Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E15862gna 1ON36836816930.0
Kwal_27.9830na 1ON36936911671e-160
SAKL0C07986gna 1ON3813629101e-120
KLLA0C04433gna 1ON3673557781e-101
Ecym_5262na 1ON3543246924e-88
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E15862g
         (368 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E15862g Chr5 complement(1406851..1407957) [1107 bp, 368 aa]...   656   0.0  
Kwal_27.9830 s27 (76603..77712) [1110 bp, 369 aa] {ON} [contig 4...   454   e-160
SAKL0C07986g Chr3 (742551..743696) [1146 bp, 381 aa] {ON} conser...   355   e-120
KLLA0C04433g Chr3 (405523..406626) [1104 bp, 367 aa] {ON} conser...   304   e-101
Ecym_5262 Chr5 (544088..545152) [1065 bp, 354 aa] {ON} similar t...   271   4e-88

>KLTH0E15862g Chr5 complement(1406851..1407957) [1107 bp, 368 aa]
           {ON} conserved hypothetical protein
          Length = 368

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/368 (88%), Positives = 325/368 (88%)

Query: 1   MGQLFIPXXXXXXXXXXXXNSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMSM 60
           MGQLFIP            NSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMSM
Sbjct: 1   MGQLFIPVICIGVVVCGGVNSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMSM 60

Query: 61  LALWWFQLRGTGRQQHEFDNKPLIKGRSYVLLALPAICDIIATTLMNLALVMIPVSIYQM 120
           LALWWFQLRGTGRQQHEFDNKPLIKGRSYVLLALPAICDIIATTLMNLALVMIPVSIYQM
Sbjct: 61  LALWWFQLRGTGRQQHEFDNKPLIKGRSYVLLALPAICDIIATTLMNLALVMIPVSIYQM 120

Query: 121 VRGAIXXXXXXXXXXXXGRQVCRLEWAYLATIVAGVAVVGYSGQSADTVSEQXXXXXXXX 180
           VRGAI            GRQVCRLEWAYLATIVAGVAVVGYSGQSADTVSEQ        
Sbjct: 121 VRGAIVFFVALFSVLFLGRQVCRLEWAYLATIVAGVAVVGYSGQSADTVSEQSFSSSLLV 180

Query: 181 XXXXXXXXXXXMATQFIVEEHVMSRWAVSPVGLIGHEGLFGSSITVALLVVGNYMGGYRD 240
                      MATQFIVEEHVMSRWAVSPVGLIGHEGLFGSSITVALLVVGNYMGGYRD
Sbjct: 181 GVLLILFALLFMATQFIVEEHVMSRWAVSPVGLIGHEGLFGSSITVALLVVGNYMGGYRD 240

Query: 241 VNSTFNMKQAFSDMFARPAVLNSSFVIMVSIALFNFFGVSITKNVSATSRSTVDTCRTLL 300
           VNSTFNMKQAFSDMFARPAVLNSSFVIMVSIALFNFFGVSITKNVSATSRSTVDTCRTLL
Sbjct: 241 VNSTFNMKQAFSDMFARPAVLNSSFVIMVSIALFNFFGVSITKNVSATSRSTVDTCRTLL 300

Query: 301 VWCVSLSLGWESFKFTQLCGFALLVIGTLLFNNAIEIPDKYLPSYFLEDKSGESQRLINT 360
           VWCVSLSLGWESFKFTQLCGFALLVIGTLLFNNAIEIPDKYLPSYFLEDKSGESQRLINT
Sbjct: 301 VWCVSLSLGWESFKFTQLCGFALLVIGTLLFNNAIEIPDKYLPSYFLEDKSGESQRLINT 360

Query: 361 IDEEVERF 368
           IDEEVERF
Sbjct: 361 IDEEVERF 368

>Kwal_27.9830 s27 (76603..77712) [1110 bp, 369 aa] {ON} [contig 43]
           FULL
          Length = 369

 Score =  454 bits (1167), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 239/369 (64%), Positives = 268/369 (72%), Gaps = 1/369 (0%)

Query: 1   MGQLFIPXXXXXXXXXXXXNSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMSM 60
           M +L+I             NSL TKYQDNQCVRDC G +P+YFNQPVLQTLQMFIGEM+M
Sbjct: 1   MSRLYIASICVGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEMAM 60

Query: 61  LALWWFQLRGTGRQQHEFDNKPLIKGRSYVLLALPAICDIIATTLMNLALVMIPVSIYQM 120
           LA    Q R     +  F  KP I  + Y+LLALPA+CDIIATTLMN ALVMIPVSIYQM
Sbjct: 61  LAFLRGQQRSKLPLEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIPVSIYQM 120

Query: 121 VRGAIXXXXXXXXXXXXGRQVCRLEWAYLATIVAGVAVVGYSGQSADTVSEQXXXXXXXX 180
            RGAI             R+V R EWA LA IVAGVAVVGYSGQ  + +SE+        
Sbjct: 121 TRGAIVFFVALFSVVFLHRRVTRFEWASLAIIVAGVAVVGYSGQEDEVLSEEVISTSSVF 180

