Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E15884g3.186ON58658627930.0
Kwal_27.98243.186ON58559516310.0
SAKL0C07964g3.186ON62362011341e-147
ZYRO0A04994g3.186ON6086159951e-127
AER213C3.186ON5575879361e-119
Smik_4.2213.186ON6194809371e-118
Skud_4.2403.186ON6194829221e-116
Suva_4.2363.186ON6304829001e-112
YDL013W (SLX5)3.186ON6194778981e-112
NDAI0A065103.186ON7125038741e-108
NCAS0I019103.186ON6135138631e-107
KAFR0A012203.186ON6475078034e-98
KLLA0C04411g3.186ON6075137431e-89
TBLA0F007203.186ON6493517137e-85
Kpol_1036.523.186ON5914776661e-78
TDEL0D043503.186ON5565916371e-74
KNAG0J012703.186ON5473565485e-62
CAGL0K01881g3.186ON5062264721e-51
TPHA0A043703.186ON6642404607e-49
Suva_11.2491.286ON551140780.77
Ecym_63311.286ON550119706.3
Kwal_27.111386.180ON129591708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E15884g
         (586 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]...  1080   0.0  
Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W (...   632   0.0  
SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} simila...   441   e-147
ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {...   387   e-127
AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}...   365   e-119
Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W ...   365   e-118
Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W ...   359   e-116
Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W ...   351   e-112
YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subuni...   350   e-112
NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa] ...   341   e-108
NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {O...   337   e-107
KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {O...   313   4e-98
KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} simila...   290   1e-89
TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.1...   279   7e-85
Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa] ...   261   1e-78
TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {O...   249   1e-74
KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3....   215   5e-62
CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakl...   186   1e-51
TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.1...   181   7e-49
Suva_11.249 Chr11 complement(455625..457280) [1656 bp, 551 aa] {...    35   0.77 
Ecym_6331 Chr6 complement(634459..636111) [1653 bp, 550 aa] {ON}...    32   6.3  
Kwal_27.11138 s27 (659056..662943) [3888 bp, 1295 aa] {ON} YGL09...    32   8.3  

>KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]
           {ON} similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 586

 Score = 1080 bits (2793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/586 (89%), Positives = 527/586 (89%)

Query: 1   MNPEDTNMDGTPPECSQNDVIEIESDTEDETQVLPGTLEAPDIGQMHGSLVDDLPSQNNA 60
           MNPEDTNMDGTPPECSQNDVIEIESDTEDETQVLPGTLEAPDIGQMHGSLVDDLPSQNNA
Sbjct: 1   MNPEDTNMDGTPPECSQNDVIEIESDTEDETQVLPGTLEAPDIGQMHGSLVDDLPSQNNA 60

Query: 61  SEVFCNTEDDDEIQLLGETVLDGNNAAAPRLGNPNINRAESVGVAQIRPHQPSAAGEEDL 120
           SEVFCNTEDDDEIQLLGETVLDGNNAAAPRLGNPNINRAESVGVAQIRPHQPSAAGEEDL
Sbjct: 61  SEVFCNTEDDDEIQLLGETVLDGNNAAAPRLGNPNINRAESVGVAQIRPHQPSAAGEEDL 120

Query: 121 VILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNXXXXXXXXXXXXXX 180
           VILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTN              
Sbjct: 121 VILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNSANGRRRLLRRTAR 180

Query: 181 XXXXXFLHPSDEEDEGFAYENTDLLPTGVRLRRQXXXXXXXXXXXXXXXLLGTGDDVDDP 240
                FLHPSDEEDEGFAYENTDLLPTGVRLRRQ               LLGTGDDVDDP
Sbjct: 181 RASSLFLHPSDEEDEGFAYENTDLLPTGVRLRRQRNSMMQRRPNPPRRQLLGTGDDVDDP 240

Query: 241 ELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLFTVYRGHVM 300
           ELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLFTVYRGHVM
Sbjct: 241 ELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLFTVYRGHVM 300

Query: 301 RSWXXXXXXXXXXXXSGMNTRTTDRTSQAHNLRYSPTLAGIIARTFNPILGHMHMAYEPG 360
           RSW            SGMNTRTTDRTSQAHNLRYSPTLAGIIARTFNPILGHMHMAYEPG
Sbjct: 301 RSWANDRLRRARDAASGMNTRTTDRTSQAHNLRYSPTLAGIIARTFNPILGHMHMAYEPG 360

Query: 361 LGTGMAAYNDADEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSGYLQKAAKLPDG 420
           LGTGMAAYNDADEERQTQNIIQMIQ             YMEDTKPKQSGYLQKAAKLPDG
Sbjct: 361 LGTGMAAYNDADEERQTQNIIQMIQEREEREFESRKRKYMEDTKPKQSGYLQKAAKLPDG 420

Query: 421 YSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVGIPDGFQGLY 480
           YSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVGIPDGFQGLY
Sbjct: 421 YSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVGIPDGFQGLY 480

Query: 481 EEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNARS 540
           EEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNARS
Sbjct: 481 EEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNARS 540

Query: 541 FNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586
           FNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF
Sbjct: 541 FNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586

>Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W
           (HEX3) - involved in hexose metabolism [contig 43] FULL
          Length = 585

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/595 (55%), Positives = 396/595 (66%), Gaps = 19/595 (3%)

Query: 1   MNPEDTNMDGTPPECSQNDVIEIESDTEDETQVL------PGTLEAPDIGQMHGSLVDDL 54
           M P +   D    E  Q D+IEIES  ED  Q+L      P TLE P   +   SL    
Sbjct: 1   MRPFEPPTDANSTESGQADIIEIESGVEDNQQMLSHQDGVPDTLEVPRTSESDPSL---- 56

Query: 55  PSQNNASEVFCNTEDDD-EIQLLGETVLDGNNAAAPRLGNPNINRAESVGVAQIRPHQPS 113
             +N   E  CNT+DDD E+Q++GE++L     + P     +++R+    + Q RP   +
Sbjct: 57  --RNENVETLCNTDDDDDELQVVGESILSERQTSYPETEYVDLDRSGEGSLGQRRPQ--A 112

Query: 114 AAGEEDLVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNXXXXXXX 173
           A+ EEDLVILEER +SPSFVLNLPGGE+L+I+GSPLDQPVRRSFQ Q  R  +       
Sbjct: 113 ASSEEDLVILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSAGARRR 172

Query: 174 XXXXXXXXXXXXFLHPSDEEDEGFAYENTDLLPTGVRLRRQXXXXXXXX--XXXXXXXLL 231
                       F+ PSD+E E     NT  LP+ V  RRQ                 + 
Sbjct: 173 LARRTARTASNLFMQPSDDEQEESVEGNTYQLPSTVMARRQRNALLMQRRPQPSRRQPVR 232

Query: 232 GTGDDVDDPELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHL 291
           G G  +  PEL +LEAQIN  P  VRSAFDHAQS+HEFRSILQS+D Q+Y QRQD+LT L
Sbjct: 233 GFGM-IQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSL 291

Query: 292 FTVYRGHVMRSWXXXXXXXXXXXXSGMNTRTTDRTSQAHNLRYSPTLAGIIARTFNPILG 351
           F+ YR +++RS             S +++R   +   A NL YSP+L GI+A+TFNP+LG
Sbjct: 292 FSEYRANLLRS-RSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNPVLG 350

Query: 352 HMHMAYEPGLGTGMAAYNDADEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSGYL 411
            MHM Y+     G+  Y + DEE+QTQNIIQMIQ             YMEDTK KQ GYL
Sbjct: 351 RMHMGYDARTHGGIMGYGEVDEEQQTQNIIQMIQEREEQEYEARKRKYMEDTKSKQLGYL 410

