct: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70

Query: 55  INLVRSKKTSQSSRKCLKNDYILKELDVKKLSIY---------------------SNNTV 93
           +     +K  +   K  K+D+ +  + +    +Y                     S    
Sbjct: 71  L-----RKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGC 125

Query: 94  LKKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSM 153
            +K +N F+ FR+Y ++F  G ++Q  LS +L+  W  + +   +W+ F Q +N      
Sbjct: 126 SEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKC 184

Query: 154 CFTLW 158
            F  W
Sbjct: 185 GFVEW 189

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 58.5 bits (140), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 80/165 (48%), Gaps = 20/165 (12%)

Query: 1   MNSTKPSFKVLIK----KKGKTLNRRLKNS--SKSYRENGANLYMSYSKPQAIPKPPNTL 54
           M ++KP+F++  K     +   +++++K    +K  + N  N+     K   IP P +  
Sbjct: 1   MFTSKPAFRINNKISKSHRNPVVSKKIKERRITKHVKPNCFNVIRPLKKDIQIPIPSSRF 60

Query: 55  INLVRSKKTSQSSRKCLKNDYI-LKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAK 113
           +      K  Q  R    N +I  ++L+  K SI S     KK +N F+ FR+YY++F  
Sbjct: 61  L------KKIQIHRIASGNQHIQCRQLN--KTSIKST----KKYLNSFMAFRAYYSQFGS 108

Query: 114 GRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLW 158
           G V+Q  LS +LSE W  +   H +W++F Q YN       F  W
Sbjct: 109 G-VKQNILSSLLSEEWHADKTQHGIWDYFAQQYNFINPGFGFVEW 152

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (44%), Gaps = 33/187 (17%)

Query: 1   MNSTKPS-FKVLIKKKGKTLNRRLKNSSKSYRE-----NGANLYMSYSKPQAIPKPPNTL 54
           MN TK + FKV +K      N R+K +SKS R       G ++ +  +    IP PP TL
Sbjct: 6   MNHTKKALFKVNLKLNK---NIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPTTL 62

Query: 55  INLVRSKKTSQSSRKCLKNDYILKELDVKKLSIY------SNNTVL-------------- 94
           +  +  +K    S + + N+Y +   D     ++       NN++               
Sbjct: 63  LYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNPNP 122

Query: 95  ---KKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVT 151
              ++ +N FI FR+Y ++F  G ++Q  LS +LS  W +N    +VW FF+Q YN    
Sbjct: 123 VNSERVLNGFIAFRAYNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKP 181

Query: 152 SMCFTLW 158
              F  W
Sbjct: 182 KCGFVEW 188

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (44%), Gaps = 33/187 (17%)

Query: 1   MNSTKPS-FKVLIKKKGKTLNRRLKNSSKSYRE-----NGANLYMSYSKPQAIPKPPNTL 54
           MN TK + FKV +K      N R+K +SKS R       G ++ +  +    IP PP TL
Sbjct: 6   MNHTKKALFKVNLKLNK---NIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPTTL 62

Query: 55  INLVRSKKTSQSSRKCLKNDYILKELDVKKLSIY------SNNTVL-------------- 94
           +  +  +K    S + + N+Y +   D     ++       NN++               
Sbjct: 63  LYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNPNP 122

Query: 95  ---KKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVT 151
              ++ +N FI FR+Y ++F  G ++Q  LS +LS  W +N    +VW FF+Q YN    
Sbjct: 123 VNSERVLNGFIAFRAYNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKP 181

Query: 152 SMCFTLW 158
              F  W
Sbjct: 182 KCGFVEW 188

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 56.6 bits (135), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 95  KKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMC 154
           KK +N F+ FR+YY++F  G V+Q  LS +LSE W  +   H +W++F Q YN       
Sbjct: 90  KKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFG 148

Query: 155 FTLW 158
           F  W
Sbjct: 149 FVEW 152

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 55.8 bits (133), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 77/148 (52%), Gaps = 17/148 (11%)

Query: 2   NSTKPSFKVLIKKKGKTLNRR--LKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVR 59
           N  KP FKV I ++ +  N +  LK    +Y +   N+++   K   IP+PPN ++  + 
Sbjct: 8   NQNKPLFKVNIPRRVRNRNSKQPLKPKPVTY-DTCFNIFLKDPKNITIPQPPNWVLQELE 66