Query: 181 XXXXXXXXXXXMATQFIVEEHVMSRWAVSPVGLIGHEGLFGSSITVALLVVGNYMGGYRD 240
                      MATQFIVEEH++SRW ++PVGL+G EG FG+SIT+A L+VGN  GG R+
Sbjct: 181 GISLILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTSITLAFLLVGNVAGGNRN 240

Query: 241 VNSTFNMKQAFSDMFARPAVLNSSFVIMVSIALFNFFGVSITKNVSATSRSTVDTCRTLL 300
            NS+FNMKQAF DM+   AVL SS +IM+SIALFNF GVSITK+VSATSRSTVDTCRTLL
Sbjct: 241 KNSSFNMKQAFMDMYEHSAVLISSIIIMISIALFNFTGVSITKHVSATSRSTVDTCRTLL 300

Query: 301 VWCVSLSLGWESFKFTQLCGFALLVIGTLLFNNAIEIPDKYLPSYFLEDKS-GESQRLIN 359
           VWCVSL LGWESFKF QLCGF LLV+GTLLFN AIEIP KYLP YF ED S GE QRLI+
Sbjct: 301 VWCVSLILGWESFKFMQLCGFVLLVLGTLLFNGAIEIPPKYLPRYFKEDSSEGERQRLID 360

Query: 360 TIDEEVERF 368
           TIDEEVERF
Sbjct: 361 TIDEEVERF 369

>SAKL0C07986g Chr3 (742551..743696) [1146 bp, 381 aa] {ON} conserved
           hypothetical protein
          Length = 381

 Score =  355 bits (910), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 238/362 (65%), Gaps = 13/362 (3%)

Query: 20  NSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMSMLALWWFQ-LRGTGRQQHEF 78
           NS+ +KYQDNQCVRDC G  PV F QPVLQTLQMFIGE S+  +   + + G G  +   
Sbjct: 20  NSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSVFVVLLLRVIAGGGSPRPRS 79

Query: 79  DNKPLIKGRSYVLLALPAICDIIATTLMNLALVMIPVSIYQMVRGAIXXXXXXXXXXXXG 138
             KP + G   +LLALPA+CDI ATTLMN+AL MIPVS+YQM RGA+            G
Sbjct: 80  VEKPPLPGNRVLLLALPAVCDICATTLMNVALTMIPVSVYQMTRGALIIFVAMFSIVFLG 139

Query: 139 RQVCRLEWAYLATIVAGVAVVGYSGQSA------------DTVSEQXXXXXXXXXXXXXX 186
            ++ RLEW  L  +V GV +VG +G S              +V+                
Sbjct: 140 HRISRLEWCSLFVVVLGVTIVGCNGGSGSDGGSGGNNSLLSSVATARLSSSLFAGVFLIL 199

Query: 187 XXXXXMATQFIVEEHVMSRWAVSPVGLIGHEGLFGSSITVALLVVGNYMGGYRDVNSTFN 246
                MA+QF++EEH+MSRW + PV L+G EG+FG SIT+A++++G+      + +S FN
Sbjct: 200 IAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGSITLAVMLLGHLTFASGNPHSPFN 259

Query: 247 MKQAFSDMFARPAVLNSSFVIMVSIALFNFFGVSITKNVSATSRSTVDTCRTLLVWCVSL 306
           + QAF+DMFA P VL SS  IM SIA FNFFG+SIT +V+AT+RST+DTCRTL+VWCVSL
Sbjct: 260 VVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITNSVNATARSTIDTCRTLMVWCVSL 319

Query: 307 SLGWESFKFTQLCGFALLVIGTLLFNNAIEIPDKYLPSYFLEDKSGESQRLINTIDEEVE 366
           S+GWESFKF QL GF LL++GTL+FN AI++  + LP +  ED   + +RLI+ +DEEV+
Sbjct: 320 SIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLPRFLAEDYPQDYERLIDVVDEEVD 379

Query: 367 RF 368
           RF
Sbjct: 380 RF 381

>KLLA0C04433g Chr3 (405523..406626) [1104 bp, 367 aa] {ON} conserved
           hypothetical protein
          Length = 367

 Score =  304 bits (778), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/355 (50%), Positives = 224/355 (63%), Gaps = 13/355 (3%)

Query: 20  NSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMSMLALWWFQLRGTGRQQHEFD 79
           NS+ TKYQDNQCVRDC   SPV F QPVLQTLQMFIGE+S++ + ++Q +   R  +E  
Sbjct: 20  NSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISLMFVMFWQ-KYNSRNGYEAV 78

Query: 80  ------NKPLIKGRSYVLLALPAICDIIATTLMNLALVMIPVSIYQMVRGAIXXXXXXXX 133
                 NK  +  R    LALPAICDI  TTLMNLAL MIPVSIYQM RG +        
Sbjct: 79  PSAESLNKTKLPSRQSYALALPAICDICGTTLMNLALTMIPVSIYQMTRGVLILFVALFS 138