Query: 412 QKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVG 471
           +KA KLP+GYS+SFDTTP+MNI+I KNG+ EELTV DD A A YMD+P+C LCGVELGVG
Sbjct: 411 EKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVELGVG 470

Query: 472 IPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRC 531
           IPD FQGL  +DRGVSFEALKAKY FHCPYQ LSKPS+ DRDLSRRTYVA CGHSFCGRC
Sbjct: 471 IPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGRC 530

Query: 532 FARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586
           FARIDNARSFNRASK+KL +LKGAS+PDNYGPK CPAKDCNN+LR+RGKMREVYF
Sbjct: 531 FARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585

>SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 623

 Score =  441 bits (1134), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 265/620 (42%), Positives = 351/620 (56%), Gaps = 60/620 (9%)

Query: 11  TPPECSQNDVIEIESDTEDETQVLPGTLEAPDIG-----QMHGSLVDDLPSQNNASEVFC 65
            PP     DVIEIESD E++ ++     +   +G     +   SL   L SQ        
Sbjct: 20  APPSAPTQDVIEIESDPEEDERIRQQYRQQRLVGDRRINRPRDSLNRFLNSQGENRNTRA 79

Query: 66  NTE-----DDDEIQLLGETVLD-----GNNAAAPRLGNPNI----------NRAESVGVA 105
             E     DDD++Q++GET+LD     G +A    L +             NR       
Sbjct: 80  ALEPDDDEDDDDLQVVGETMLDRHGPIGEDADFVDLSSFGGGDTGSGGSGDNRNGVPTRT 139

Query: 106 QIRPHQPSAAGEE---DLVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQ-- 160
            I  H   A G +   D+ ILEER  +P+FVLNLPGGE L+ISG+  DQPVRRSFQ Q  
Sbjct: 140 AIIRHSTGANGSDRGDDIEILEERTTAPNFVLNLPGGESLRISGTTADQPVRRSFQNQQP 199

Query: 161 --GNRHTNXXXXXXXXXXXXXXXXXXXFLHPSDEEDEGFAYENT-DLLPTGVRLRRQXXX 217
                 +                    F        +G++ EN  D +P GVR  RQ   
Sbjct: 200 SRTRAVSAAAAARRRLLNRTARSATNLFFSSGQGPQDGYSEENDPDYIPAGVRQLRQQNA 259

Query: 218 ---XXXXXXXXXXXXLLGTGDDVDDPELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQ 274
                           L   D   + EL +L ++IN +P +++SAFDHAQS++EF  I+Q
Sbjct: 260 MRDRQASLEQRREQQRLNGMDPGANAELTALRSRINGYPLDIQSAFDHAQSLYEFEGIIQ 319

Query: 275 SVDRQSYEQRQDELTHLFTVYRGHVMRSWXXXXXXXXXXXXS-GMNTRTTDRTSQAHNL- 332
           SV+ +  E R+ EL  L++ YRGHVM SW            +    TR  ++  +   L 
Sbjct: 320 SVEPRMNENRKQELRELYSRYRGHVMHSWAQNRRRTYREQAARAQQTRAREQEQRQRELE 379

Query: 333 ------RYSPTLAGIIARTFNPILGHMHMAYEPGLGTGMAAYNDADEERQTQNIIQMIQX 386
                 R+S T   +IAR F P     H   +            ADEE +TQNII+MIQ 
Sbjct: 380 NQVFHNRHSLT-EFLIARAFGPF----HWGGQ-----------QADEEIETQNIIEMIQA 423

Query: 387 XXXXXXXXXXXXYMEDTKPKQSGYLQKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTV 446
                       YMEDTK +Q G+L++A  +P+GYSASFDT P+M I++ +NG+ EE+TV
Sbjct: 424 REEREQDTRKKRYMEDTKFQQQGFLRRAEGVPEGYSASFDTAPKMKIAMTRNGREEEVTV 483

Query: 447 VDDHADALYMDIPACCLCGVELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSK 506
            DDHA   Y D+PACCLCG+ELGVGIPD F G+ +EDRGVSFE+L AKY FHCPYQ+L++
Sbjct: 484 TDDHAAKQYEDVPACCLCGIELGVGIPDEFSGITKEDRGVSFESLVAKYGFHCPYQSLAR 543

Query: 507 PSVADRDLSRRTYVAQCGHSFCGRCFARIDNARSFNRASKKKLSELKGASNPDNYGPKNC 566
           PSVADRDLS+RTYVA CGH+FCGRCFAR+DNAR+++RASKKKL+ L+GAS+PDNYGPK C
Sbjct: 544 PSVADRDLSKRTYVASCGHTFCGRCFARVDNARAYSRASKKKLAGLQGASHPDNYGPKTC 603

Query: 567 PAKDCNNRLRSRGKMREVYF 586
           PA+ C+ +LRS+G+M+EV+F
Sbjct: 604 PAEGCSMQLRSKGRMKEVFF 623

>ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {ON}
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 608

 Score =  387 bits (995), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 238/615 (38%), Positives = 332/615 (53%), Gaps = 56/615 (9%)

Query: 13  PECSQN--------DVIEIESDTEDETQVL----PGTLEAPDIGQMH------------- 47
           PE SQ         D I IESD E++ ++     P  L  PD G++H             
Sbjct: 9   PEASQEVHINGRDEDPIIIESDQEEDQRIRDDARPIRLH-PD-GRIHRPRDGLNRFVNSE 66

Query: 48  GSLVDDLPSQNNASEVFCNTEDDDEIQLLGETVLDGNNAAAPRLGNPNI------NRAES 101
           G+ V    SQ+N          DDE+ ++GE      N   P   +         N  + 
Sbjct: 67  GTNVATTRSQDNGG-------SDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQV 119

Query: 102 VGVAQIRPHQPSAAGEEDLVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQG 161
           + V     +    + ++ LVI++ER  +P   LNLPGGE LQI  SP D+P RRSF+ Q 
Sbjct: 120 IEVNDNNRNNNENSDDDGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQ 179

Query: 162 NRHTNXXXXXXXXXXXXXXXXXXXFLHPSDEEDEGFA---YENTDLLPTGVRLRRQXXXX 218
              T                      H SD++D+       EN  L P+ ++LRRQ    
Sbjct: 180 QDRTRRQAMERSARRASRL-----LFHTSDDDDDDSGNGTVENGRLPPSVLQLRRQEEER 234

Query: 219 XXXXXXXXXXXLLGTGDDVDDPELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDR 278
                       + +     +P L+ L  +I+SFP +VRSAF HAQS++EFRSILQSV  
Sbjct: 235 SRLRNITRRRDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAP 294

Query: 279 QSYEQRQDELTHLFTVYRGHVMRSWXXXXXXXXXXXXSGMNTRTTDRTSQ-AHNLRYSPT 337
            + ++  +EL  LFT YR  ++++W              +N    +R  +  HN R+   
Sbjct: 295 LTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWHNRRHFRI 354

Query: 338 LAGIIARTFNPILGHMHMAYEPGLGTGMAAY------NDADEERQTQNIIQMIQXXXXXX 391
             G+    F   L +  +    G+G+  AA+       D DEE  TQ+I+ MIQ      
Sbjct: 355 HMGV-GGGFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQEREERE 413

Query: 392 XXXXXXXYMEDTKPKQSGYLQKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHA 451
                  YME T+ +Q  Y+Q+A +LPDGYSASFDT P++ + I+++G+ E + V DD  
Sbjct: 414 HDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDDSV 473

Query: 452 DALYMDIPACCLCGVELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVAD 511
              + ++P C LCGVELGVGIPD F+G+ + DRGVSFE L  KY FHCPYQTL++PS  D
Sbjct: 474 SDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLD 533

Query: 512 RDLSRRTYVAQCGHSFCGRCFARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDC 571
           RDLSRRT+VA CGH++CGRCFARIDNAR  +R +K+KL++LKG+++PDNYGPK CPAK C
Sbjct: 534 RDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGC 593

Query: 572 NNRLRSRGKMREVYF 586
            + +R+RGKMRE +F
Sbjct: 594 KSPIRTRGKMREAFF 608

>AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL013W
           (HEX3)
          Length = 557

 Score =  365 bits (936), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/587 (36%), Positives = 315/587 (53%), Gaps = 42/587 (7%)

Query: 11  TPPECSQNDVIEIESDTEDETQVLPGTLEAPDIGQMHGSLVDD--LPSQNNASEVFCNT- 67
           T P  ++N VIEIESD E++ +++    +          LV D  L    +A+  F +  
Sbjct: 2   TDPNAARNAVIEIESDPEEDQRIINQYRQT--------RLVPDRRLNRPRDAANRFVSVS 53

Query: 68  --------EDDDEIQLLGETVLDGNNAAAPRLGNPNINRAESVGVAQIRPHQPSAAGEED 119
                   E DDE++++ E  LD            +++  +    + +  H     G++D
Sbjct: 54  GRVAAAAGEGDDEVEIVNEVYLDDEGPIDSTADFVDLDEQQGPSSSMVINH--DGGGDDD 111

Query: 120 LVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNXXXXXXXXXXXXX 179
           + I+EER   P+F+LNLP G+ L+ISGS  D+P+RRSF+TQ     N             
Sbjct: 112 VAIIEERTTHPTFLLNLPNGQTLRISGSVHDRPLRRSFETQRTARANMLRRAARSAQRL- 170

Query: 180 XXXXXXFLHPSDEEDEGFAYENTDLLPTGVRLRRQXXXXXXXXXXXXXXXLLGTGDDVDD 239
                 F++ +D E       + + LP  V  +RQ                    + + D
Sbjct: 171 ------FMNENDGEPSEREASDREYLPQSVLRQRQQALMQERLQRQREHAR--QHEHIAD 222

Query: 240 PELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLFTVYRGHV 299
           P       Q+++   E+RS F HA+++HE R++L +    +      +L  L+  +R   
Sbjct: 223 P-------QVDALAPELRSIFYHAETLHEVRTMLNASGLGTSAAAMQDLLQLYMQFRSRQ 275

Query: 300 MRSWXXXXXXXXXXXXSGMNTRTTDRTSQAHNLRYSPTLAGIIARTFNPILGHMHMAYEP 359
           + +W            +       D ++    LR +P L    A+  N    ++      
Sbjct: 276 INNWARQRAQEFRHGSAREADHAQDDSASRARLR-NPALN---AQRRNSFTSYVLARSLG 331

Query: 360 GLGTGMAAYNDADEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSGYLQKAAKLPD 419
           G G     +   D+E  TQNII +IQ             YMEDTK +Q  ++ +A +LP+
Sbjct: 332 GFGVWPNDFFGDDDE-VTQNIIDIIQAREERDLDSRKRKYMEDTKSQQQAFVARAQRLPE 390

Query: 420 GYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVGIPDGFQGL 479
           GY ASFD TP+M +++ KNG+ EE+ V DD A   Y+++P CCLCGVELG+GIPD F G+
Sbjct: 391 GYYASFDPTPKMKMTLEKNGKTEEVVVADDLAAKSYVEVPVCCLCGVELGLGIPDDFAGI 450

Query: 480 YEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNAR 539
              DRGVSFE+L +KY+FHCPYQ L+ PS+ADRDLSR+T+VA CGH+FCGRCFARI+NA+
Sbjct: 451 SAVDRGVSFESLVSKYDFHCPYQALAHPSIADRDLSRKTFVAHCGHTFCGRCFARINNAK 510

Query: 540 SFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586
            F++ SKK+L+EL G S+PDNYGP+ CPA+ C  +LR+RGKMREV+F
Sbjct: 511 RFSKISKKRLAELHGPSHPDNYGPRVCPAEGCRGQLRTRGKMREVFF 557

>Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  365 bits (937), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 202/480 (42%), Positives = 276/480 (57%), Gaps = 28/480 (5%)

Query: 120 LVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNXXXXXXXXXXXXX 179
           L I+EER   P   LNLPGGE L+++ +  D P+RRSF+ Q     +             
Sbjct: 155 LTIVEERTTRPRITLNLPGGERLEVNATTTDIPIRRSFEFQ----EDLAASRRQLLRRSA 210

Query: 180 XXXXXXFLHPSDEEDEGFAYENTDLLPTGV-RLRRQXXXXXXXXXXXXXXXLLGTGDDVD 238
                 F+  SDE DE +  E+T  LP  + R RR+               L+     + 
Sbjct: 211 TRARSLFVDRSDENDEDWT-EHTHSLPETIQRARRESHMRMNRRIAERQ--LMAQQQRIS 267

Query: 239 DPE-------LLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHL 291
             E       L S+  +I S+  +VRSAF HA+S+HEFRSILQ+V   + ++ ++EL  L
Sbjct: 268 RDENTSTSFRLQSIRERIQSYTPDVRSAFHHAESLHEFRSILQNVAPVTLQECEEELMAL 327

Query: 292 FTVYRGHVMRSWXXXXXXXXXXXXSGMNTRTTDRTSQA-----HNLRYSPTLAGIIARTF 346
           FT +R  ++++W              ++    +R  +      H   +  ++A  +   F
Sbjct: 328 FTEFRNQLLQNWAIERVRNTQEEALRLHREALERQGRTTGRNFHRGVFRESIANYL--NF 385

Query: 347 NPILGHMHMAYEPGLGTGMAAYNDADEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPK 406
           N   G +       L +G +  NDADEER TQNII MIQ              M  TK +
Sbjct: 386 NGDDGFLSR-----LWSG-SVLNDADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQ 439

Query: 407 QSGYLQKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGV 466
           Q  +  +AA LP+GYSASFDTTP+M + IMKNG+ E + V DD       DIP CCLCG 
Sbjct: 440 QEEFEARAASLPEGYSASFDTTPKMKLDIMKNGKEETIIVTDDDLAKTLDDIPVCCLCGA 499

Query: 467 ELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHS 526
           ELGVGIPD F G+ + DRG+SFE L +KY FHCPYQTL++PSV DRDLS+RT++A CGH+
Sbjct: 500 ELGVGIPDDFTGMSQRDRGISFEGLVSKYKFHCPYQTLARPSVLDRDLSKRTFIASCGHA 559

Query: 527 FCGRCFARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586
           +CGRCFARIDNA+  ++  KKKL++LKG+++PDNYGPK CPA+ C   +RSRGK++EVYF
Sbjct: 560 YCGRCFARIDNAKKKSKTPKKKLAQLKGSAHPDNYGPKLCPAESCKKLIRSRGKLKEVYF 619

>Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  359 bits (922), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/482 (40%), Positives = 276/482 (57%), Gaps = 32/482 (6%)

Query: 120 LVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNXXXXXXXXXXXXX 179
           L I+EER   P   LNLPGGE L+++ +  D P+RRSF+ Q +                 
Sbjct: 155 LTIVEERTTRPRVTLNLPGGERLEVNATTTDMPIRRSFEFQDD----LAVSRRQLLRRSA 210