Query: 60  SKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVRQQ 119
           +          ++  Y  K+    +  + SN +   K IN FI FRSYY+++  G ++Q 
Sbjct: 67  T----------IRIIYPSKQKPKPRKQVTSNPS---KPINGFILFRSYYSRWGYG-IKQT 112

Query: 120 ELSKILSEYWTKNSKIHSVWEFFTQHYN 147
            LS++L+++W  +    ++W++F   Y+
Sbjct: 113 MLSQLLAKFWKSSDTDQALWDYFALQYS 140

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 1/56 (1%)

Query: 92  TVLKKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYN 147
           T  KK +N F+ FR+YY++F  G V+Q  LS +LSE W  +   H +W++F Q YN
Sbjct: 87  TPSKKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYN 141

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 55.1 bits (131), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 98  INPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTL 157
           IN F+ FR+YY++F  G V+Q  LS +LSE W  +   H +W++F Q YN       F  
Sbjct: 92  INSFMAFRAYYSQFGSG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVE 150

Query: 158 W 158
           W
Sbjct: 151 W 151

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 98  INPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTL 157
           IN F+ FR+YY++F  G V+Q  LS +LSE W  +   H +W++F Q YN       F  
Sbjct: 92  INSFMAFRAYYSQFGSG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVE 150

Query: 158 W 158
           W
Sbjct: 151 W 151

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 81/189 (42%), Gaps = 34/189 (17%)

Query: 3   STKPSFKVLI---------KKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNT 53
           +++P FKV +         KKKG  +N+   ++ K  ++   N++++ S    IP PP++
Sbjct: 9   TSQPLFKVKLNKSNKIEKQKKKGIAINKLANSAGKLSQKANVNVFITNSLVTKIPFPPSS 68

Query: 54  L-----------------INLVRSKKTSQSSRKCLKNDYILKE-------LDVKKLSIYS 89
           L                 IN+         S    ++D  L +       L     S+  
Sbjct: 69  LLLGIDEETKKMKSKKTSINIQNDTNILNFSSSWDEDDLFLSDTETEYDLLSTSPNSVIE 128

Query: 90  NNTVLKKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNRE 149
            +T  KK +N F+ FR+Y ++F  G ++Q+ LS +LSE W  + +    W   +Q +N  
Sbjct: 129 VDTSSKKSLNGFMAFRAYNSQFGYG-LKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFV 187

Query: 150 VTSMCFTLW 158
                F  W
Sbjct: 188 KPKCGFVEW 196

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 73/150 (48%), Gaps = 15/150 (10%)

Query: 1   MNSTKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVRS 60
           M S KP FK+ I +   + N+ ++   K  R    N + S +  +  PK P+   N++R+
Sbjct: 1   MFSKKPLFKMNITQSHSS-NKSIR---KRTRRPNLNSFASTNAAKNTPKIPDP--NIIRA 54

Query: 61  KKTSQSSRKCLKNDYILKELDVKKLS---IYSNNTVLKK-KINPFIGFRSYYAKFAKGRV 116
                  R    +  I+   D   LS   I S   + K   +N FI FR+YY++FA G +
Sbjct: 55  VLF----RNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANG-I 109

Query: 117 RQQELSKILSEYWTKNSKIHSVWEFFTQHY 146
            Q +LS ILS++W  N    + W+  T+ Y
Sbjct: 110 NQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 77/183 (42%), Gaps = 30/183 (16%)

Query: 5   KPSFKVLIKKKGKT-------------LNRRLKNSSKSYRENGANLYMSYSKPQAIPKPP 51
           +P FKV I K  +T             L++    +S    E     ++   +P  IP PP
Sbjct: 15  RPLFKVQINKDSRTSQCKAKTKFKKAKLDKCQPENSGRLEERHVKTFVVILRPIKIPLPP 74

Query: 52  NTLINLVRSKKT---SQSSRK---------CLKNDYILKELDVKKLS-IY---SNNTVLK 95
           N L+  +  +K    S++S +            N+ +L  +    L  IY   +  T   
Sbjct: 75  NILLEKIEQEKRKVYSETSPEIGSLWDSPIAWDNEDLLFSIASDVLGNIYKKPARETASN 134