Query: 134 XXXXGRQVCRLEWAYLATIVAGVAVVGYSGQSADTVSEQXXXXXXXXXXXXXXXXXXXMA 193
                 ++ R EW  L  +V GV +VGYSG    TV                       A
Sbjct: 139 VFFLKHKISRFEWLSLFIVVFGVFLVGYSGNVGVTVD-----VSLVTGVLLIVLAQVCTA 193

Query: 194 TQFIVEEHVMSRWAVSPVGLIGHEGLFGSSITVALLVVGNYMGGYRDVNSTFNMKQAFSD 253
           TQF++EEH+MS+W + P  L+  EG++G+SIT+  +++ +        NS+FN+  +  D
Sbjct: 194 TQFVLEEHIMSKWIIPPSTLVAFEGIYGASITLLTMLIASVTFAQNKQNSSFNIVYSLQD 253

Query: 254 MFARPAVLNSSFVIMVSIALFNFFGVSITKNVSATSRSTVDTCRTLLVWCVSLSLGWESF 313
           MF  P VL SS +IM+SIA FNFFG+++T +++AT RST+DTCRTLLVW VSLSLGWESF
Sbjct: 254 MFVNPRVLYSSIIIMISIACFNFFGITLTNSMNATVRSTIDTCRTLLVWLVSLSLGWESF 313

Query: 314 KFTQLCGFALLVIGTLLFNNAIEIPDKYLPSYFLEDKSGESQRLINTIDEEVERF 368
           K TQ  GF LLV+GTLLFN AI I  K LP +  +D  G+  R+IN IDEEVERF
Sbjct: 314 KLTQFNGFVLLVLGTLLFNGAITIDKKRLPQWLTKDYPGD-DRIINVIDEEVERF 367

>Ecym_5262 Chr5 (544088..545152) [1065 bp, 354 aa] {ON} similar to
           KLLA0C04433g - Kluyveromyces lactis
          Length = 354

 Score =  271 bits (692), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 142/324 (43%), Positives = 203/324 (62%), Gaps = 6/324 (1%)

Query: 20  NSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMSMLALWWFQLRGTGRQQHEFD 79
           NS+ TKYQD QCVR+C   SP    QPVLQT+QMF+GE S  AL+ F L G   +     
Sbjct: 20  NSIATKYQDKQCVRNCLTDSPELLQQPVLQTVQMFLGEAS--ALFAFYLLGA--RPSTSV 75

Query: 80  NKPLIKGRSYVLLALPAICDIIATTLMNLALVMIPVSIYQMVRGAIXXXXXXXXXXXXGR 139
            K L++ ++ VLL++PA+CDI  TT+M+LAL ++PVSIYQMVRG++             +
Sbjct: 76  TKFLLQNKNTVLLSIPAVCDICGTTMMHLALTLVPVSIYQMVRGSLVIVVATFSVVFLNK 135

Query: 140 QVCRLEWAYLATIVAGVAVVGYSGQSADTVSEQXXXXXXXXXXXXXXXXXXXMATQFIVE 199
           ++ R EW  L T++ G+ +VG +G   D  +                     MA Q+++E
Sbjct: 136 KLTRGEWLSLYTVMFGIGIVGLTG--FDDWNSDKPAANTLLGITLILVAQLFMAAQYVIE 193

Query: 200 EHVMSRWAVSPVGLIGHEGLFGSSITVALLVVGNYMGGYRDVNSTFNMKQAFSDMFARPA 259
           EH++SR+    + ++G EGLFG +IT+  L++G +   ++D +S  N+ Q   D+     
Sbjct: 194 EHLISRYPFDSLEVVGFEGLFGGAITLFFLLLGTFTIAWKDPSSPLNLFQGLKDVSYSGN 253

Query: 260 VLNSSFVIMVSIALFNFFGVSITKNVSATSRSTVDTCRTLLVWCVSLSLGWESFKFTQLC 319
           ++ SSF IM+SIA +NFFG++IT +++ATSRST+DT RTLLVW VSL LGWE F F QL 
Sbjct: 254 LMVSSFTIMISIAFYNFFGIAITNHMNATSRSTIDTSRTLLVWLVSLILGWERFSFLQLI 313

Query: 320 GFALLVIGTLLFNNAIEIPDKYLP 343
           GFAL V+GTL+FN AI   +  +P
Sbjct: 314 GFALSVVGTLIFNGAISFANYQVP 337

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,293,055
Number of extensions: 1086012
Number of successful extensions: 2957
Number of sequences better than 10.0: 6
Number of HSP's gapped: 3012
Number of HSP's successfully gapped: 6
Length of query: 368
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 257
Effective length of database: 40,753,473
Effective search space: 10473642561
Effective search space used: 10473642561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)