Query: 180 XXXXXXFLHPSDEEDEGFAYENTDLLPTGV-RLRRQXXXXXXXXXXXXXXXL----LGTG 234
                 F+  SDE DE +  E+TD +P  + R RR+                    + + 
Sbjct: 211 ARARTLFVDRSDENDEEWT-EDTDNVPEAIQRARRESHMRMSRRIAERQLRAQQHRMASN 269

Query: 235 DDVDDP-ELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLFT 293
           ++++      S+  +I ++  ++RSAF HA+S+HEFRSILQ+V   + ++ + EL  LFT
Sbjct: 270 ENMNTSIRFQSIRERIQAYAPDIRSAFYHAESLHEFRSILQNVAPVTLQECEGELMALFT 329

Query: 294 VYRGHVMRSWXXXXXXXXXXXXSGMNTRTTDRTSQAHNLRYSPTLAGIIARTFN------ 347
            +R  +++ W              ++    +R  +A              R F+      
Sbjct: 330 EFRNQLLQDWAIDRVRNTQEEALRLHREALERQERA------------TGRVFHRGPFRE 377

Query: 348 PILGHMHMAYEPGLGT---GMAAYNDADEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTK 404
            I  +++ + E G  T   G    NDADEER TQNII MIQ              M  TK
Sbjct: 378 SITNYLNFSGENGFLTRLWGSPVLNDADEERHTQNIIDMIQEREERERDVVMKNLMSKTK 437

Query: 405 PKQSGYLQKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLC 464
            +Q  +  +AA+LP+GYSASFDTTP+M + IMKN + E +TV DD        IP CCLC
Sbjct: 438 AQQEEFEDRAARLPEGYSASFDTTPKMKLDIMKNDKEETITVTDDDLARTLEVIPVCCLC 497

Query: 465 GVELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCG 524
           GVELGVGIPD F G+ ++DRG+SFE L +KY FHCPYQTL++PS+ DRDLSRRT++A CG
Sbjct: 498 GVELGVGIPDDFIGMNQKDRGISFEGLVSKYKFHCPYQTLARPSMLDRDLSRRTFIAACG 557

Query: 525 HSFCGRCFARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREV 584
           H++CGRCFARIDNA+  ++  KKKL+ L+G+++PDNYGPK CPA+ C   +RSRG+++EV
Sbjct: 558 HAYCGRCFARIDNAKKKSKTPKKKLASLRGSAHPDNYGPKFCPAESCKKPIRSRGRLKEV 617

Query: 585 YF 586
           YF
Sbjct: 618 YF 619

>Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W
           (REAL)
          Length = 630

 Score =  351 bits (900), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/482 (40%), Positives = 278/482 (57%), Gaps = 27/482 (5%)

Query: 120 LVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNXXXXXXXXXXXXX 179
           L I+EER   P   LNLPGGE L+++ +P D P+RRSF+ Q     +             
Sbjct: 161 LTIVEERTARPRITLNLPGGERLEVNATPRDIPIRRSFEFQ----EDLAASRRQLLRRSA 216

Query: 180 XXXXXXFLHPSDEEDEGFAY--ENTDLLPTGV-RLRRQXXXXXXXXXXXXXXXLLGTGDD 236
                 F+  SDE+DE      ENT+ LP  + R RR+               +      
Sbjct: 217 ARARNLFVERSDEDDENDEEWTENTNDLPETIQRARRESHMRMSRRVAERQHRIRAQQQR 276

Query: 237 VDDPE-------LLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELT 289
           +   E       L S+  +I ++  ++RSAF HA+S+HEFRSILQ+V   + ++ + EL 
Sbjct: 277 MVSNENMGTAIRLQSIRERIQAYVPDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELM 336

Query: 290 HLFTVYRGHVMRSWXXXXXXXXXXXXSGMNTRTTDRTSQA-----HNLRYSPTLAGIIAR 344
            LFT +R  ++++W              ++    +   +      H+  Y  +++  +  
Sbjct: 337 ALFTEFRNQLLQNWAIDRVRNTQEEALRLHREALEGQERVAGGALHHGPYRESISSYL-- 394

Query: 345 TFNPILGHMHMAYEPGLGTGMAAYNDADEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTK 404
            FN   G +   +      G    N+ADEER TQNII MIQ              M  TK
Sbjct: 395 NFNGEDGFLTRLW------GGPVLNEADEERHTQNIIDMIQEREERERDVVMKNLMNKTK 448

Query: 405 PKQSGYLQKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLC 464
            +Q  + ++AA LP+GYSASFDTTP+M + IMKNG+ E +TV+DD       D+  CCLC
Sbjct: 449 AQQDEFEERAANLPEGYSASFDTTPKMKLDIMKNGKEETITVLDDDLAKTLEDVSVCCLC 508

Query: 465 GVELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCG 524
           GVELGVGIPD F G+ ++DRG+SFE L ++Y FHCPYQTL++PSV DRDLS+RT+VA CG
Sbjct: 509 GVELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCG 568

Query: 525 HSFCGRCFARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREV 584
           H++CGRC+ARIDNA+  +++ KKKL+ELKG+++PDNYGPK CPA  C   +RSRG+++EV
Sbjct: 569 HTYCGRCYARIDNAKKKSKSPKKKLAELKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEV 628

Query: 585 YF 586
           YF
Sbjct: 629 YF 630

>YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subunit
           of the Slx5-Slx8 SUMO-targeted ubiquitin ligase (STUbL)
           complex, stimulated by SUMO-modified substrates;
           contains a RING domain and two SIMs (SUMO-interacting
           motifs); forms SUMO-dependent nuclear foci, including
           DNA repair centers
          Length = 619

 Score =  350 bits (898), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/477 (40%), Positives = 271/477 (56%), Gaps = 22/477 (4%)

Query: 120 LVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNXXXXXXXXXXXXX 179
           L I+EER   P   LNLPGGE L+++ +  D P+RRSF+ Q     +             
Sbjct: 155 LTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQ----EDLGASRRQLLRRSA 210

Query: 180 XXXXXXFLHPSDEEDEGFAYENTDLLPTGVRLRRQXXXXXXXXXXXXXXXLLGTGDDVDD 239
                 F+  SDE DE +  ++T  LP  ++  R+                +       D
Sbjct: 211 TRARNLFVDRSDENDEDWT-DDTHNLPEAIQRARRESRMRMSRRIAERQRRVQQQRVSSD 269

Query: 240 P------ELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLFT 293
                   L S+  +I S+  ++RSAF  A+S+HEFRSILQ+V   + ++ ++EL  LFT
Sbjct: 270 ENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFT 329

Query: 294 VYRGHVMRSWXXXXXXXXXXXXSGMNTRTTDRTSQ-AHNLRYSPTLAGIIARTFNPILGH 352
            +R  ++++W              ++    +R  + A  + +  TL          I  +
Sbjct: 330 EFRNQLLQNWAIDRVRNTQEEALRLHREALERQERTAGRVFHRGTLR-------ESITNY 382

Query: 353 MHMAYEPGLGTGMA---AYNDADEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSG 409
           ++   E G  + +    A +DADEER TQNII MIQ              M  T+ +Q  
Sbjct: 383 LNFNGEDGFLSRLWSGPALSDADEERHTQNIIDMIQEREERERDVVMKNLMNKTRAQQEE 442

Query: 410 YLQKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELG 469
           +  +AA LP+GYSASFDTTP+M + I KNG+ E + V DD       DIP CCLCG ELG
Sbjct: 443 FEARAASLPEGYSASFDTTPKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELG 502

Query: 470 VGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCG 529
           VGIPD F G+ ++DRGVSFE L +KY FHCPYQTL++PS+ DRDLS+RT++A CGH+FCG
Sbjct: 503 VGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCG 562