Query: 96  KKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCF 155
           K +N F+ FR+Y ++F  G ++Q  LS +L+  W  + +   +W+ F Q +N       F
Sbjct: 135 KPLNSFMAFRAYNSQFGYG-LKQNILSSLLASAWHSHPEQQGIWDTFAQQFNFVKPKCGF 193

Query: 156 TLW 158
             W
Sbjct: 194 VEW 196

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 36/49 (73%), Gaps = 1/49 (2%)

Query: 96  KKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQ 144
           + +NPF+ FRSYY+++A+G ++Q ELS++L++ W  ++K  + W   TQ
Sbjct: 119 RNLNPFMAFRSYYSQYAQG-LKQIELSEVLAKAWHSDTKEQNYWISLTQ 166

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 96  KKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYN 147
           + +N F+ FR+YYA+   G ++Q  LS ILSE W       ++W+ F Q +N
Sbjct: 73  RPMNAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 123

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 57/127 (44%), Gaps = 14/127 (11%)

Query: 34  GANLYMSYSKPQAIPKPPNTLINLVRSK--KTSQSSRKCLKNDYILKELDVKKLSIYSNN 91
           G N+ ++      IP P   L+  +R +  K + S    +    I    ++ K   +  N
Sbjct: 39  GLNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFN 98

Query: 92  TVL-----------KKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWE 140
           T +           K+ +N F+ FR+YYA+   G ++Q  LS ILSE W       ++W+
Sbjct: 99  TSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWD 157

Query: 141 FFTQHYN 147
            F Q +N
Sbjct: 158 IFAQQFN 164

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 78/177 (44%), Gaps = 22/177 (12%)

Query: 3   STKPSFKV-LIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVRSK 61
           S +P FKV L KK+ +++  +   ++   ++  ++ +++ +    IP PP  L+  + ++
Sbjct: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPPTCLLRSIDAE 67

Query: 62  KTSQSSRKCL---------------KNDYILKELDVKKLSIYSN-----NTVLKKKINPF 101
                 +K +                 D +L + D+     Y N       + KK +N F
Sbjct: 68  LRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEEELLFKKSLNSF 127

Query: 102 IGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLW 158
           I FR+Y A+F  G + Q  LS +LS  W    + H VW+ F Q +N       F  W
Sbjct: 128 IAFRAYNAQFGNG-LNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGFVEW 183

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 78/177 (44%), Gaps = 22/177 (12%)

Query: 3   STKPSFKV-LIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVRSK 61
           S +P FKV L KK+ +++  +   ++   ++  ++ +++ +    IP PP  L+  + ++
Sbjct: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPPTCLLRSIDAE 67

Query: 62  KTSQSSRKCL---------------KNDYILKELDVKKLSIYSN-----NTVLKKKINPF 101
                 +K +                 D +L + D+     Y N       + KK +N F
Sbjct: 68  LRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEEELLFKKSLNSF 127

Query: 102 IGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLW 158
           I FR+Y A+F  G + Q  LS +LS  W    + H VW+ F Q +N       F  W
Sbjct: 128 IAFRAYNAQFGNG-LNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGFVEW 183

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/101 (20%), Positives = 40/101 (39%), Gaps = 10/101 (9%)

Query: 47  IPKPPNTLINLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRS 106
           +P PP   ++ +  +    +     + + IL+    +            K IN F+ FRS
Sbjct: 21  VPPPPKWFLDSINFEHNPTTRLTYFQKESILRPYQSR---------CYAKSINGFMLFRS 71

Query: 107 YYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYN 147
           YY+++ KG  +      +    W  +     +W+ F Q  N
Sbjct: 72  YYSQYGKGLKQSLLSPLLSKL-WNAHETDQLLWDQFAQQCN 111

>CAGL0K04807g Chr11 complement(467118..469508) [2391 bp, 796 aa]
          {ON} similar to uniprot|P40157 Saccharomyces cerevisiae
          YNL212w
          Length = 796

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%)

Query: 38 YMSYSKPQAIPKPPNTLINLVRSKKTSQSSRKCLKNDYILK 78
          +M   + Q I   P+   NL+RS+K+ +SS +C+ ND +L+
Sbjct: 7  FMQLGEKQEISMIPSGEFNLLRSRKSPKSSLECIYNDAMLR 47

