Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E13948g3.454ON43843823660.0
Kwal_27.123173.454ON43543414760.0
Ecym_24653.454ON43841113430.0
SAKL0B06116g3.454ON43139613230.0
ZYRO0C06270g3.454ON43039112781e-174
ABL019W3.454ON43138812651e-172
Kpol_1035.93.454ON42738912591e-171
KNAG0B009503.454ON41838312571e-171
YGR110W (CLD1)3.454ON44542812321e-167
Smik_6.2003.454ON44542812041e-163
Skud_7.4153.454ON45244212021e-162
TDEL0F033903.454ON42439011961e-162
NCAS0E008603.454ON44040211921e-161
Suva_7.3953.454ON45140611891e-160
KAFR0I019703.454ON41141811801e-160
NDAI0G010903.454ON45639511471e-154
TPHA0O013103.454ON43838011081e-148
CAGL0L04686g3.454ON45141410691e-142
KLLA0B12914g3.454ON4264249821e-130
TBLA0F034603.454ON4414099241e-121
KLTH0C01254gna 1ON4344144931e-56
Ecym_5577singletonON4334054782e-54
SAKL0G19074gna 1ON4324294661e-52
Kwal_14.985na 1ON4354244591e-51
Skud_12.1678.284ON3943331852e-14
YLR099C (ICT1)8.284ON3943291843e-14
Skud_4.3868.284ON4463321828e-14
Suva_10.1838.284ON3943331801e-13
Kwal_56.237028.284ON4163421731e-12
Smik_12.1588.284ON3943251721e-12
TDEL0F041008.284ON4343391712e-12
Suva_2.2888.284ON4353321702e-12
Kpol_543.498.284ON4293931684e-12
NCAS0B051208.284ON3963501632e-11
Smik_4.3718.284ON4353391588e-11
ZYRO0D06666g8.284ON3803301579e-11
KLLA0F19624g8.284ON4093331561e-10
SAKL0H16500g8.284ON4193241561e-10
TPHA0A016908.284ON4054461533e-10
KAFR0B028308.284ON3913631507e-10
AGR062C8.284ON3843161481e-09
YDR125C (ECM18)8.284ON4533281472e-09
KLTH0G13178g8.284ON4153361472e-09
CAGL0M11462g8.284ON3863561391e-08
KNAG0H031208.284ON4343231392e-08
KNAG0G021408.284ON4083441373e-08
NDAI0J01200singletonON4273421284e-07
Ecym_42858.284ON4053381267e-07
KAFR0B053808.284ON4113431241e-06
NDAI0J012108.284ON4163411241e-06
NCAS0B037108.284ON4303241212e-06
CAGL0B01969g8.284ON4233231213e-06
KNAG0A037708.524ON3562201114e-05
TPHA0L016008.524ON372117970.002
NDAI0C054308.524ON362114970.002
TBLA0H014008.284ON421199920.010
ZYRO0F09064g8.524ON349116880.025
TBLA0H035408.524ON378139850.059
CAGL0M05467g8.524ON354117840.086
SAKL0H10450g8.524ON392118810.18
KAFR0A011308.505ON43785800.24
NCAS0B022608.524ON363153780.46
AAL030C1.389ON153985790.50
Suva_4.4598.524ON375142751.0
KLTH0E12188g8.524ON336114741.3
ZYRO0B07018g3.73ON93488751.4
Kwal_43.16490singletonON28694713.1
Kwal_26.9628singletonON25494703.3
YOR084W (LPX1)5.693ON38753713.5
Kwal_26.6639singletonON30394703.6
Kwal_48.19391singletonON18394684.0
Kwal_23.6592singletonON16494684.4
KLLA0A10395gna 2ON29456687.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E13948g
         (438 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   915   0.0  
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   573   0.0  
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   521   0.0  
SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   514   0.0  
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   496   e-174
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   491   e-172
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   489   e-171
KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   488   e-171
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   479   e-167
Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   468   e-163
Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   467   e-162
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   465   e-162
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    463   e-161
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   462   e-160
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              459   e-160
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    446   e-154
TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   431   e-148
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   416   e-142
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   382   e-130
TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              360   e-121
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   194   1e-56
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   188   2e-54
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   184   1e-52
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...   181   1e-51
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    76   2e-14
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    75   3e-14
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    75   8e-14
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    74   1e-13
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    71   1e-12
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    71   1e-12
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    70   2e-12
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    70   2e-12
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    69   4e-12
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    67   2e-11
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    65   8e-11
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    65   9e-11
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    65   1e-10
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    65   1e-10
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    64   3e-10
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    62   7e-10
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    62   1e-09
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    61   2e-09
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    61   2e-09
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    58   1e-08
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    58   2e-08
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    57   3e-08
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              54   4e-07
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    53   7e-07
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    52   1e-06
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    52   1e-06
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     51   2e-06
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    51   3e-06
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    47   4e-05
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    42   0.002
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    42   0.002
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    40   0.010
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    39   0.025
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    37   0.059
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    37   0.086
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    36   0.18 
KAFR0A01130 Chr1 (219445..220758) [1314 bp, 437 aa] {ON} Anc_8.5...    35   0.24 
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    35   0.46 
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    35   0.50 
Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON...    33   1.0  
KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} simi...    33   1.3  
ZYRO0B07018g Chr2 complement(551747..554551) [2805 bp, 934 aa] {...    33   1.4  
Kwal_43.16490 s43 (51..911) [861 bp, 286 aa] {ON} YNR064C - Hypo...    32   3.1  
Kwal_26.9628 s26 (1300688..1301449) [762 bp, 254 aa] {ON} YNR064...    32   3.3  
YOR084W Chr15 (480587..481750) [1164 bp, 387 aa] {ON}  LPX1Oleic...    32   3.5  
Kwal_26.6639 s26 complement(252..1163) [912 bp, 303 aa] {ON} YNR...    32   3.6  
Kwal_48.19391 s48 (3319..3870) [552 bp, 183 aa] {ON} YNR064C - H...    31   4.0  
Kwal_23.6592 s23 (1658078..1658572) [495 bp, 164 aa] {ON} [conti...    31   4.4  
KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {O...    31   7.0  

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/438 (100%), Positives = 438/438 (100%)

Query: 1   MPTISDLQIYKAASLFRSAFSQVVGIQPKVRKPAFPCNSESASNPSITCRPSSPSAIPLR 60
           MPTISDLQIYKAASLFRSAFSQVVGIQPKVRKPAFPCNSESASNPSITCRPSSPSAIPLR
Sbjct: 1   MPTISDLQIYKAASLFRSAFSQVVGIQPKVRKPAFPCNSESASNPSITCRPSSPSAIPLR 60

Query: 61  ELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDE 120
           ELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDE
Sbjct: 61  ELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDE 120

Query: 121 QANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPG 180
           QANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPG
Sbjct: 121 QANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPG 180

Query: 181 YGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALY 240
           YGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALY
Sbjct: 181 YGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALY 240

Query: 241 ANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLT 300
           ANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLT
Sbjct: 241 ANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLT 300

Query: 301 SGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERR 360
           SGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERR
Sbjct: 301 SGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERR 360

Query: 361 LFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFD 420
           LFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFD
Sbjct: 361 LFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFD 420

Query: 421 NYEQFNRILEKEMKMWDQ 438
           NYEQFNRILEKEMKMWDQ
Sbjct: 421 NYEQFNRILEKEMKMWDQ 438

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/434 (61%), Positives = 327/434 (75%)

Query: 1   MPTISDLQIYKAASLFRSAFSQVVGIQPKVRKPAFPCNSESASNPSITCRPSSPSAIPLR 60
           MPT  DLQ  +  ++ RSA  Q+  +Q +  +           N S   +PSSPSAIPL 
Sbjct: 1   MPTFGDLQSSRVIAVIRSAADQLSNLQLRRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLN 60

Query: 61  ELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDE 120
           E+++ LP LFPRS+++S RD+  F+ +AG LQ +LL+TLPFFP     + AE+++T VD 
Sbjct: 61  EIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDA 120

Query: 121 QANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPG 180
           Q NYINEF +RP     S T++HLI+VHGYGAGLGFFLK  E LNLI+  W+IHAIDLPG
Sbjct: 121 QGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPG 180

Query: 181 YGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALY 240
           YGFSSRP FP+K      AQVE WFH+RF  W+E+RGLL+ PE NM+VAHSMGAYL ALY
Sbjct: 181 YGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALY 240

Query: 241 ANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLT 300
           ANK+P HFKKLVMCSPAG+C++    ++R PPWWFAKLWD+NISPFSLVRN+ +LGSKLT
Sbjct: 241 ANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLT 300

Query: 301 SGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERR 360
           SGWSYRR GQLL +    A+Q EA+H+YAYAIFN  GSGEYLLSFAL+CGG+PR  LERR
Sbjct: 301 SGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERR 360

Query: 361 LFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFD 420
           LFHN+  QFKA CEWLWLYGDQDW+D  GG RVS FL   MG +S V++V +SGHHLY D
Sbjct: 361 LFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLD 420

Query: 421 NYEQFNRILEKEMK 434
           N+  FN+ILE EM+
Sbjct: 421 NHRMFNKILEDEMR 434

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/411 (59%), Positives = 306/411 (74%), Gaps = 10/411 (2%)

Query: 27  QPKVRKPAFPCNSESASNPSITCRPSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRK 86
           Q  + +  +  N  S ++P    +P+ P+AIPL E+++N+P LFP  +KES +DY  F  
Sbjct: 23  QFSIERNKYGANMSSFTSP----KPTPPTAIPLMEILLNIPSLFPMPLKESWKDYKIFHD 78

Query: 87  DAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMP--HPSGT-LRH 143
           D    Q  LLSTLPFFP A D K+ E+++TPVDE+ NYINEFC+RP  P  +P  + + H
Sbjct: 79  DVDKFQTGLLSTLPFFPSAADGKIGEIIRTPVDEEGNYINEFCIRPNSPPVNPKDSKMHH 138

Query: 144 LIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEH 203
           LI VHGYGAGLGFFLKN E + L++N W IHAID PGYGFSSRPKFP+    + A++VE+
Sbjct: 139 LIFVHGYGAGLGFFLKNFENIKLLNNSWTIHAIDFPGYGFSSRPKFPFSINKNTASEVEN 198

Query: 204 WFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTP 263
           WFH RF+ WL+KRGLL+  E+N+++AHS+GAYL ALYA   P H KKL+MCSPAGIC  P
Sbjct: 199 WFHDRFEIWLQKRGLLEDQERNLVLAHSLGAYLIALYAQSRPKHLKKLIMCSPAGIC--P 256

Query: 264 SNKQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFE 323
           SNK  + PPWWF KLWDRN+SPFSLVRNS + GSKLTSGWS+RRF Q L+EG  G  QF+
Sbjct: 257 SNKVIKQPPWWFVKLWDRNLSPFSLVRNSGIFGSKLTSGWSFRRFKQFLNEGTMGESQFQ 316