Query: 530 RCFARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586
           RCFARIDNA+  ++  KKKL++LKG+++PDNYGPK CPA  C   +RSRG+++EVYF
Sbjct: 563 RCFARIDNAKKKSKMPKKKLAQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619

>NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa]
           {ON} Anc_3.186 YDL013W
          Length = 712

 Score =  341 bits (874), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/503 (37%), Positives = 273/503 (54%), Gaps = 42/503 (8%)

Query: 119 DLVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNXXXXXXXXXXXX 178
           +++ILEER ++P+  LNLPGGE L+I+  P ++P R SF++  N +              
Sbjct: 217 EVMILEERTSTPTVTLNLPGGERLRINADPNERPTRSSFESL-NENIVPLSRRQLLRRAT 275

Query: 179 XXXXXXXFLHPSDEEDEGFAYENTDLLPTGVRLRRQXXXXXXXXXXXXXXXLLG------ 232
                  F H SDE +     +   L  + + +R++                        
Sbjct: 276 RRATNSLFFHGSDENESDNDTDEVSLPASILGMRQRARMMAMQERQRQRQGQGQGHSAPD 335

Query: 233 -TGDDVDDPE----LLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDE 287
            +G+ VD+      L++L  +I+++P +VR AFDHAQS+ EF SI+QSV   ++ +  D+
Sbjct: 336 TSGNSVDNTSTNRNLINLRERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDD 395

Query: 288 LTHLFTVYRGHVMRSWXXXXXXXXXXXXSGMNTRTTDR---TSQAHNLRYSPTLAGIIAR 344
           L  LFT YRG VM  W              +      R   T +A+N  +   LA     
Sbjct: 396 LISLFTQYRGQVMADWTLRRIRQSQRDNERLLRERHARVRSTIRANNRHFGSNLASFF-- 453

Query: 345 TFNPILGHMHMAY---------------------EPGLGTGMAAYNDADEERQTQNIIQM 383
               ++  + + Y                     + G   G   Y   D++  TQNII M
Sbjct: 454 ----LMNQLGLGYGDVGAADDEDDGDYGIGEEDNDTGRAAGAYGYEYEDDDAHTQNIINM 509

Query: 384 IQXXXXXXXXXXXXXYMEDTKPKQSGYLQKAAKLPDGYSASFDTTPRMNISIMKNGQNEE 443
           IQ             +M  TKP+Q G+ ++A  LP+GYS+SF T P++ +++ KNG++E 
Sbjct: 510 IQRREDAERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDET 569

Query: 444 LTVVDDHADALYMDIPACCLCGVELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQT 503
           + + D      +MD+PAC LCGVELGVGIP  F G  ++D GVSFE L +KY+FHCPYQ+
Sbjct: 570 VIMEDVDLAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQS 629

Query: 504 LSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNARSFNRASKKKLSELKGASNPDNYGP 563
           LSKPS  DRDLS++ YVA CGH+FCGRC+ RIDNA+S ++  KKKL+ELKG+S+PDNYGP
Sbjct: 630 LSKPSQLDRDLSQKVYVASCGHTFCGRCYVRIDNAKSKSKLPKKKLAELKGSSHPDNYGP 689

Query: 564 KNCPAKDCNNRLRSRGKMREVYF 586
           K CP   C   LRSRG+MRE+YF
Sbjct: 690 KTCPGPSCKTLLRSRGRMREIYF 712

>NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {ON}
           Anc_3.186 YDL013W
          Length = 613

 Score =  337 bits (863), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/513 (38%), Positives = 273/513 (53%), Gaps = 36/513 (7%)

Query: 92  GNPNINRAESVGVAQIRPHQPSAAGEEDLVILEERNNSPSFVLNLPGGEHLQISGSPLDQ 151
            N  I R  ++ +  I P  P    ++DLVI +ER   P+  LNLPGG+ LQ+  +P DQ
Sbjct: 119 ANATIPRPRTIQI--ITPSPPQQQQDDDLVITQERTMRPTVTLNLPGGQTLQVDATPTDQ 176

Query: 152 PVRRSFQTQGNRHTNXXXXXXXXXXXXXXXXXXXFLHPSDEEDEGFAYENTDLLPTGVRL 211
             R SF+ Q     N                   F H   E D       +  LP  V  
Sbjct: 177 LARSSFEWQ----ENIPLARRQLLRRSTNRANSLFFHDDHESDND---NGSVPLPPNV-- 227

Query: 212 RRQXXXXXXXXXXXXXXXLLGTGDDVDDPELLSLEAQINSFPFEVRSAFDHAQSIHEFRS 271
                                   D  +P +  L  +IN++  +++SAF+HA S+HEF S
Sbjct: 228 --IRLRQRQQQQNREEPPPPPPPQDDANPIMTRLRTRINTYSPDIQSAFNHAHSLHEFTS 285

Query: 272 ILQSVDRQSYEQRQDELTHLFTVYRGHVMRSWXXXXXXXXXXXXSGMNTRTTDRTSQAHN 331
           ILQ+V   + ++  DEL  LFT YR  +M +W            S  N R  +  +   N
Sbjct: 286 ILQNVAPLTLQECGDELLSLFTQYRSQLMVNWATRRVRSSQQNTSSSNHRQRNLRNLRRN 345

Query: 332 --LRYSPTLAGIIARTFNPILGHMHMAYEPGLGTG-------MAAYN---------DADE 373
             LR +P   G     FN  L  + +  + G+  G         AYN         D ++
Sbjct: 346 GALRVTPNANG-----FNVNLARLFLMNQLGINNGNDEDQYFTGAYNSEDDADHNGDDED 400

Query: 374 ERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSGYLQKAAKLPDGYSASFDTTPRMNI 433
           + QTQNII MIQ             +M  TKP+Q  + ++A +LP+ YSA+F+T P M +
Sbjct: 401 DTQTQNIINMIQRREEQEHDTRTKSFMARTKPQQDAFKKRANELPENYSANFNTEPTMKL 460

Query: 434 SIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVGIPDGFQGLYEEDRGVSFEALKA 493
            I KNG+ E + V D+ A   Y+++PAC LCGVELGVGIP  FQG+ + DRG SFE+L +
Sbjct: 461 DIKKNGKEETIIVEDNDAAKNYIEVPACTLCGVELGVGIPKDFQGINDTDRGGSFESLVS 520

Query: 494 KYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNARSFNRASKKKLSELK 553
           KY FHCPYQ+L+KPS  D+DLS+R ++A CGH+FCGRC+ARIDNA+S ++  KK L +LK
Sbjct: 521 KYKFHCPYQSLAKPSQLDKDLSQRVFMASCGHTFCGRCYARIDNAKSKSKLPKKTLKQLK 580

Query: 554 GASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586
           G+S+PDNYGP+ CPA  C + LR + KMREV+F
Sbjct: 581 GSSHPDNYGPRVCPADSCRSLLRVKTKMREVFF 613

>KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {ON}
           Anc_3.186 YDL013W
          Length = 647

 Score =  313 bits (803), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 196/507 (38%), Positives = 271/507 (53%), Gaps = 49/507 (9%)

Query: 120 LVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNXXXXXXXXXXXXX 179
           L I+EER   P+  LNLPGGE LQI+ S  D+P  RSF+ Q                   
Sbjct: 150 LEIIEERTTRPTVTLNLPGGESLQINASDSDRPAHRSFEWQ----DALPEPRRRLLRRSA 205