>TPHA0B04080 Chr2 (964764..970793) [6030 bp, 2009 aa] {ON} Anc_1.127
           YJL207C
          Length = 2009

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 12/60 (20%)

Query: 103 GFRSYYAKFAKGRVRQQELSKILSEYWTKNSKI---HSVWEFFTQHY----NREVTSMCF 155
           GF +  ++    RV    LS+IL +Y+  N KI     VWEF+T+ Y    +R+ TS CF
Sbjct: 285 GFSNDSSRIYTARV----LSEILFDYYA-NKKIITLDEVWEFYTRAYVNAVSRDTTSGCF 339

>Kwal_27.11945 s27 (1012266..1014017) [1752 bp, 583 aa] {ON} YBR163W
           (DEM1) - Weak similarity to Pta1p (pre-tRNA processing
           protein) [contig 26] FULL
          Length = 583

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 2   NSTKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKP 50
           N  KPS + L K K   L R+L    + +++  ++ Y++Y+ P  +P P
Sbjct: 80  NEPKPSTQGLTKAKRAYLERKLPIVHELFKDENSSRYLTYNLPAKLPNP 128

>ABL168C Chr2 complement(84646..87042) [2397 bp, 798 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL212W
          (VID27)
          Length = 798

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 40 SYSKPQAIPKPPNTLINLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKK 97
          S SKP+ +  P   L  L RS+++ +SS +CL ND  +    V+  + Y+   V++K+
Sbjct: 10 SGSKPEVVSIPSGQLY-LTRSRQSPKSSSECLYNDATVT---VRACARYAYELVVRKQ 63

>Suva_9.255 Chr9 (415666..417120) [1455 bp, 484 aa] {ON} YKR101W
           (REAL)
          Length = 484

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 6/69 (8%)

Query: 42  SKPQAIPKPPNTLINLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPF 101
           ++P+ +PK   TL +    K T      C++ +YIL   D++++S Y++    K  +N F
Sbjct: 418 AEPEPVPKDEGTLFHFQFKKDTPF----CVQEEYILLVKDLREISTYASQR--KYYVNYF 471

Query: 102 IGFRSYYAK 110
             F+  + +
Sbjct: 472 ARFKDMFEQ 480

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 4   TKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVR 59
           TKP  +  I+ +  +L+RRLK SS      G +  +S    ++ P PP T+ NL+R
Sbjct: 707 TKPVMEK-IQSRDLSLDRRLKISSPLASVAGKHGGVSLDPRRSAPDPPKTIENLLR 761

>Kpol_1060.18 s1060 (45327..46283) [957 bp, 318 aa] {ON}
           (45327..46283) [957 nt, 319 aa]
          Length = 318

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 1   MNSTKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVRS 60
           M+ T P    L++  G      + ++ ++      +LY++YS    +PK      N   S
Sbjct: 139 MDETTPDIDDLMESMGIEDTDDIIDTPQNTDRRYYDLYITYSTSYKVPKMYIVGFNGSGS 198

Query: 61  KKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINP 100
             T +   + +  DY  K   ++KL  Y  NT+    I+P
Sbjct: 199 PLTPEEMFEDIAPDYRSKTATIEKLPFYK-NTISSVSIHP 237

>ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q75BS4 Ashbya gossypii ACR197W DHH1
           ATP-dependent RNA helicase DHH1 and similar to YDL160C
           uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 523

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 10/63 (15%)

Query: 70  CLKNDYILKELDVKKLSIYSNNT----VLKKKINPFIGFRSYYAKFAKGRVRQQELSKIL 125
           CL  + +  +L V +  I+ N+T    +L KKI   +G+  YY+     R+RQQE +K+ 
Sbjct: 257 CL--NTLFSKLQVNQAIIFCNSTNRVELLAKKITD-LGYSCYYSH---ARMRQQERNKVF 310

Query: 126 SEY 128
            E+
Sbjct: 311 HEF 313

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,371,645
Number of extensions: 1149874
Number of successful extensions: 4380
Number of sequences better than 10.0: 92
Number of HSP's gapped: 4462
Number of HSP's successfully gapped: 92
Length of query: 249
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 142
Effective length of database: 41,212,137
Effective search space: 5852123454
Effective search space used: 5852123454
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)