Query: 324 AIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNK-MNQFKAKCEWLWLYGDQ 382
           A+H+YAYAIFN PGSGEYLLSF LKCGGDPR  L  RLF+++  + FKA+C+WLW+YGDQ
Sbjct: 317 ALHRYAYAIFNKPGSGEYLLSFVLKCGGDPRSPLLSRLFNSQAADSFKAQCDWLWMYGDQ 376

Query: 383 DWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEKEM 433
           DWMD  GG + S F+   +GK+S V V+  SGHHLY DNY  FN +L+ EM
Sbjct: 377 DWMDCKGGEQASDFIVRHIGKESNVHVIPQSGHHLYLDNYSVFNELLQAEM 427

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/396 (61%), Positives = 301/396 (76%), Gaps = 4/396 (1%)

Query: 39  SESASNPSITCRPSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLST 98
           + + +   I  + + P+A+PL ++   LP LFP S + S+RDY  F+++A + Q QLLST
Sbjct: 36  TSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQSQLLST 95

Query: 99  LPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFL 158
           LPF+P   + + +E+++TPVD++ NYINEF ++P  P  S +++HLI VHGYGAGLGFFL
Sbjct: 96  LPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPSSSSSMKHLIFVHGYGAGLGFFL 155

Query: 159 KNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGL 218
           KN E + L++N W IHAIDLPGYGFSSRPKFP+ Y       VE WFH R K WL KRGL
Sbjct: 156 KNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGL 215

Query: 219 LQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKL 278
           L +P+ N+LVAHS+GAY++ALYANK+PNHF KL+MCSPAGIC  PS K  + PP WF KL
Sbjct: 216 LANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGIC--PSPKLGQAPPQWFVKL 273

Query: 279 WDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGS 338
           WDRNISPFSLVRNS  LGSKLTSGW+YRRF Q L EG RG +Q +A+HKY YAIFN PGS
Sbjct: 274 WDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGS 333

Query: 339 GEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLN 398
           GEYLLSFALKCGGDPR  LE+RLF N  + FKA C+WLWLYGD+DWMD+ GG+R S FL 
Sbjct: 334 GEYLLSFALKCGGDPRLPLEKRLFDNT-SSFKANCDWLWLYGDEDWMDLRGGQRASEFLK 392

Query: 399 TAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEKEMK 434
             +G KS V+VV  +GHHLY DNY+ FN ++ KEM+
Sbjct: 393 K-IGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEME 427

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  496 bits (1278), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/391 (60%), Positives = 288/391 (73%), Gaps = 7/391 (1%)

Query: 51  PSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKV 110
           P++P+AIPL ++++ LP+LFPRS+  S RDY  F    G LQ +LL TLPF+P   + K 
Sbjct: 38  PAAPTAIPLHKIIMRLPKLFPRSVDASTRDYKDFCYHTGQLQEELLRTLPFYPYCAESKK 97

Query: 111 AEVVQTPVDEQANYINEFCVRPAMPH-PSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDN 169
           AEVV+T VD+Q NYINEFC+ P  P  PS  ++HLI +HGYGAGLGFFLKNLE + L+DN
Sbjct: 98  AEVVKTTVDDQGNYINEFCITPVKPSVPSHKMKHLICIHGYGAGLGFFLKNLEGIPLLDN 157

Query: 170 RWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVA 229
            WVIHAIDLPGYGFSSRPKFP+KY  D  +QV  WFH R  TW +KRGLL + + N+++A
Sbjct: 158 SWVIHAIDLPGYGFSSRPKFPFKYPKDSLSQVHSWFHDRIHTWFKKRGLLVNSQNNLVMA 217

Query: 230 HSMGAYLAALYANKYPNHFKKLVMCSPAGIC--NTPSNKQRRLPPWWFAKLWDRNISPFS 287
           HS+GAYL ALY  KY  HFKKLVMCSPAG+C   T  N     PPWW+ KLWD NISPF 
Sbjct: 218 HSLGAYLMALYTTKYTTHFKKLVMCSPAGVCKSTTAKNIGNTTPPWWYTKLWDLNISPFC 277

Query: 288 LVRNSRLLGSKLTSGWSYRRFGQLL---SEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLS 344
           LVRN+  LGS +TSGWSYRRF +LL   S       QFEA+H+YAYAIFN  GSGEYLLS
Sbjct: 278 LVRNAAALGSMVTSGWSYRRFNKLLQSNSNTNLDRLQFEALHRYAYAIFNRRGSGEYLLS 337

Query: 345 FALKCGGDPRDALERRLFHNKMNQ-FKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGK 403
           FAL CGGDPR  LE  +F +K +  F++ CEW+W+YG++DWMDV GG RVS F+    G+
Sbjct: 338 FALSCGGDPRLPLEDTIFKDKTSGIFRSNCEWIWIYGERDWMDVNGGERVSRFIENQGGR 397

Query: 404 KSKVEVVHDSGHHLYFDNYEQFNRILEKEMK 434
           KS+V V  +SGHHLYFDN++ FN  + K+MK
Sbjct: 398 KSQVHVAPNSGHHLYFDNHKFFNSFIVKQMK 428

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  491 bits (1265), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 236/388 (60%), Positives = 291/388 (75%), Gaps = 5/388 (1%)

Query: 50  RPSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDK 109
           +P+ P+A+PL E++ NLP LFP    +S  DY AF+ D    Q  LLSTLPFF  A + K
Sbjct: 41  KPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGK 100

Query: 110 VAEVVQTPVDEQANYINEFCVRPA-MPHPSGT-LRHLIIVHGYGAGLGFFLKNLEKLNLI 167
           + ++++TPVD++ NYINEFC+RPA M    G    HLI +HGYGAGLGFF+KN E L L+
Sbjct: 101 IGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLL 160

Query: 168 DNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNML 227
           D++WVIHAIDLPGYG+S+R +FP+   +    +VE WFH R +TWL KRGLLQ P +NM+
Sbjct: 161 DDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMV 220

Query: 228 VAHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFS 287
           +AHSMGAYL A YA    NHFKKL+MCSPAGI  +PS   ++ PPWWF KLWDRN+SPFS
Sbjct: 221 MAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGI--SPSKSMKKQPPWWFIKLWDRNVSPFS 278

Query: 288 LVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFAL 347
           LVRNS  LGSKLTSGWS+RRF  LL+EG  G +QFEA+HKY+YAIFN PGSGEYLLSF L
Sbjct: 279 LVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVL 338

Query: 348 KCGGDPRDALERRLFH-NKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSK 406
           KCGGDPR  L   +F   K + FKA+CEWLWLYGD  WMD  GG+R S ++   +G KS+
Sbjct: 339 KCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSR 398

Query: 407 VEVVHDSGHHLYFDNYEQFNRILEKEMK 434
           VE+V +SGHHLYFDNY  FN+IL +EM+
Sbjct: 399 VEIVPNSGHHLYFDNYSYFNKILLREMQ 426

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  489 bits (1259), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/389 (58%), Positives = 289/389 (74%), Gaps = 7/389 (1%)

Query: 51  PSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKV 110
           P++P+AIPL E+++ LP LFPR++KES+ DY  F KD    Q +LLSTLP++P+A D K 
Sbjct: 39  PAAPAAIPLYEIILKLPNLFPRTLKESLNDYHDFHKDIDKFQTELLSTLPYYPMANDGKK 98

Query: 111 AEVVQTPVDEQANYINEFCVRPAMPHPSG-TLRHLIIVHGYGAGLGFFLKNLEKLNLIDN 169
           AE++ T VD++ NYINEFC+ P         L+HLI +HGYGAGLGFFLKN E L L+DN
Sbjct: 99  AELITTKVDDEGNYINEFCISPIGAEADQRDLKHLIFIHGYGAGLGFFLKNFEHLPLLDN 158

Query: 170 RWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVA 229
           +W IHAIDLPGYG+S R +FP+KY     + V+ WFH R +TW + R LL  PE NM++A
Sbjct: 159 KWCIHAIDLPGYGYSKRCEFPFKYPEHDISDVQDWFHKRIRTWFKARSLLTTPENNMIMA 218

Query: 230 HSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQ--RRLPPWWFAKLWDRNISPFS 287
           HS+GAYL ALY +K+PN FKK+VMCSPAGIC + ++++      PWWF KLWD+N+SPF+
Sbjct: 219 HSLGAYLMALYIDKFPNDFKKIVMCSPAGICQSSTSEEIGNIKTPWWFNKLWDQNVSPFT 278

Query: 288 LVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFAL 347
           LVRN+  LGSKLTSGWSYRRF QL   G+    QFE +H+YAY+IFN  GSGEY+L FAL
Sbjct: 279 LVRNTYYLGSKLTSGWSYRRFKQLKQSGH--LMQFEKLHRYAYSIFNQKGSGEYILGFAL 336

Query: 348 KCGGDPRDALERRLFHNKMNQF--KAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKS 405
           KCGGDPR  LE  LF +   +   K+ CEWLW+YG++DWMD+GGG+RV+  L T  GKKS
Sbjct: 337 KCGGDPRIPLEDNLFKSPKTEGIPKSDCEWLWVYGEKDWMDIGGGKRVTDELVTRFGKKS 396

Query: 406 KVEVVHDSGHHLYFDNYEQFNRILEKEMK 434
              VV DSGHHLYFDNY+ FN +L KEMK
Sbjct: 397 STTVVPDSGHHLYFDNYKFFNELLVKEMK 425

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  488 bits (1257), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/383 (60%), Positives = 286/383 (74%), Gaps = 7/383 (1%)

Query: 51  PSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKV 110
           P++P+AIPL E+++ LP LFPR + +S+ DY  F  +A  +Q+ LLSTLPFFP A D K 
Sbjct: 40  PTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKR 99

Query: 111 AEVVQTPVDEQANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNR 170
           AE+V+T +DE  N+INEF ++PA       L+HLI +HGYGAGLGFFLKN E + L DN 
Sbjct: 100 AEIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNS 159

Query: 171 WVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAH 230
           W IHAIDLPG+GFSSR KFP+KY  D  ++V+ WFH R K W EKR LL++P  NM+VAH
Sbjct: 160 WCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAH 219

Query: 231 SMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVR 290
           S+GAYL ALY    P HFKKL+MCSPAG+CN+   K++  PPWW+A LWD N+SPFSLVR
Sbjct: 220 SLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQ--PPWWYAALWDMNLSPFSLVR 277

Query: 291 NSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCG 350
           NS  LGSKLTSGWSYRRF  L S+      QFE +H Y+YAIFN PG GEYLL+FAL+CG
Sbjct: 278 NSGWLGSKLTSGWSYRRFRSLHSK-----IQFENLHLYSYAIFNRPGCGEYLLAFALRCG 332