Query: 180 XXXXXXFLHPSDEE--DEGFAYENTDLLPTGVRLRRQXXXXXXXXXXXXXXXLLGTGDDV 237
                 FL+ SD+E  D     +N   LP+ +R  RQ               +     + 
Sbjct: 206 GRIRSLFLNNSDDENNDTAAGRQNNRYLPSNIRRLRQEEQAQMRQLAQRRRRM-----NE 260

Query: 238 DDPELLS-------LEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTH 290
             PE++S       +  +IN++  ++RSAFDHAQ+IHEF+SIL+++   + +    EL  
Sbjct: 261 QRPEMISGNPRFDEIRNRINAYSPDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELIS 320

Query: 291 LFTVYRGHVMRSWXXXXXXXXXXXXSG-------MNTRTTDRTSQAHNLRY------SPT 337
           L+T YR +++++W            +         + R   R  +   LR+         
Sbjct: 321 LYTEYRSYLLQNWATRRVQNSAAPATAGRARTDGRDRRRRTRNQRLARLRFDMESNEGGL 380

Query: 338 LAGIIARTF-------NPILGHMHMAYEPGLGTG-MAAYND--------ADEERQ-TQNI 380
            A  +AR F       N   G      E G   G M  Y+D         DEE Q TQNI
Sbjct: 381 TANNLARIFLANNGFQNVFDGGDIRDDEDGDYYGYMNEYDDYMGEHGENEDEEAQRTQNI 440

Query: 381 IQMIQXXXXXXXXXXXXXYMEDTKPKQSGYLQKAAKLPDGYSASFDTTPRMNISIMKNGQ 440
           I MIQ             +M +TK ++    +KA  LPDGYSA+FD+TP+  +  MKNG+
Sbjct: 441 INMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDSTPKTVVKAMKNGK 500

Query: 441 NEELTVVDDHA-DALYMDIPACCLCGVELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHC 499
            EE+ V DD A     M++P C LCG ELG+GIPD F+G+ EEDRG+SF+ L +KY  +C
Sbjct: 501 EEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGLSFQFLVSKYKSYC 560

Query: 500 PYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNARSFNRASKKKLSELKGASNPD 559
           PYQ+L+KPS  DR LS+RT+VA+CGH +CGRC ARI NA+  +R  KK+L++L G+S+P+
Sbjct: 561 PYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPKKELAKLIGSSHPE 620

Query: 560 NYGPKNCPAKDCNNRLRSRGKMREVYF 586
           NYGPK CPA +C   LRSRGK+ EVYF
Sbjct: 621 NYGPKKCPADNCKGLLRSRGKLSEVYF 647

>KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 607

 Score =  290 bits (743), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 183/513 (35%), Positives = 250/513 (48%), Gaps = 60/513 (11%)

Query: 116 GEEDLVILEER--NNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNXXXXXXX 173
           G++DL+++EER   +    +L LP G+ LQ+  S  + PV RSFQ Q  R+ N       
Sbjct: 113 GDDDLMLVEERIQESGRPVLLQLPAGQTLQVDASWNELPVGRSFQNQVYRNPNQLRRLRR 172

Query: 174 XXXXXXXXXXXXFLHPSDEEDEGFAYENTDLLPTGVRLRR-----QXXXXXXXXXXXXXX 228
                       + + S   D  F+  + D +P  +   R     Q              
Sbjct: 173 HIDHATAMFMGGY-NQSGTGDSDFSDNDADYIPPDIVNERNQYTMQTRMREQRERQNQMQ 231

Query: 229 XLLGTGDDVDDPELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDEL 288
            L    D+            I+S   ++RS F  +QS+ +FR  L   +      R ++L
Sbjct: 232 RLQRAADET-----------IDSLDPDLRSLFFESQSLSQFREGLARFNFPP--ARLEQL 278

Query: 289 THLFTVYRGHVMRSWXX---XXXXXXXXXXSGMNTRTTDRTSQAH----------NLRYS 335
              +  +R   M+SW               S    RT   T Q H          N  Y 
Sbjct: 279 LGQYRDFRARAMQSWAEGRRTRSMSYQNRNSLRPQRTRSGTQQNHSRGSNGDSRDNALYQ 338

Query: 336 PTLAG----------------------IIARTFNPILGHMHMAYEPGLGTGMAAYNDADE 373
             L G                      II+ T N   G++      G+G     Y D D+
Sbjct: 339 QMLFGMPDDDENMDGNNFTGTTQSLQRIISNTMNRRFGNLPF----GVGPEFGFYEDGDD 394

Query: 374 ERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSGYLQKAAKLPDGYSASFDTTPRMNI 433
              T+ II+MIQ               E TK +Q  Y+ KA  LP+GYSASF+T P M++
Sbjct: 395 AANTELIIRMIQEREERDASTRTKKLNEVTKSQQQKYIDKANSLPEGYSASFNTAPLMSM 454

Query: 434 SIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVGIPDGFQGLYEEDRGVSFEALKA 493
           ++   G+ E + V DD A   Y+D+P C LCGVELGVGIPD ++G+ EED+GVSFEAL++
Sbjct: 455 TMENEGREETVMVTDDVAAKTYIDVPVCVLCGVELGVGIPDDWKGVSEEDKGVSFEALQS 514

Query: 494 KYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNARSFNRASKKKLSELK 553
            Y FHCPYQTL++P++ DRDLSRRTYV+ CGH+FCGRC  RI NAR  +   K KL   +
Sbjct: 515 HYKFHCPYQTLARPTLVDRDLSRRTYVSSCGHTFCGRCQVRIKNARDISAKEKNKLKNSQ 574

Query: 554 GASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586
           G S+PDNYGPK CPA+ CN+ LR +G MREVYF
Sbjct: 575 GPSHPDNYGPKKCPAEGCNSNLRKKGIMREVYF 607

>TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.186
           YDL013W
          Length = 649

 Score =  279 bits (713), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 202/351 (57%), Gaps = 21/351 (5%)

Query: 238 DDPELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLFTVYRG 297
           + P +  L  +IN++P +VRS FDHA +++EF +++QS    + E  + +L  +FT+YRG
Sbjct: 318 ESPIMAELRRRINAYPPDVRSIFDHATTLNEFLALMQSTAPITLEDNRTDLIDIFTLYRG 377

Query: 298 HVMRSWXXXXXXXXXXXXSGMNTRTTDRTSQAHNLRYSPTLAGIIARTFNPILGHMHMAY 357
           ++ ++W            +   + T  R   AH  R+              + G +H   
Sbjct: 378 NLTQNWMINRMNSSRDNSARTASSTPMRNMPAHT-RF--------------VQGFLHSIM 422

Query: 358 EPGLGTGMAAY--NDADEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSGYLQKAA 415
             GLG G   Y   ++DEE  TQNII+MI+              M+ TK +Q  +  KA 
Sbjct: 423 --GLG-GDFPYGGTESDEEATTQNIIRMIEEREANERDSKVKQLMKKTKKQQEDFENKAK 479

Query: 416 KLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVGIPDG 475
            LP G+SASF   P+  ISI  +    E+ V D+     Y ++P CCLCGVELGVGIPD 
Sbjct: 480 YLPKGFSASFSLVPKKIISIDGDDSKREI-VTDEFLAEEYEELPVCCLCGVELGVGIPDS 538

Query: 476 FQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARI 535
           F+G+  E+  VSF++L  KYN  CPY  LS P   DRDLSRRTYVA CGHSFCGRC  RI
Sbjct: 539 FRGITPEESKVSFDSLVKKYNIPCPYNALSAPGDIDRDLSRRTYVASCGHSFCGRCVRRI 598

Query: 536 DNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586
           ++A+   + SK+KL EL G  NPD YGPK CPA DC  +LR +G+MREVYF
Sbjct: 599 NHAKESGKISKQKLKELVGPENPDIYGPKTCPATDCTGKLRRKGQMREVYF 649