Query: 351 GDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVV 410
           GDPR +LE  LF++ +N++ +  EW+WLYGD+DWMDV GGRR+S  +N     KS VEV+
Sbjct: 333 GDPRVSLEATLFNDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVI 392

Query: 411 HDSGHHLYFDNYEQFNRILEKEM 433
            ++GHHLYFDN   FN ILEKEM
Sbjct: 393 PNAGHHLYFDNISCFNAILEKEM 415

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  479 bits (1232), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 230/428 (53%), Positives = 298/428 (69%), Gaps = 12/428 (2%)

Query: 19  AFSQVVGIQPKVRKPAFP-CNSESASNPSITCRPSSPSAIPLRELVINLPRLFPRSMKES 77
            F  + G      +P  P  ++   +   I   PS+P+AIPLRE++  +P LFPR +++S
Sbjct: 16  GFQLLRGADSSNTRPQSPRASARDVTEKQILRTPSAPTAIPLREIIYRVPSLFPRPLEDS 75

Query: 78  VRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMPH- 136
           V+D+  F K+    Q +LL TLPF+P   + K A +++T VD++ NYINEFC+RP     
Sbjct: 76  VKDFRDFIKNEDAFQTELLKTLPFYPTPSESKTARLIRTVVDDEGNYINEFCIRPRKTSV 135

Query: 137 PSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSD 196
           P   L+HL+ +HGYGAGLGFF+KN E + L+DN W IHAIDLPGYGFSSRPKFP++Y  D
Sbjct: 136 PEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPRD 195

Query: 197 PAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPN--HFKKLVMC 254
               V+ WFH R  TW  KR LL  PE+N+++AHS+G+YL ALY  KY     FKKL++C
Sbjct: 196 NIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQKYKESPSFKKLILC 255

Query: 255 SPAGIC-----NTPSNKQR-RLPPWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRF 308
           SPAG+      NT S  ++ + PPWW+ KLWDRNISPF+LVRN R LGSK+TSGWSYRRF
Sbjct: 256 SPAGVSYRDFNNTASEVEKWKPPPWWYVKLWDRNISPFTLVRNFRQLGSKITSGWSYRRF 315

Query: 309 GQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQ 368
             +L+     +++FEA+H+YAYAIFN  GSGEYLLSFALKCGG+PR +LE++LF  K + 
Sbjct: 316 KHILNGDPEQSKRFEALHRYAYAIFNKRGSGEYLLSFALKCGGEPRLSLEQQLFDGKKSD 375

Query: 369 F--KAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFN 426
               + C+WLWLYGD DWMDV GG RVS FL   + +KS V +V  SGHHLY DNY+ FN
Sbjct: 376 ILKNSNCDWLWLYGDDDWMDVNGGLRVSRFLKEKLKQKSNVIIVPHSGHHLYLDNYKFFN 435

Query: 427 RILEKEMK 434
            IL KEM+
Sbjct: 436 NILTKEMQ 443

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  468 bits (1204), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 228/428 (53%), Positives = 298/428 (69%), Gaps = 12/428 (2%)

Query: 19  AFSQVVGIQPKVRKPAFPCNS-ESASNPSITCRPSSPSAIPLRELVINLPRLFPRSMKES 77
           +F  + G  P   +P  P  S    +   I+  PS+P+AIPLRE++  +P LFPR + +S
Sbjct: 16  SFQLLTGANPSNTQPQCPRASVRDITEKQISRTPSAPTAIPLREIIYKVPGLFPRPVGDS 75

Query: 78  VRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMPH- 136
           V+D+  F K     Q +LL TLPF+P     K + V++T VD+  NYINEFC+RP  P  
Sbjct: 76  VKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPINPSV 135

Query: 137 PSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSD 196
           P   L+HLI +HGYGAGLGFF+KN E + L++N W +HAIDLPGYGFSSRPKFP++Y  D
Sbjct: 136 PETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRD 195

Query: 197 PAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNH--FKKLVMC 254
               V+ WFH R  TW  KR LL  P++N+++AHS+G+YL ALY  KY     FKKL++C
Sbjct: 196 NLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILC 255

Query: 255 SPAGICNTPSN------KQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRF 308
           SPAG+ +  SN      ++ + PPWW+ KLWDRNISPF+LVRNSR  GSK+TSGWSYRRF
Sbjct: 256 SPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRF 315

Query: 309 GQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNK-MN 367
             +L+   + + +FEA+H+YAY+IFN  GSGEYLLSFALKCGG+PR  LE +LF+++ +N
Sbjct: 316 KHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLN 375

Query: 368 QFK-AKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFN 426
             + +  EWLWLYGD DWMDV GG RVS FLN  + +KS V +V  +GHHLY DN + FN
Sbjct: 376 ILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFN 435

Query: 427 RILEKEMK 434
            IL KEM+
Sbjct: 436 DILVKEMR 443

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  467 bits (1202), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 230/442 (52%), Positives = 304/442 (68%), Gaps = 23/442 (5%)

Query: 16  FRSAFSQVVG-----IQPKVRKPAFPCNSESASNPS-------ITCRPSSPSAIPLRELV 63
           F+S  S ++G     +Q      +    SES  +P        I   PS+P+AIPLRE++
Sbjct: 8   FKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAPTAIPLREII 67

Query: 64  INLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQAN 123
             +P LFPR +++SV+D+  F K+    Q +LL TLPF+P     K +++++T VD+  N
Sbjct: 68  YKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKTVVDDDGN 127

Query: 124 YINEFCVRPAMPH-PSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYG 182
           YINEFC+ P  P  P   L+HL+ +HGYGAGLGFF+KNLE + L+DN W IHAIDLPGYG
Sbjct: 128 YINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYG 187

Query: 183 FSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYAN 242
           FSSRPKFP++Y  D    V+ WFH R  TW  KR LL  P++N++VAHS+G+YL ALY  
Sbjct: 188 FSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQ 247

Query: 243 KYPN--HFKKLVMCSPAGICN------TPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRL 294
           KY     FKKLV+CSPAG+ N      T    + + PPWW+ KLWDRNISPF+LVRN+R 
Sbjct: 248 KYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQ 307

Query: 295 LGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPR 354
           LGSK+TSGWSYRRF  +L+     +++FEA+H+YAY+IFN  GSGEYLLSFAL+CGG+PR
Sbjct: 308 LGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPR 367

Query: 355 DALERRLFHNKMNQF--KAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHD 412
             LE +LF+ + ++    +  EW+WLYG+ DWMDV GG RVS +LN  +G+KS V +V  
Sbjct: 368 LPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPH 427

Query: 413 SGHHLYFDNYEQFNRILEKEMK 434
           +GHHLY DNY  FN+IL KEM+
Sbjct: 428 AGHHLYLDNYTFFNKILVKEMQ 449

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  465 bits (1196), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 226/390 (57%), Positives = 283/390 (72%), Gaps = 7/390 (1%)

Query: 51  PSSPSAIPLRELVINLPRLFPRSMKESVRDYFAF-RKDAGTLQHQLLSTLPFFPVAGDDK 109
           P++P+AIPLRE+++ LP LFPRS  +SVRDY    R      Q  LL+TLPF+      +
Sbjct: 34  PAAPTAIPLREIIVKLPSLFPRSFGDSVRDYRDLCRHTDEKFQRDLLATLPFYGEGDLHR 93

Query: 110 VAEVVQTPVDEQANYINEFCVRPAMPH-PSGTLRHLIIVHGYGAGLGFFLKNLEKLNLID 168
            +EV++T VD++ NYINEF + P     P   L+HL+ +HGYGAGLGFFLKN E + L++
Sbjct: 94  RSEVIRTKVDDEGNYINEFYIMPKNASVPRDRLKHLVFIHGYGAGLGFFLKNFENIPLLN 153

Query: 169 NRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLV 228
           N W IHAIDLPGYGFSSR KFP++Y  D    V  WFH R   W  +R LL++PE N+++
Sbjct: 154 NEWCIHAIDLPGYGFSSRCKFPFQYPKDTVTDVHEWFHKRLNRWFAERNLLRNPENNIVM 213

Query: 229 AHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQ--RRLPPWWFAKLWDRNISPF 286
           AHS+GAYL ALYA+K  +HFKKLVMCSPAGIC + + K    R PPWW++KLWDRNISPF
Sbjct: 214 AHSLGAYLMALYASKNSSHFKKLVMCSPAGICESTTTKAIGNRKPPWWYSKLWDRNISPF 273

Query: 287 SLVRNSRLLGSKLTSGWSYRRFGQLL-SEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSF 345
           SLVR S  LGSKLTSGWSY+RFG+LL S+  +  QQFEA+HKY Y+IFN PG GEYLLSF
Sbjct: 274 SLVRVSSRLGSKLTSGWSYKRFGKLLRSKSRKSEQQFEALHKYCYSIFNKPGCGEYLLSF 333

Query: 346 ALKCGGDPRDALERRLFH-NKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKK 404
           AL+CGGDPR  LE  LF  N         EWLWLYG++DWMD  GG+RVS  L  + G+K
Sbjct: 334 ALRCGGDPRIPLEDMLFKTNDSGIMNGNLEWLWLYGERDWMDFNGGKRVSEHLKKS-GQK 392

Query: 405 SKVEVVHDSGHHLYFDNYEQFNRILEKEMK 434
           S+V +V ++GHHLYFDNY+ FN ++ +EMK
Sbjct: 393 SEVCIVPNAGHHLYFDNYDYFNSLIIREMK 422

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  463 bits (1192), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 222/402 (55%), Positives = 286/402 (71%), Gaps = 8/402 (1%)

Query: 39  SESASNPSITCRPSSP-SAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLS 97
           +E A++ +I  +PS+P  AIP+ +++ +LP LFPRS+ +S RDY  F  D  +LQ  LL 
Sbjct: 38  TEYATSNTILPQPSTPPVAIPITDIITSLPSLFPRSLHDSRRDYNTFTTDIDSLQLNLLK 97

Query: 98  TLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMP---HPSGTLRHLIIVHGYGAGL 154
           TLPFFP+    KVA++++TP+D++ NYINEFC+ PA+    + S  L+HLI +HGYGAGL
Sbjct: 98  TLPFFPMGSSQKVAKLIRTPIDDEGNYINEFCIMPAVKDGDYSSPDLKHLIFIHGYGAGL 157

Query: 155 GFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLE 214
           GFFLKNLE + L+DN+W IHAIDLPGYGFSSR KFP+ Y +D   +V+ WFH R   W  
Sbjct: 158 GFFLKNLENIPLLDNKWCIHAIDLPGYGFSSRFKFPFHYPNDSQTKVQKWFHDRIYRWFR 217

Query: 215 KRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWW 274
           +R LLQ+P+ N+++AHS+GAYL A YA  + NHFKK++MCSPAG+      KQ + PPWW
Sbjct: 218 ERNLLQNPQNNLVMAHSLGAYLMAHYAFHFSNHFKKIIMCSPAGVSQFAVGKQNKQPPWW 277

Query: 275 FAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFN 334
           + KLWD N SPFSLVRNS + GSK+TSGWSYRRF      G     QFEA+HKY Y IFN
Sbjct: 278 YNKLWDLNYSPFSLVRNSGIYGSKITSGWSYRRFKPTSFNGL-NESQFEALHKYTYGIFN 336

Query: 335 SPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVS 394
             GSGEYLLSF L CGGDPR ALE  LF  + N  +  C+W+W+YGD+DWMD+ G  R+S
Sbjct: 337 KNGSGEYLLSFILSCGGDPRFALEDNLFKEE-NPPEDLCDWVWVYGDRDWMDINGAHRIS 395

Query: 395 HFLNTAMG--KKSKVEVVHDSGHHLYFDNYEQFNRILEKEMK 434
             L    G   KSKV V+  +GHHLY DNY+ FN ++ KEM+
Sbjct: 396 RRLVKKAGDTSKSKVHVIPSAGHHLYLDNYKAFNNLIIKEME 437

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  462 bits (1189), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 220/406 (54%), Positives = 293/406 (72%), Gaps = 11/406 (2%)

Query: 40  ESASNPSITCRPSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTL 99
           + A+   I   PS+P+AIPLRE++  +P LFPR +++SV+D+  F K+  + Q +LL+TL
Sbjct: 44  KDAAEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATL 103

Query: 100 PFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMPH-PSGTLRHLIIVHGYGAGLGFFL 158
           PF+P     K +++++T VD+  NYINEFC+ P +P  P   L+HL+ +HGYGAGLGFF+
Sbjct: 104 PFYPNPSTTKKSKLIKTIVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFI 163

Query: 159 KNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGL 218
           KN E + L++N W +HAIDLPGYGFSSRPKFP+KY  D    V+ WFH R  TW EKR L
Sbjct: 164 KNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNL 223

Query: 219 LQHPEQNMLVAHSMGAYLAALYANKYPN--HFKKLVMCSPAGICNTPSN------KQRRL 270
           L  PE+N+++AHS+G+YL ALY  KY     FKKL++CSPAG+ +   +      ++ + 
Sbjct: 224 LNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKP 283

Query: 271 PPWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAY 330
           PPWW+ KLWD+NISPF+LVRNSR  GSK+TSGWSYRRF  +L+     +++FEA+H+YAY
Sbjct: 284 PPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAY 343

Query: 331 AIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNK-MNQFK-AKCEWLWLYGDQDWMDVG 388
           +IFN  GSGEYLLSFALKCGG+PR  LE +LF+ K  N  K AK EW+WLYGD DWMDV 
Sbjct: 344 SIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVN 403

Query: 389 GGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEKEMK 434
           GG RVS  LN  + +KS V  V ++GHHLY DN++ FN I+  EM+
Sbjct: 404 GGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQ 449

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  459 bits (1180), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 287/418 (68%), Gaps = 16/418 (3%)

Query: 18  SAFSQVVGIQPKVRKPAFPCNSESASNPSITCRPSSPSAIPLRELVINLPRLFPRSMKES 77
           ++F ++V    K++K   P +S  +S         +P AIPL +++  LPRLFPRS+ ES
Sbjct: 7   ASFLKLVLGHSKIKKSQVPVHSNISS---------APVAIPLVKIIAQLPRLFPRSIDES 57

Query: 78  VRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMPHP 137
            +DY  +++    +Q  LLSTLPF+P    DKVA +++T VDE+ NYINEFC+ P     
Sbjct: 58  FKDYRVYKEGPERMQEDLLSTLPFYPNVSKDKVARIIKTVVDEEGNYINEFCITPKNTVN 117

Query: 138 SGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDP 197
           S  L+HLI +HGYGAG GFFLKNLE + L+DN W IHAIDLPG+GFSSR  FP+KY +  
Sbjct: 118 SQKLKHLIFIHGYGAGFGFFLKNLESIPLLDNNWCIHAIDLPGFGFSSRKNFPFKYPTSN 177

Query: 198 AAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPA 257
            ++V  WFH R + WLE+R LL +P+ N++VAHS+GAYL ALY   YP H +KL+MCSPA
Sbjct: 178 TSEVTAWFHERIRRWLEERTLLDNPKNNVIVAHSLGAYLMALYTQVYPAHLRKLIMCSPA 237

Query: 258 GICNTPSNKQRRL-PPWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGY 316
           G+  + +N +  L PPWW+AKLWD N+SPF+LVR S+ LGSKLTSGWSYRRF  +     
Sbjct: 238 GVSKSQNNSKAVLQPPWWYAKLWDMNLSPFTLVRLSKHLGSKLTSGWSYRRFKLI----- 292

Query: 317 RGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWL 376
               QFE +H+Y+YAIFN PGSGEYLL F L+CGG+PR +LE  LF N  N   +K EW 
Sbjct: 293 ENRMQFEMLHRYSYAIFNQPGSGEYLLGFILECGGNPRCSLEDTLFSNNFN-VSSKVEWA 351

Query: 377 WLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEKEMK 434
           W+YG+ DWMD+ GGRRV + L     + SK  +V ++GHHLY DN   FN I+ + M+
Sbjct: 352 WIYGENDWMDIEGGRRVHNLLLEKFNRDSKFYMVPNAGHHLYLDNIRYFNNIIVQHME 409

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  446 bits (1147), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 209/395 (52%), Positives = 281/395 (71%), Gaps = 9/395 (2%)

Query: 48  TCRPSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGD 107
           T  P+ P+AIPL  ++ +LP+LFPRS+K+S++DY  F+KD   LQ  LL TLPFF     
Sbjct: 66  TIAPTPPTAIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAK 125

Query: 108 DKVAEVVQTPVDEQANY-INEFCVRPA--MPHPSGTLRHLIIVHGYGAGLGFFLKNLEKL 164
            K  ++++T +++  +Y INEFC+ P   +   S  ++HLI +HGYGAGLGFF+KNLE +
Sbjct: 126 FKTGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENI 185

Query: 165 NLIDNRWVIHAIDLPGYGFSSR-PKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPE 223
            L++NRW IHAIDLPGYG+S+R  KFP+KY  D   +V++WFH +   WL+KR LL +P+
Sbjct: 186 PLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPK 245

Query: 224 QNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNI 283
            N++VAHS+GAYL A YA K+P+HF+KL+MCSPAG+  +   K    PPWW+ KLWD N 
Sbjct: 246 NNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNF 305

Query: 284 SPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLL 343
           SPFS+VRNS + GSK+TS WSYRRF  L  +     +QFEA+H+YAY+IFN PG GEYLL
Sbjct: 306 SPFSIVRNSGIYGSKITSAWSYRRFKPLDLD----HKQFEALHRYAYSIFNRPGCGEYLL 361

Query: 344 SFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGK 403
           SF L CGG+PR +LE  LF  + N     C+W W+YGD DWMD+ G +RVS  +N     
Sbjct: 362 SFILSCGGNPRFSLEDTLFQ-RENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKG 420

Query: 404 KSKVEVVHDSGHHLYFDNYEQFNRILEKEMKMWDQ 438
           KS V V+  +GHHLY DNY+ FN++L KEM+M+ +
Sbjct: 421 KSDVHVIPSAGHHLYLDNYKDFNKLLIKEMEMFGE 455

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  431 bits (1108), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 205/380 (53%), Positives = 269/380 (70%), Gaps = 5/380 (1%)

Query: 57  IPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQT 116
           + L EL+   PRLFPRS  +S +DY  F  D    Q +LL TLP+FP   +   +++  T
Sbjct: 59  LSLFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNT 118

Query: 117 PVDEQANYINEFCVRPA-MPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHA 175
            VD++ + INEF V P+ +  PS  L+HLI VHGYGAGLGFFLKNLE + L+++ W +HA
Sbjct: 119 IVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHA 178

Query: 176 IDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAY 235
           IDLPGYGFS+R KFP++       QV  WFH+R + W+ +R LLQH + N L+AHS+GAY
Sbjct: 179 IDLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAY 238

Query: 236 LAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRLL 295
           L ALY +K+PN  +K++MCSPAGI ++  N +++ P WWF KLW+RNISPF+LVR+S  +
Sbjct: 239 LMALYVDKHPNDLQKILMCSPAGIGDS-MNLKKKTPAWWFEKLWERNISPFTLVRSSSYI 297

Query: 296 GSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRD 355
           GSKLTSGW+YRRF  LLS+     +QFEA+HKY Y+IFN  GSGEYLL+FALKCGG PR 
Sbjct: 298 GSKLTSGWTYRRFSSLLSQN--NLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRY 355

Query: 356 ALERRLFHNKMNQF-KAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSG 414
            LE+ LF N      K+  EW+W YGD DWMD  GG RVS  L   + K+S+V +V  +G
Sbjct: 356 PLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAG 415

Query: 415 HHLYFDNYEQFNRILEKEMK 434
           HHLYFDN++ FN ++ KEM+
Sbjct: 416 HHLYFDNHQFFNDLILKEME 435

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  416 bits (1069), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 206/414 (49%), Positives = 262/414 (63%), Gaps = 27/414 (6%)

Query: 46  SITCRPSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVA 105
           S     ++P+A PL E+V +LPRLFPRS+ ES RDY  F  +   +Q +LL TLPFF   
Sbjct: 37  SAIIHATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERT 96

Query: 106 GDDKVAEVVQTPVDEQANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLN 165
           G +K A + +T +D   NYINE  + PA   P+   + LI VHGYGAGLGF+LKN E L 
Sbjct: 97  GYNKRAYLRKTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLP 156

Query: 166 LIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQN 225
           L+D+ W IHAIDLPGYGFSSR  FP+++  D  + V  WF +R +T  EKRG       N
Sbjct: 157 LLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGF--DKSDN 214

Query: 226 MLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLP-------------- 271
           +++AHSMGAYL A Y NKYP+  KK+VMCSPAGI  +  +    +               
Sbjct: 215 IVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKI 274

Query: 272 ---PWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKY 328
              PWW+ KLWDRNISPF LVR + +LGSK+TSGW+YRRF  +L       +QFE +H+Y
Sbjct: 275 KKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRY 334

Query: 329 AYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQF--------KAKCEWLWLYG 380
           ++AIFN  GSGEYLLSF L+CGGDPR  LE  LF +  N+F         + CEW+W+YG
Sbjct: 335 SFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYG 394

Query: 381 DQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEKEMK 434
             DWMD+ G  RV+        KKS+V  + +SGHHLYFDNY  FN +L  EMK
Sbjct: 395 ANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMK 448

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  382 bits (982), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 203/424 (47%), Positives = 267/424 (62%), Gaps = 25/424 (5%)