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (71%)

Query: 116 GEEDLVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQG 161
           G +DLVI++ER ++P+  L LPG   +QI+ +P D+PVR SF  QG
Sbjct: 193 GADDLVIVQERTSAPTVTLTLPGNRSIQINAAPTDRPVRSSFGWQG 238

>Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa]
           {ON} complement(140685..142460) [1776 nt, 592 aa]
          Length = 591

 Score =  261 bits (666), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 168/477 (35%), Positives = 238/477 (49%), Gaps = 54/477 (11%)

Query: 118 EDLVILEERNNSPS---FVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNXXXXXXXX 174
           +DL+I+ E++  PS     L +PG + +++  +  D P R SF+ Q +R           
Sbjct: 161 DDLIIISEQHPQPSANSIFLTIPGRQLMELQVASTDIPTRSSFEYQNDRR---------- 210

Query: 175 XXXXXXXXXXXFLHPSDEEDEGFAYENTDLLPTGV-RLRRQXXXXXXXXXXXXXXXLLGT 233
                         P    + G    N   +     R+RRQ               LLG 
Sbjct: 211 --------------PVRLGNSGRPRINRQYMQNSFSRVRRQ---------------LLGI 241

Query: 234 GD-DVDDPELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLF 292
                 +PE+  +  +I+ +   +RSAF HA S +EF +I++   R       D+L  L+
Sbjct: 242 LRVRQSNPEIDEIAREISLYHTNIRSAFIHANSFNEFMAIIEVAPRLGI---TDDLVDLY 298

Query: 293 TVYRGHVMRSWXXXXXXXXXXXXSGMNTRTTDRTSQAHNLRYSPTLAGIIARTFN-PILG 351
                   R+                N+ TT R  +  N    P     I  +F+ P++ 
Sbjct: 299 LRLEDLRNRTHQANSLFVPDIDNISSNSETT-RYDEGWNPVTHPVTNRFIEDSFHSPMIR 357

Query: 352 HMHMAYEPGLGTGMAAYNDADEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSGYL 411
            +   Y    G     Y+D DEE +TQ+II MIQ             Y E TK KQ  + 
Sbjct: 358 RIFGNYG---GRHHQDYDDDDEEGRTQSIITMIQEREEVEKDLRTKKYSESTKEKQDEFE 414

Query: 412 QKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVG 471
           ++A +LPDGYS+SF+T P+  + + KNG N  ++VVDD     + +IP CCLCGV L  G
Sbjct: 415 RRATELPDGYSSSFNTEPKAKVDMTKNGVNGSVSVVDDTMAEDWEEIPICCLCGVTLSEG 474

Query: 472 IPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRC 531
           IPD FQG+  EDR + FE LK KY+  CPYQ L +PS +DRD S+R YVA CGH++CGRC
Sbjct: 475 IPDEFQGMSNEDRFLPFEELKEKYDSFCPYQCLIRPSQSDRDFSKRVYVANCGHTYCGRC 534

Query: 532 FARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLR-SRG-KMREVYF 586
           + RI N++  ++  K +L++LKGA +PDNYGPK CP   CN  LR SRG   RE YF
Sbjct: 535 YRRIQNSKEKSKLPKSQLAKLKGACHPDNYGPKKCPVTSCNRLLRISRGVAFREAYF 591

>TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {ON}
           Anc_3.186 YDL013W
          Length = 556

 Score =  249 bits (637), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 186/591 (31%), Positives = 286/591 (48%), Gaps = 65/591 (10%)

Query: 13  PECSQNDVIEIESDTEDETQVLPGTLEAPDIGQMHGSLVDDL-PSQN--NASEVFC--NT 67
           P  + +DVI IESD E  +        + D G    +  D + P+ N  N SEV    ++
Sbjct: 14  PVSNSDDVILIESDDEQHS--------SRDSGLRSSTTRDTMSPNSNGSNQSEVVSRESS 65

Query: 68  EDDDEIQLLGETVLDGNNAAAPRLGNPNINRAESVGVAQIRPHQPSAAGEEDLVILEERN 127
            + D +  +G T    +    P  GN      + + V   R   P  A +++L+ ++E+ 
Sbjct: 66  RNADSVSPMGSTAEYIDLEMEP-AGN---EEQDDMIVYDERLSTPRDAEDDELIFVQEQT 121

Query: 128 NSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQG-NRHTNXXXXXXXXXXXXXXXXXXXF 186
              +  LNLPG   ++I+ +  D+P RRSF+ Q  NR                       
Sbjct: 122 RPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASNRQLRHQTRVARRQPMRRAARRANH 181

Query: 187 LHPSDEEDEGFAYENTDLLPTGVRLRRQXXXXXXXXXXXXXXXLLGTGDDVDDPELLSLE 246
                E D+G    N + +                                 DPE  +++
Sbjct: 182 SMNGYESDDGGLTSNRNQINY-------------------------------DPEFAAIQ 210

Query: 247 AQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLFTVYRGHVMRSWXXX 306
            +++S+P ++RSAF HAQ+++EF SI+++VD  +++  + +L  LF  YR  + R     
Sbjct: 211 RRLDSYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYRRMMAR----- 265

Query: 307 XXXXXXXXXSGMNTRTTDRTSQAHNLRYSPTLAGIIARTFNPILGHMHMAYEPGL-GTGM 365
                     G  +        A  LR    L   I           H   EPG+ G G 
Sbjct: 266 RAAQIGQNMPGYRSPPNRTQGNADLLRRLGPLGVRIGIGTGMGESLTHYILEPGIFGYGS 325

Query: 366 -------AAYNDA-DEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSGYLQKAAKL 417
                    ++D  +EE +TQ+I+  IQ              ME T+ ++  +++K   L
Sbjct: 326 FRMIGNPGGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNL 385

Query: 418 PDGYSASFDTTPR-MNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVGIPDGF 476
           P+GYSASFDTTP  + +  + +G  + + V D+ A A + +I  CCLCGVELGVG+PD F
Sbjct: 386 PEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDF 445

Query: 477 QGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARID 536
            G+  +DR +SF+ L  KY  HCPYQ+L+  +  +R LS +T+VA CGH+FCGRC  RI+
Sbjct: 446 TGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIE 505

Query: 537 NARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLR-SRGKMREVYF 586
           NAR+ +++SKK+LS+ KG  +PDNYGP+ CPA  C   +R  R KMRE +F
Sbjct: 506 NARTHSKSSKKELSKFKGPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556

>KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3.186
           YDL013W
          Length = 547

 Score =  215 bits (548), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 131/356 (36%), Positives = 194/356 (54%), Gaps = 21/356 (5%)

Query: 238 DDPELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLFTVYRG 297
           +DP+   + A+INS+P  ++S F +AQS+ EF  I+Q+ D  ++ + +D+LT+LF+ Y+ 
Sbjct: 206 EDPQRRRIRARINSYPPNIQSTFHYAQSLPEFTYIVQNTDPITFAECRDDLTNLFSQYQS 265

Query: 298 HV----MRSWXXXXXXXXXXXXSGMNTRTTDRTSQAHNLRYSPTL---AGIIARTFNPIL 350
                 MR+              G N       S ++N  + P         AR    +L
Sbjct: 266 MQHDDRMRN-VGQQGSRQSEPRHGTNYSQRSAVSHSNNRYFYPEFNQYESDEARA-QSLL 323