Query: 20  FSQVVGIQPKVRK-----PAFPCNSESASNPSI---TCRPSS-PSAIPLRELVINLPRLF 70
           + +V+G+  K+++      A   N  S +  S+   T R S+ P  +PL ++V NL +LF
Sbjct: 17  YREVIGVFNKLQREHVGVTAGTGNVGSTNKKSVRVNTVRKSTAPIGLPLLQIVTNLHKLF 76

Query: 71  PRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCV 130
           P S  ES++DY  +  +    Q  LLS LP++P       +++++TP+D   NYINEF +
Sbjct: 77  PLSFAESLKDYKQYNINKEQFQEDLLSVLPYYPEPSARFSSKIIKTPIDAAGNYINEFQI 136

Query: 131 RPAMPHPSGT-LRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKF 189
            P  P   G  L+H+I+VHGYGAGLGF+LKN   L  +    V+HAIDLPGYGFSSRP F
Sbjct: 137 TPIRPESDGKPLKHIILVHGYGAGLGFYLKNFNAL--LSENVVVHAIDLPGYGFSSRPMF 194

Query: 190 PYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFK 249
           P+ Y  D    VE +FH     W +K+GL+   E N ++AHSMGAY+ +LYANKY  HFK
Sbjct: 195 PFHYPKDSYLAVEDYFHDALHKWFDKKGLISCWENNYVIAHSMGAYIFSLYANKY-KHFK 253

Query: 250 KLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFG 309
           KL MCSP GI     NK    PPWWF KLWD+NISPFSLVRN+  +GSKL SGW+ RRFG
Sbjct: 254 KLFMCSPGGIS---RNKDMPPPPWWFLKLWDQNISPFSLVRNAGHVGSKLVSGWTARRFG 310

Query: 310 QLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQF 369
                       F+ +H Y Y IFN PGSGEY+LSF L CGG PR  LE RLF  + N  
Sbjct: 311 L-------HHPNFDKLHHYTYGIFNQPGSGEYMLSFMLGCGGWPRVPLETRLF-TEENFN 362

Query: 370 KAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRIL 429
            +  +W+WLYGD DWMD+ G RR++ FL       +K+E+V ++GHHLY+DN   FN +L
Sbjct: 363 SSHLDWVWLYGDSDWMDINGARRINDFLRKKC-INTKLEIVPNAGHHLYWDNDSFFNNVL 421

Query: 430 EKEM 433
            KE+
Sbjct: 422 RKEL 425

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  360 bits (924), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 194/409 (47%), Positives = 256/409 (62%), Gaps = 27/409 (6%)

Query: 48  TCRPSS-PSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFP--- 103
           T +PS+ P A  L +++ NLPRLFPRSM +S+RDY  F+ +    Q +LLS L F+P   
Sbjct: 41  TLKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLY 100

Query: 104 ------VAGDD--KVAEVVQTPVDEQANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLG 155
                  +G+D  +  ++++T V+E   YINEF + P    P   L+HLI++HGYGAGLG
Sbjct: 101 NNNSNDTSGNDDPRQGQIIKTYVNENE-YINEFQILPNTSTPYDRLKHLILIHGYGAGLG 159

Query: 156 FFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKY---KSDPAAQVEHWFHARFKTW 212
           F++  L+ L++  + W IHA+DLPGYGFSSR KFPY     +      V  WF  R KTW
Sbjct: 160 FYINTLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTW 217

Query: 213 LEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPP 272
             K+GLL HPE N++ AHSMGAY+   Y N +P+ F+K++MCSPAG    P++      P
Sbjct: 218 FHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFY--PASNPLTNIP 275

Query: 273 WWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAI 332
            W+  LWDRN SPFSLVR S  LGSKLTSGWSY RF    S      +   A+H YAY+I
Sbjct: 276 LWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF--FHSNQTISNELSLALHTYAYSI 333

Query: 333 FNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQF----KAKCEWLWLYGDQDWMDVG 388
           FN PGSGEY LS  LK GGDPR  L+   F  +        ++  E+ WLYG  DW++  
Sbjct: 334 FNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKT 393

Query: 389 GGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEKEMKMWD 437
           GG ++S FLN ++ KKS V +  +SGHHLYFDNY  FN  L KEM +++
Sbjct: 394 GGFKISQFLN-SLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEMTLFN 441

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  194 bits (493), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 131/414 (31%), Positives = 196/414 (47%), Gaps = 80/414 (19%)

Query: 85  RKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMPHPSGTLRHL 144
           R DA   + +LLSTL FFP     +  E++   +  +  +I+EF ++          + L
Sbjct: 36  RADAKENEKKLLSTLEFFPGGDSIRNCELLDVDIGNK-QHIHEFSIQNIESCSRDYCKDL 94

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPY-----------KY 193
           ++VHGYGA LG F++N + L+ I     +HA+D+ G G SSRP+FP            + 
Sbjct: 95  VMVHGYGAALGLFVRNFDGLSRIPG-INLHALDMLGCGLSSRPRFPGTGLISSVIKRGRV 153

Query: 194 KSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVM 253
             +   + E++F    + W ++R L    ++ +LV HS+G YL+  YA K+P   +KLV+
Sbjct: 154 TKEEVYEAENFFIDSLEKWRQQRKL----DKFVLVGHSLGGYLSCCYALKFPERVEKLVL 209

Query: 254 CSPAGIC---------NTPSNKQ------------------------------------- 267
            SP G+          +TPS+                                       
Sbjct: 210 VSPVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTTDDPVKTSSSFHVPDEA 269

Query: 268 ---RRLP--PWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQF 322
               R+P  PW F+ +W  NISPF L+R++   G  L+S WS+RRF           +Q 
Sbjct: 270 GNVERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRFSFA-----ENTEQL 324

Query: 323 EAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQ 382
              H+Y Y+IF+  GSGEY L+  L  G   R  L  R+  N       KC+  W+YG  
Sbjct: 325 LTFHEYCYSIFSGSGSGEYALTRILAPGVLARVPLLSRVPEN------LKCDSFWMYGSH 378

Query: 383 DWMDVGGGRRVSHFLNTAMGK-KSKVEVVHDSGHHLYFDNYEQFNRILEKEMKM 435
           DWM    G  +   +N   G  K+   VV D+GHHLY DN E+FN+ L K +K+
Sbjct: 379 DWMSKEAGSVIVRQINKTKGSVKADYSVVSDAGHHLYLDNPEEFNQKLAKFLKV 432

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  188 bits (478), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 124/405 (30%), Positives = 188/405 (46%), Gaps = 83/405 (20%)

Query: 92  QHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMPHPSGTLRHLIIVHGYG 151
           +  +L  L F+P    ++  EV+   +    +Y++EFC+   +P    T + +++VHGYG
Sbjct: 41  EDNVLRMLSFYPDGDSERTCEVLHVDIG-GGDYMHEFCIENKLPMTRDTCKDIVLVHGYG 99

Query: 152 AGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFP--------YKYKSDPAAQVEH 203
             LG F++N ++L+ I     +HAID+ GYG SSRP+FP         K K     QVE 
Sbjct: 100 TALGVFIRNFDELSQIPGV-RLHAIDMLGYGLSSRPRFPRSGFWDYYVKGKVVTKEQVEE 158

Query: 204 ---WFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGI- 259
              +F    + W EKR +    +  +LV HS+G YL++ YA ++P    KLV+ SP G+ 
Sbjct: 159 ALAFFVDSLEAWREKRNV----DSFVLVGHSLGGYLSSFYALRHPERIDKLVLVSPVGVE 214

Query: 260 ------------------------------------------CNTPSNKQRRLP------ 271
                                                      N+P +    +P      
Sbjct: 215 TSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLSIDSNSPQSSSLHIPNEKGFV 274

Query: 272 ------PWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAI 325
                 PW    LW+ N+SPFSL+R    LG K+ + WS+RRFG       +   +    
Sbjct: 275 EHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRRFGAC-----KDTNELMNF 329

Query: 326 HKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWM 385
           H+YAY  F + GSGEY +   L  G   R  L  +L          KC+ LW+YG  DWM
Sbjct: 330 HQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQL------PGALKCDSLWMYGSNDWM 383

Query: 386 DVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRILE 430
               G  +   L      +++ ++V+++GHHLY DN E+FNR L+
Sbjct: 384 SKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPEEFNRELK 428

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  184 bits (466), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 132/429 (30%), Positives = 188/429 (43%), Gaps = 89/429 (20%)

Query: 72  RSMKESVRDYFAFRKDAGTLQH---------QLLSTLPFFPVAGDDKVAEVVQTPVDEQA 122
           +++ E ++  + F+    T +H          +LS L F+P   + +  E +   +    
Sbjct: 16  KTLLEELKKDYDFKASFKTWKHASSLRESEENILSMLDFYPEGDESRRCETMDVDIG-TG 74

Query: 123 NYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYG 182
           N I+EFC+           R +++VHGYGA LG F++N + L+ I     +HAID+ GYG
Sbjct: 75  NSIHEFCIENTKESDRDYCRDMVLVHGYGAALGLFIRNFDGLSQIPG-IRLHAIDMLGYG 133

Query: 183 FSSRPKFP-----------YKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHS 231
            SSRPKFP            +   +     E +F    +TW  KR    H ++ +LV HS
Sbjct: 134 LSSRPKFPDTGFLTSFWKKREVTKEDVLLAEDFFIDSIETWRHKR----HLDKFVLVGHS 189

Query: 232 MGAYLAALYANKYPNHFKKLVMCSPAGICNT----------------------------- 262
           +G YL+  YA KYP   +KL++ SP G+  +                             
Sbjct: 190 LGGYLSCRYALKYPERVEKLILVSPVGVETSIFDLTKEHTATHEHAAELGPDIAQELKVV 249

Query: 263 PSNKQ--------------------RRLP--PWWFAKLWDRNISPFSLVRNSRLLGSKLT 300
           P N                       R+P  P     +W+ NISPF ++R+    G  L 
Sbjct: 250 PENSTTDKPVQPSSSFHVPNESGHVERIPNLPKIVRIIWENNISPFGILRSLGPWGPLLC 309

Query: 301 SGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERR 360
           S WS+RRF     +     +Q    H YAY  FN+ GSGEY L+  L  G   R  L   
Sbjct: 310 SRWSFRRFSHCGDK-----EQVMKFHDYAYNTFNARGSGEYALTRILAPGVLARIPLLSC 364

Query: 361 LFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFD 420
              N       KCE LW+YG  DWM    G  +   LN A G  +   VV D+GHHLY D
Sbjct: 365 APKN------LKCESLWMYGSHDWMSKEAGSVIVKELNKA-GNTADYSVVSDAGHHLYLD 417

Query: 421 NYEQFNRIL 429
           N  +FN+ L
Sbjct: 418 NPHEFNQKL 426

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score =  181 bits (459), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 130/424 (30%), Positives = 192/424 (45%), Gaps = 81/424 (19%)

Query: 75  KESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAM 134
           K+S + +   + +A   + QLLSTL FFP     +  +++   + ++   I+E  +    
Sbjct: 28  KQSFKSWMG-KSNARENEKQLLSTLEFFPQGDSTRKCKILDVDIGDKQT-IHELEIENLK 85

Query: 135 PHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPY--- 191
                    L++VHGYGA LG F++N + L+ +     +HAID+ G G SSRPKFP    
Sbjct: 86  TSSRSYANDLVLVHGYGAALGLFVRNFDGLSSVPG-IKLHAIDMLGCGLSSRPKFPGTGL 144

Query: 192 --------KYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANK 243
                       +   + E +F    + W +KR +    E+ +LV HS+G YL++ YA K
Sbjct: 145 ISSLIKRGNVTKEEVYEAEDFFVDSMEKWRKKRQV----EKFVLVGHSLGGYLSSCYALK 200

Query: 244 YPNHFKKLVMCSPAG-----------------------------ICNTPSNKQ------- 267
           YP   +KLV+ SP G                             I N P           
Sbjct: 201 YPERVEKLVLVSPVGVEKSIFDLTHEHTESHKGAAELGPDVAKEITNNPDKPTTDNPVKN 260

Query: 268 -------------RRLPPW--WFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLL 312
                         R+P     F+ +W  NISPF ++R    +G  ++S WS+RRF    
Sbjct: 261 SSSFHVPDEHGMVERVPNMSRIFSYMWTYNISPFGILRTLGPVGPLISSNWSFRRFSFT- 319

Query: 313 SEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAK 372
                  +Q    H+Y Y +F+  GSGEY L+  L  G   R  L  R+  N       K
Sbjct: 320 ----DDPKQLLTFHEYCYGVFSGAGSGEYALTRILAPGVLARLPLLSRMPGN------LK 369

Query: 373 CEWLWLYGDQDWMDVGGGRRVSHFLNTAMG-KKSKVEVVHDSGHHLYFDNYEQFNRILEK 431
           C+  W+YG QDWM    G  +   LN + G  K+   +V D+GHHLY DN E+FNR L K
Sbjct: 370 CDSFWMYGSQDWMSKEAGSVMVKKLNESPGLGKADFSIVSDAGHHLYLDNPEEFNRKLLK 429

Query: 432 EMKM 435
            +K+
Sbjct: 430 FLKL 433

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/333 (23%), Positives = 130/333 (39%), Gaps = 66/333 (19%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKF--------------- 189
           +++HGY A    F +  E L+  DN   ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFESLS--DNIKDLYAIDLPANGASQAPALQVDKTKKIKPLRFKH 131

Query: 190 -------PYKYKSDPAA-------QVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAY 235
                  P   K  PA        Q E++F  R + W +   L     +  +V HS G Y
Sbjct: 132 IEDDVVVPVLDKHPPAEDIKSHLEQYENYFVDRIEQWRKDNKL----RRINVVGHSFGGY 187

Query: 236 LAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWF---------AKLWDRNISPF 286
           ++  YA KYPN   KL + SP G+ N+      +  P            ++ + R ++  
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGVENSIHAIAHKWEPNTTYPLTFTDPSSRYYTRKLNVP 247

Query: 287 SLVRNSRL--------LGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGS 338
             +  ++L        +GSKL S +    + ++  + Y+            Y + +  G 
Sbjct: 248 QFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQLYKD-----------YLLHSFVGK 296

Query: 339 GEYLLSFALKCGGD--PRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHF 396
            + +    +K       R+ + R    N +         +++YG+ DWMD   G   +  
Sbjct: 297 NQTVQPQTIKVFTHLFERNLIARDPIINNVGLLNPATHVMFMYGEHDWMDKYAGYLTTES 356

Query: 397 LNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRIL 429
           +     K S VEV  D+GH+L+ DN   F   L
Sbjct: 357 MLKNKAKASYVEVP-DAGHNLFLDNPHHFTSSL 388

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 130/329 (39%), Gaps = 66/329 (20%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKF--------------- 189
           +++HGY A    F +  E  NL DN   ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFE--NLSDNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKH 131

Query: 190 -------PYKYKSDPAA-------QVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAY 235
                  P   K  PA        Q E +F  R + W +   L     +  +V HS G Y
Sbjct: 132 IEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKL----RKINVVGHSFGGY 187

Query: 236 LAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWF---------AKLWDRNISPF 286
           ++  YA KYP+  +KL + SP G+ N+      +  P            ++ + R ++  
Sbjct: 188 ISFKYALKYPDSIEKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVP 247

Query: 287 SLVRNSRL--------LGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGS 338
             +  ++L        +GSKL S +    + ++  + Y+            Y + +  G 
Sbjct: 248 RFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKD-----------YLLHSFVGK 296

Query: 339 GEYLLSFALKCGGD--PRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHF 396
            + +    +K       R+ + R    N +         +++YG+ DWMD   G   +  
Sbjct: 297 NQTVQPQTIKVFTHLFERNLIARDPIINNVRFLNPATPVMFMYGEHDWMDKYAGYLTTES 356

Query: 397 LNTAMGKKSKVEVVHDSGHHLYFDNYEQF 425
           +     K S VE V D+GH+L+ DN + F
Sbjct: 357 MLKNKAKASYVE-VPDAGHNLFLDNPQHF 384

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 85/332 (25%), Positives = 140/332 (42%), Gaps = 56/332 (16%)

Query: 138 SGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRP---------- 187
           S  L   +++HGY A    + +N   L+   +   +++IDLP  G SS P          
Sbjct: 116 STVLTPTLLIHGYAASSMSYFRNYPGLS--KHIRDLYSIDLPASGLSSIPSLEINATTPL 173

Query: 188 ------------KFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAY 235
                       K PY   ++    V   F   +   +E+  +     +  +V HS GAY
Sbjct: 174 PLDIKFIGKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQWRIDNKLGKMNIVGHSFGAY 233

Query: 236 LAALYANKYPNHFKKLVMCSPAGICN---TPSNKQRRLPPWWF------AKLWD-RNISP 285
           L+  YA KYPN  +KL + SP G+     + +N  R   P+        +K +  RNI P
Sbjct: 234 LSFKYAVKYPNSVEKLCLVSPLGVERNIWSVNNNFRSNSPYTIDFENPSSKFYSKRNIIP 293

Query: 286 -------FSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGS 338
                  F ++R    LG+KL   +    + ++ S  Y+         +Y + +F   G 
Sbjct: 294 RYLFQQQFQILRMMGPLGAKLCWNYILAAYSRVPSLAYK---------EYIFELFYGKG- 343

Query: 339 GEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLN 398
           G   ++  +  G   R  L R    + +N    + + L +YG  DWM+   G  +   LN
Sbjct: 344 GIPAVTTEIFEGLFSRSILARDPLMDSLNSLNVR-KLLVVYGQYDWMNKNAGMLMVKELN 402

Query: 399 TAMG---KKSKVEVVHDSGHHLYFDNYEQFNR 427
             +G   +K+    +  SGH+L+ DN E FN+
Sbjct: 403 N-LGDHFEKATYTEIPFSGHNLFLDNPESFNQ 433

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 131/333 (39%), Gaps = 66/333 (19%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKF--------------- 189
           +++HGY A    F +  +  NL DN   ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFK--NLSDNIKDLYAIDLPANGASEAPALQVEGVKKIKSLRFKH 131

Query: 190 -------PYKYKSDPAAQV-------EHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAY 235
                  P   K  PA ++       E +F  R + W +   L     +  +V HS G Y
Sbjct: 132 VEDDMVTPVLDKRPPAEEIKSHLEQYESYFVDRIEQWRKDNNL----RKINVVGHSFGGY 187

Query: 236 LAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLP-----PWWF----AKLWDRNISPF 286
           ++  YA KYPN   KL + SP G+ N+      +       P  F    ++ + R ++  
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGVENSIHAINHKWEANTTYPVTFTDPSSRYYTRKLNVP 247

Query: 287 SLVRNSRL--------LGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGS 338
             +  ++L        +GSKL S +    + ++  + Y+            Y + +  G 
Sbjct: 248 QFIFENQLNVLKWMGPIGSKLCSSYISTAYVKVPDQLYKD-----------YLLHSFVGK 296

Query: 339 GEYLLSFALKCGGD--PRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHF 396
            + +    +K       R+ + R    N +         +++YG+ DWMD   G   +  
Sbjct: 297 NQSVQPQTIKVFTQLFERNLIARDPIINNVGLLNPATHVMFMYGEHDWMDKYAGYLTTES 356

Query: 397 LNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRIL 429
           +     K S +EV  D+GH+L+ DN   F   L
Sbjct: 357 MLKNKAKASYMEVP-DAGHNLFLDNPNHFTSSL 388

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 89/342 (26%), Positives = 140/342 (40%), Gaps = 57/342 (16%)

Query: 136 HPSGTLRH-LIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYK 194
           +P G +R   ++VHGY A    F +N   L+   +   ++AIDLP  G S  P  P + +
Sbjct: 90  NPKGEIRTPTLLVHGYAASSMGFHRNFPGLS--QSIKDLYAIDLPASGLS--PALPLEMR 145

Query: 195 -SDPAAQVEHWFHARFK-----TWLEKRGLLQHPEQNML-----------------VAHS 231
            + P     +     F       +L  + L+Q+ E   L                 VAHS
Sbjct: 146 CTQPLDLKINMSKDTFSLPYTINYLHHKSLIQNYEDYYLDAIEQWRHDNKLGPINIVAHS 205

Query: 232 MGAYLAALYANKYPNHFKKLVMCSPAGI------------CNTPSNKQRRLPPWWFAKLW 279
            G YL+  YA K+P+  +KL + SP G+             NT  N     P   F    
Sbjct: 206 FGGYLSFKYAVKFPHAVEKLCLVSPLGVERNIFSVNNQWRSNTSYNLDFENPASKFYIKK 265

Query: 280 DRNISPF------SLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIF 333
              I          L+RN   LG+KL+  +    + ++ S  Y+         KY + + 
Sbjct: 266 GPAIPRLVFEQQTQLLRNLGPLGAKLSWNYINAAYSRVPSLDYK---------KYVFELL 316

Query: 334 NSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRV 393
               +G    S  L  G      L R    + +  F    + + +YGD DWM+   G  +
Sbjct: 317 YGK-NGLNQTSKDLFIGLFNNRVLARDPLLDSIQFFGKSAKLMCIYGDHDWMNRRAGMEM 375

Query: 394 SHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEKEMKM 435
            +  N  +G ++K   V  SGH+L+ DN E+FN  L + +K+
Sbjct: 376 VNEANQ-LGIEAKYNEVSSSGHNLFLDNPEEFNDKLVRFLKL 416

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/325 (23%), Positives = 130/325 (40%), Gaps = 66/325 (20%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRP-----------KFPYKY 193
           +++HGY A    F +  E L+  +N   ++AIDLP  G S  P              +K+
Sbjct: 74  VLIHGYAASSMAFYRTFESLS--NNIKDLYAIDLPANGASEAPVLQVDKTKKVKSLRFKH 131