Query: 351 GHMHMAYEPGLGTGMAAYNDADEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSGY 410
             +H      L   +  Y + DEE  TQNII MIQ             + + +KP     
Sbjct: 324 PRIH----DFLQMRLMGYPNDDEETTTQNIISMIQEREDTERDTRVKNFTDKSKPLLKSI 379

Query: 411 LQKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGV 470
           L++A  LP  YSASF      +   +  G   E         A   ++  C LCG ELGV
Sbjct: 380 LKEAKSLPSNYSASFHYPSSPSKPQIPGGSTSET--------AESEEVSCCVLCGSELGV 431

Query: 471 GIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGR 530
           GIPD F G   EDR + F +L +KY+F CPYQ+L +P+  DRDLS+RT++++CGH +CGR
Sbjct: 432 GIPDSFIGRSAEDRDLDFSSLISKYSFPCPYQSLIRPNQLDRDLSKRTFMSKCGHVYCGR 491

Query: 531 CFARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586
           CFARIDNA++ ++ SKK+L+ LKG SNP+ YGP+ C A  C   +R++ ++RE+YF
Sbjct: 492 CFARIDNAKAKSKISKKELASLKGCSNPNIYGPRICVADGCTAVIRAKARLRELYF 547

>CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013w Hexose metabolism-related protein
          Length = 506

 Score =  186 bits (472), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 137/226 (60%), Gaps = 12/226 (5%)

Query: 362 GTGMAAYNDADEERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSGYLQKAAKLPDGY 421
           GT +    D DEE QTQ+II +IQ             Y   ++ ++  + ++A +LP GY
Sbjct: 292 GTPITGSED-DEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGY 350

Query: 422 SASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVGIPDGFQGLYE 481
           SASF T       +++   +E+ +  DD  D +      C LCGVELG+GIP+ F G+ +
Sbjct: 351 SASFATP-----EVIRENDDEDNSNNDDDEDMI-----VCNLCGVELGIGIPEEFTGISK 400

Query: 482 EDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNARSF 541
           ED  +SF  L  KY   CPYQ+L KPS  DRDLS+RTYV+ CGH FCGRC+ R  NARS 
Sbjct: 401 EDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSL 460

Query: 542 NRASKKKLSELK-GASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586
            +    K   +K GAS+PDN+ PK CPA +C  ++RS+GKMREVYF
Sbjct: 461 MKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 117 EEDLVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQ 158
           E+ + +LEER       LNLPGG  + ++ +  + PVR SF+
Sbjct: 115 EDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFE 156

>TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.186
           YDL013W
          Length = 664

 Score =  181 bits (460), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 137/240 (57%), Gaps = 27/240 (11%)

Query: 374 ERQTQNIIQMIQXXXXXXXXXXXXXYMEDTKPKQSGYLQKAAKLPDGYSASFDT-TPRMN 432
           E++TQ++I MIQ             + +  +  Q    +KA  +P+GYS+SF T  P   
Sbjct: 425 EQETQDLIAMIQEREEREHDIRTRKFTKKNEKLQQLIREKAKTIPEGYSSSFSTEVPVKL 484

Query: 433 ISIM-KNGQN-----EELTVVDDH----ADALYMDIPACCLCGVELGVGIPDGFQGLYEE 482
           I    KNG N     E+   VDD      +   +++P CCLCGVELG+GIP+ F G+  E
Sbjct: 485 IDKQDKNGNNVIMLEEQQVEVDDEFGNKKNESVIEVPVCCLCGVELGIGIPETFAGISAE 544

Query: 483 DRGVS-FEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNARSF 541
           D+ +  F+ +  KY F CPYQT+ +P+  DRDLSRRT+++ CGH+FCGRC+ RI  A++ 
Sbjct: 545 DKKLECFKDIATKYGFSCPYQTMVRPTELDRDLSRRTFISNCGHAFCGRCYNRIHLAKAE 604

Query: 542 NRASK-----KKLSELK----------GASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586
            + +       KL+ L           G+ NPDNYGPK CP  DC  ++R+R KMRE YF
Sbjct: 605 TKKNNGRDITNKLTRLSQSNRISPVILGSLNPDNYGPKICPGSDCKYQIRARTKMREAYF 664

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 96  INRAESVGVAQIRPHQPSAAG---EEDLVIL-EERNNSPSFVLNLPGGEHLQISGSPLDQ 151
           IN  E V + +  P   S A    ++DL+I+ E+   +P  +LNLPGG   ++S +  D 
Sbjct: 89  INEREVVDLDR-EPEITSVANNTNDDDLMIVGEQVIENPHILLNLPGGRTFELSTTTNDL 147

Query: 152 PVRRSFQTQGN 162
           P R SF+   N
Sbjct: 148 PFRSSFEMLQN 158

>Suva_11.249 Chr11 complement(455625..457280) [1656 bp, 551 aa] {ON}
           YKR017C (REAL)
          Length = 551

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 50/140 (35%), Gaps = 39/140 (27%)

Query: 466 VELGVGIPDGFQGLYEEDRGVSFEALKAKY--NFHCPYQTLSKPSVADRDLSRRTYVAQC 523
           VELG+      +    ED+G S  + K ++  +F C     SK +         T+  +C
Sbjct: 148 VELGLSTVASVK----EDKGYSLHSRKVEFKDDFACVICCESKNT--------ETFALEC 195

Query: 524 GHSFCGRCF-----------------------ARIDNARSFNRASKKKL--SELKGASNP 558
           GH +C  C+                         +D  +    AS  KL  S +K     
Sbjct: 196 GHEYCINCYRHYIQDKLHEGNIITCMDCSLALKNVDIDKVMGHASSSKLMDSSIKSFVQK 255

Query: 559 DNYGPKNCPAKDCNNRLRSR 578
            N   K CP  DC + +  R
Sbjct: 256 HNRNYKWCPFADCKSIIHLR 275

>Ecym_6331 Chr6 complement(634459..636111) [1653 bp, 550 aa] {ON}
           similar to Ashbya gossypii AFR104W
          Length = 550

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 40/119 (33%), Gaps = 32/119 (26%)

Query: 488 FEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFAR------------- 534
           F  LK +  F CP    S  ++       +T+  +CGH +C  C+               
Sbjct: 166 FSRLKTRDGFVCPICCESSETM-------KTFSLECGHEYCLTCYQHYISDKLNVGNIIK 218

Query: 535 ------------IDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKM 581
                       ID       ++K  LS +KG     +   K CP  DC   +  +  M
Sbjct: 219 CMNCELALKNDDIDIIMGEGSSTKLMLSSIKGFIQKHSQYYKWCPFTDCKYVIHVKNTM 277

>Kwal_27.11138 s27 (659056..662943) [3888 bp, 1295 aa] {ON} YGL092W
           (NUP145) - nuclear pore protein [contig 31] FULL
          Length = 1295

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 8/91 (8%)

Query: 69  DDDEIQLLG-ETVLDGNNAAAPRLGNPNINRAESVGVAQIRPHQPSAAGEEDLVILEERN 127
           DD++I + G E+ ++  N  AP         A+ + V   +P++PS    EDL  +E + 
Sbjct: 624 DDEDIAISGDESRVENQNFGAPSTTALLAEDADMIDVLDEKPYEPSDVSSEDLEGIEVKT 683

Query: 128 NSPSFVLNLPGG--EHLQISGSPLDQPVRRS 156
           +S     N PG     LQI+G   +   R S
Sbjct: 684 SS-----NTPGNWTTQLQIAGESYNSVFRFS 709

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,958,369
Number of extensions: 2509793
Number of successful extensions: 6514
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6636
Number of HSP's successfully gapped: 41
Length of query: 586
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 471
Effective length of database: 40,294,809
Effective search space: 18978855039
Effective search space used: 18978855039
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)