Query: 194 KSD-----------PA-------AQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAY 235
             D           PA        Q E++F  R + W +   L     +  +V HS G Y
Sbjct: 132 IEDDVVIPVLDRRPPAEDIKSHLEQYENYFVDRIEQWRKDNKL----RKINVVGHSFGGY 187

Query: 236 LAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWF---------AKLWDRNISPF 286
           ++  YA KYPN   KL + SP G+ N+      +  P            ++ + R ++  
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVP 247

Query: 287 SLVRNSRL--------LGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGS 338
             +  ++L        +GSKL S +    + ++  + Y+            Y + +  G 
Sbjct: 248 RFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKD-----------YLLHSFVGK 296

Query: 339 GEYLLSFALKCGGD--PRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHF 396
            + +    +K       R+ + R    N +         +++YG+ DWMD   G   +  
Sbjct: 297 NQTVQPQTIKVFTHLFERNLIARDPIINNVGLLNPTMHVMFMYGEHDWMDKYAGYLTTES 356

Query: 397 LNTAMGKKSKVEVVHDSGHHLYFDN 421
           +     K S +EV  D+GH+L+ DN
Sbjct: 357 MLKNKAKASYIEVP-DAGHNLFLDN 380

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 84/339 (24%), Positives = 135/339 (39%), Gaps = 61/339 (17%)

Query: 135 PHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSR-------- 186
           P  +      +++HGY A    + +N   L+       ++AIDLP  G S+         
Sbjct: 106 PAATAITTPTLLIHGYAASSMAYYRNFTGLSQTVTD--LYAIDLPANGLSAEQPFKLNGD 163

Query: 187 ------------PKFPYKYKSDPAA------QVEHWFHARFKTWLEKRGLLQHPEQNMLV 228
                        KF  ++  D +       Q E ++  + + W +   L    E+  LV
Sbjct: 164 KPRSLKVKYLDNDKFSVQHVIDESGTKQMIQQCESYYLDKIEEWRKVNKL----EKINLV 219

Query: 229 AHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLP--PWWFAKLWD------ 280
            HS G YL+  YA KYPN  +KL + SP G+  +  +   +L     +   L D      
Sbjct: 220 GHSFGGYLSFKYALKYPNSIEKLCLVSPLGVETSIYSVNNKLEKNTKYALDLEDPTSNFY 279

Query: 281 ---RNISPFSLVRNSRL------LGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYA 331
              R I  F     S +      LG+K+   W+Y      +   Y    + E    Y + 
Sbjct: 280 TRRREIPKFIFKNQSEILRWMGPLGAKMC--WNY------ILSAYSRIPEME-YKSYIFE 330

Query: 332 IFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGR 391
           +    G G    +  +      R+ L +    + + Q +AK + L +YGD DWM+   G 
Sbjct: 331 LLYGKG-GIAPTARQIFTNLFTRNLLAKDPIMDSLGQLQAK-KVLLVYGDHDWMNKYAGY 388

Query: 392 RVSHFLNTAMGKKSKVEV-VHDSGHHLYFDNYEQFNRIL 429
           ++   LNT     S   + V +SGH+L+ DN   FN  L
Sbjct: 389 KLVERLNTIRNNTSAQYIEVPESGHNLFLDNPTFFNASL 427

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 83/332 (25%), Positives = 131/332 (39%), Gaps = 70/332 (21%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRP----------------- 187
           +++HGY A    + +N   L+   +   +++IDLP  G SS P                 
Sbjct: 112 LLIHGYAASSMSYFRNYSGLS--KHFQNLYSIDLPASGLSSIPPLEVNTTTPLPLDIKFI 169

Query: 188 -----KFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYAN 242
                K PY   +     V   F   +   +E+  +    ++  +V HS G YL+  YA 
Sbjct: 170 GKNKFKIPYTINASHHKFVIQMFEDFYIDRIEQWRIDNKLDKMNIVGHSFGGYLSFKYAV 229

Query: 243 KYPNHFKKLVMCSPAGI--------CNTPSN----------------KQRRLPPWWFAKL 278
           KYPN  +KL + SP G+         N  SN                K   +P + F + 
Sbjct: 230 KYPNSVEKLCLVSPLGVERNIWSVNNNLSSNTLYTTDFKDPSSKFYSKGHLIPKYLFEE- 288

Query: 279 WDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGS 338
                  F L+R    LG+K+   W+Y      +   Y       A  +Y + +F   G 
Sbjct: 289 ------QFKLLRLMGPLGAKVC--WNY------IMAAYSRVTSL-AFKEYIFELFYGKGG 333

Query: 339 GEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLN 398
              + +   K G   R  L R    + +N    K + L +YG  DWM+   G  +   +N
Sbjct: 334 IPEVTTDIFK-GLFSRSILARDPILDSLNYLNVK-KLLVVYGQYDWMNKNAGMLLVENVN 391

Query: 399 ---TAMGKKSKVEVVHDSGHHLYFDNYEQFNR 427
                + + S +E V  SGH+L+ DN E FN+
Sbjct: 392 KLGNGLERASYLE-VPSSGHNLFLDNPESFNQ 422

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 92/393 (23%), Positives = 155/393 (39%), Gaps = 111/393 (28%)

Query: 108 DKVAEVVQTPVDEQANYINEFCVRPAMPHPSGTLRHL--IIVHGYGAGLGFFLKNLEKLN 165
           DK+ + V+    ++ + I     +    +P  +L     +++HGY A    + +    L+
Sbjct: 64  DKIMDTVEINGTKKNDLILNEINQWHFHNPEASLVDTPTLLIHGYAASSLAYFRTFSGLS 123

Query: 166 LIDNRWVIHAIDLPGYGFSSRPKFPYKYK-SDPAAQV----------------------- 201
             D    ++AIDLP +G S+ P   +K K SD   ++                       
Sbjct: 124 --DKIKNLYAIDLPSFGLSNAPPLDFKEKVSDIKIKLSDDNTKFKISDSNRVDSLDLKKL 181

Query: 202 ----EHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPA 257
               E ++  + + W +   L    E+  LV HS G Y++  YA KYP+   +L + SP 
Sbjct: 182 IGKYEDYYVEKIEDWRKANKL----EKINLVGHSFGGYISFKYAIKYPDAINRLCLVSPL 237

Query: 258 GI--------------------CNTPSN----KQRRLPPWWFAKLWDRNISPFSLVRNSR 293
           G+                       PS+    K+RR+P + F        +  +++R   
Sbjct: 238 GMESNIHSVNNNFETKKEYPLDLEDPSSRFYAKERRIPNFLFK-------NQLNVLRWMG 290

Query: 294 LLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDP 353
            +GSKL   W+Y      ++  YR                 +P   EYL       GG P
Sbjct: 291 PIGSKLC--WNY------INASYRRVP--------------NPLFKEYLFELLYGKGGMP 328

Query: 354 ------------RDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLN--- 398
                       R  L R    + +++ KA+ + L LYG+ DWM+   G  +   LN   
Sbjct: 329 SVTIDIFTNLFTRSLLARDPIMDSISKLKAE-KVLLLYGEHDWMNNLAGYNMVESLNQLK 387

Query: 399 -----TAMGKKSKVEVVHDSGHHLYFDNYEQFN 426
                + +   + VE V D+GH+L+ DN + FN
Sbjct: 388 PNNNISTIDYANYVE-VPDAGHNLFLDNPQFFN 419

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 136/350 (38%), Gaps = 89/350 (25%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRP----------------- 187
           +++HGY A    + + L  L+   N   ++ IDLP    SS P                 
Sbjct: 70  VLIHGYAASSMAYYRTLATLS--KNVKDVYVIDLPANSLSSVPPHSDISHLKINKIKVVQ 127

Query: 188 --------KF------PYKYKSDPAAQV----EHWFHARFKTWLEKR-GLLQHPEQNMLV 228
                   K+      P+ Y +    QV    E+++    + W     GL    ++  LV
Sbjct: 128 VSKDKENEKYVFKVAPPHAYDAQREKQVIDKLENYYLDVIEKWRRANYGL----DKFNLV 183

Query: 229 AHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPS------------------------ 264
            HS G YL+  YA KYP    KL + SP G+ +                           
Sbjct: 184 GHSFGGYLSFKYAIKYPEVVDKLCLVSPLGVASNIRSVNNVFDTKKEYVMDLQNPGSMLY 243

Query: 265 NKQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEA 324
           N+QR +P + F        +  ++++    +GSKLT  +    + ++ +  Y+       
Sbjct: 244 NRQRMIPNFLFN-------NQLNVLKWMGPVGSKLTRKYINSAYVKVPTMDYKD------ 290

Query: 325 IHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDW 384
              Y Y  F   G  +  +    K     R+ + R    + MN+ K+   ++ +YGD DW
Sbjct: 291 ---YLYEYFQM-GVPQVNVDIFTKLFS--RNLMARDPIMDNMNRLKS-TRFMMMYGDNDW 343

Query: 385 MDVGGGRRVSHFLN---TAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEK 431
           MD   G  +   +N       +K+    + D+GH+L+ DN E F+  L K
Sbjct: 344 MDKFSGYTLVQNINKIKNNFDRKATYVEIPDAGHNLFLDNPEDFSNNLIK 393

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 84/339 (24%), Positives = 140/339 (41%), Gaps = 70/339 (20%)

Query: 138 SGTLRHLIIVHGYGAGLGFFLKNLEKLNL-IDNRWVIHAIDLPGYGFSSRP--------- 187
           S  L   +++HGY A    F +N   L+  I N   +++IDLP  G SS P         
Sbjct: 105 STVLTPTLLIHGYAASSMSFFRNYPGLSKHIQN---LYSIDLPASGLSSIPPLEINATTP 161

Query: 188 -------------KFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGA 234
                        K PY    +    V   +   +   +E+  +     +  +V HS G 
Sbjct: 162 LPLDIEFTGKNKFKIPYTINLNHHKFVIQMYEDFYLDKIEQWRIDNKLGKVNIVGHSFGG 221

Query: 235 YLAALYANKYPNHFKKLVMCSPAGI------------CNT--------PSNK---QRRLP 271
           YL+  YA KYPN  +KL + SP G+             NT        PS+K   +R + 
Sbjct: 222 YLSFKYAAKYPNSVEKLCLVSPLGVERNIWSINNNFRSNTLYTIGFEDPSSKFYSKRNMI 281

Query: 272 PWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYA 331
           P +   L++R    F L+R    +G+KL   +    + ++ S  Y+         +Y + 
Sbjct: 282 PKY---LFERQ---FQLLRMMGPVGAKLCWNYIMAAYSRVPSLAYK---------EYIFE 326

Query: 332 IFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGR 391
           +F   G    + +   K G   R  L +    + ++    + + + +YG  DWM+   G 
Sbjct: 327 LFYGKGGIPEVTTEIFK-GLFSRCILAKDPLMDSLHYLNVR-KLMVVYGQYDWMNKKAGM 384

Query: 392 RVSHFLNT---AMGKKSKVEVVHDSGHHLYFDNYEQFNR 427
            +   LN+    + K S +E+   SGH+L+ DN   FN+
Sbjct: 385 LMVENLNSLGNCLEKASYLEIP-SSGHNLFLDNPLSFNQ 422

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 85/330 (25%), Positives = 133/330 (40%), Gaps = 62/330 (18%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVE-H 203
           +++HGY A    + +  +   L D    ++ IDLP  G S         ++ P  +VE H
Sbjct: 62  LLIHGYAASSMAYYRTFQ--GLTDKISDLYTIDLPSNGLSKELPLILDGQTPPPLKVEIH 119

Query: 204 WFHARFKTWLEK------RGLLQHPEQNML-----------------VAHSMGAYLAALY 240
              ++FK  +E+      R +++  E   L                 V HS G Y+A  Y
Sbjct: 120 KDGSKFKI-IERVDAEHCRSVVKQYEDYYLDSIELWRKHNGIGRFNLVGHSFGGYIAFKY 178

Query: 241 ANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLT 300
           A KYP   ++L + SP G+    SN       W    +++      S    SR+ G    
Sbjct: 179 AVKYPKAVEQLGLISPLGV---ESNIYSVNNDWKLDTVYEME----STDPASRMYGKN-- 229

Query: 301 SGWS-----YRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEY---LLSFALKCGGD 352
             W      + R  +LL   + G    +    Y  A +N   + EY   +       GG 
Sbjct: 230 --WEIPKVLFERQTELLR--WMGPIGAKLCWNYITAAYNKLPTMEYKDYVFELLYGNGGI 285

Query: 353 PRDA------------LERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTA 400
           P+ A            L R    + M++  A+ + L LYGD DWM+   G R+   LN  
Sbjct: 286 PKTARKVFGGLFTRSLLARDPIMDSMDKLGAR-KVLLLYGDSDWMNNYAGYRMVELLNQK 344

Query: 401 MGKK-SKVEVVHDSGHHLYFDNYEQFNRIL 429
            GK  +  + V D+ H+L+ DN + FN  L
Sbjct: 345 RGKGYATYDEVPDARHNLFLDNPDSFNDKL 374

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 128/333 (38%), Gaps = 67/333 (20%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSR------------------ 186
           +++HGY A    F +N E+L+L  +   ++A+DLPG G S                    
Sbjct: 90  LMIHGYAASSMTFFRNFEQLSL--SLKDVYAVDLPGNGLSKELPLSVDSMQKPDRVEFNE 147

Query: 187 -----------PKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAY 235
                      P    KYK    A  E ++    + W ++  L     +  LV HS G Y
Sbjct: 148 TVKGQYFRLQNPVDEEKYKKH-LAHYEDYYVDALEKWRKENKL----SKINLVGHSYGGY 202

Query: 236 LAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWD-----------RNIS 284
           L   Y+ KYP++  KL + SP G+  +  +    L P    ++             RNI 
Sbjct: 203 LTFKYSLKYPDNVHKLCLVSPLGVERSIFSIHNHLEPERDYEIQSEDPSKSNYSNKRNIP 262

Query: 285 PFSLVRNSRL------LGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGS 338
              L   ++       LG+K   G+    +G++ S  YR    F+ +         S   
Sbjct: 263 KLILQYQNKALRWMGPLGAKACWGYVNSSYGRVPSVPYR-EYVFQLVFGKGIMTDTSIRI 321

Query: 339 GEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWL-YGDQDWMDVGGGR-RVSHF 396
              L S +L       D+L+           K K   L L YG+ DWM+   GR  +  F
Sbjct: 322 FNQLFSRSLLAYDPIMDSLD-----------KVKVSKLMLVYGEHDWMNKVAGRLAIEEF 370

Query: 397 LNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRIL 429
            +         ++V  +GH+L  DN  +FN  L
Sbjct: 371 NSIRKSYDGTFDIVSRAGHNLVLDNPSEFNSKL 403

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 129/324 (39%), Gaps = 52/324 (16%)

Query: 145 IIVHGYGAGLGFFLKNLEKLN-LIDNRWVIHAIDLPGYGFSSRPKFPYKYK-SDPAAQVE 202
           +++HGY A    F +N   L+  I N   ++AIDLP  G S     P      +P     
Sbjct: 100 LLLHGYAAASMGFHRNFAGLSSRIQN---LYAIDLPANGLSPGSSQPLVVSCGEPLPMKA 156

Query: 203 HWFHARFKT-----WLEKRGLLQHPEQNML-----------------VAHSMGAYLAALY 240
            + + RFK      +L ++  +Q  E   L                 VAHS G YL+  Y
Sbjct: 157 EFSNDRFKIPYTLEYLHQKSFIQQLEDYYLNSIEQWRIDNKLNKINIVAHSFGGYLSTKY 216

Query: 241 ANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLW-DRNIS-PFSLVRNSRLLGSK 298
           A KYP+  ++L + SP G+     +        W +  W D N   P S     R+ G  
Sbjct: 217 AIKYPHAVERLCLVSPLGVERNIHSVNNH----WCSNTWYDLNYEDPGSKYYMRRMRGIP 272

Query: 299 LTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALE 358
            T   S  +  +LL  G  GA+        AY+   +    EY+        G  + A++
Sbjct: 273 STVFQSQVKLLRLL--GPLGAKLCWNYINAAYSRVKNEKYKEYVFELFYGKEGVTQTAMD 330

Query: 359 RRLFHNKMN-QFKAK------------CEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKK- 404
             +F N    Q  AK               +  YG+ DWM+   G  ++   N   GK  
Sbjct: 331 --IFTNLFTRQLLAKDPLMDSLQHLHVGRLMLAYGEHDWMNKYAGVLMTKEFNHLRGKSD 388

Query: 405 -SKVEVVHDSGHHLYFDNYEQFNR 427
            +   V+  SGH+++ DN ++FN 
Sbjct: 389 AATYTVISSSGHNMFLDNPDEFNE 412

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 105/446 (23%), Positives = 167/446 (37%), Gaps = 148/446 (33%)

Query: 81  YFAFRK-----DAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMP 135
           YF F K        TLQ +++S + F    GD      +      Q ++ N       + 
Sbjct: 5   YFKFNKCEPTNKLKTLQDEIVSNIEF---HGDVTTTNTMLFDEINQWHFHNNAVNGDLIE 61

Query: 136 HPSGTLRHLIIVHGYG----------AGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSS 185
            P+      ++VHGY           AGL  ++K+L            ++IDLP +G S 
Sbjct: 62  TPT------LLVHGYATSSLAYYRNFAGLSSYIKDL------------YSIDLPTFGLSK 103

Query: 186 RPKFPYKY--------------KSDPAAQV---------------------------EHW 204
            P+ P +               KSD   ++                           E++
Sbjct: 104 TPELPTRKVTKNLKVTLSNSNDKSDDPKKITSFQLSKDDIKHNEKYYNETKKELEINENY 163

Query: 205 FHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPAG------ 258
           +  R + W  +  L    ++  LV HS G YL+  YA KYP+  +KL + SP G      
Sbjct: 164 YIDRIEKWRIENKL----DKINLVGHSFGGYLSYKYATKYPDSIEKLCLVSPLGMESNIY 219

Query: 259 -ICNTPSNKQ-----------------RRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLT 300
            I N   N +                 R +P + F        +  +++R    +GS LT
Sbjct: 220 SINNKFENDKIYEIEEEDPSSIFFTNTRTIPKFLFN-------NQLNVLRWLGPVGSTLT 272

Query: 301 SGW---SYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLS-----FALKCGGD 352
             +   SYRR    L + Y        IH+    I+   G  E  +      F  K    
Sbjct: 273 WKYIKASYRRVDDALYKDY--------IHE---LIYGKGGMEETTIKTFTNLFTTKL--- 318

Query: 353 PRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMG-KKSKVEVVH 411
               L +    + +++ KAK   L LYG +DWM+   G +++  LN   G   SKV  ++
Sbjct: 319 ----LAKDPITDTVDKLKAK-NVLLLYGQEDWMNNYAGYQMTKKLNELKGYNTSKVGELN 373

Query: 412 --------DSGHHLYFDNYEQFNRIL 429
                   ++GH+L+ DN   FN+ L
Sbjct: 374 YATYMEVPEAGHNLFLDNPSFFNKAL 399

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 86/363 (23%), Positives = 149/363 (41%), Gaps = 53/363 (14%)

Query: 105 AGDDKVAEVVQTPVDEQA----NYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFLKN 160
           A ++K+ E V  P  +      N INE+      P+ S      +++HGY A    F + 
Sbjct: 30  ALEEKIMEKVTVPGTKTNQMVNNEINEWHFHN--PNASKIKTPTLLIHGYAASSMAFHRT 87

Query: 161 LEKLNLIDNRWVIHAIDLPGYGFSSRPK--------------------FPYKYKSD---- 196
             +L+   +   ++AIDLPG G SS P+                    F  K   D    
Sbjct: 88  FNRLS--TDIKDLYAIDLPGNGLSSAPELSDVIKMKDLKITLNKSKDGFTLKKAIDLEIE 145

Query: 197 --PAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMC 254
               A+ E+++ +R   W +  G+    E+  ++ HS G +++  YA  +PN    L++ 
Sbjct: 146 KANLAKYENYYLSRIDEWRKFHGI----EKLNVIGHSFGGFISFKYAITHPNQVNDLILV 201

Query: 255 SPAGI-CNTPS-NKQRRLPPWWFAKL-------WDRNISPFSLVRNSRLLGSKLTSGWSY 305
           SP G+  N  S N    L   +           + R+ +  S++ N++L   +       
Sbjct: 202 SPLGMEKNIHSLNNNFELETKYTLDFENPASLYYARSFNVPSILFNNQLNILRWMGPLGG 261

Query: 306 RRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNK 365
           R   Q +   Y+      A   Y Y +F   G     ++         ++ L R    + 
Sbjct: 262 RMARQYIDMAYKKVPDV-AYKNYLYYVF-YDGKSFPKVTINNFTNMFSKNLLARDPIMDN 319

Query: 366 MNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGK-KSKVEVVH--DSGHHLYFDNY 422
           + + +AK + + +YG+ DWMD   G  +   L+ +  K K  V  V   D+GH+L+ DN 
Sbjct: 320 LLKLRAK-KVMLVYGEHDWMDKYAGYNMVELLSKSNYKLKDTVHYVEIPDAGHNLFLDNP 378

Query: 423 EQF 425
             F
Sbjct: 379 TDF 381

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 124/316 (39%), Gaps = 60/316 (18%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSR-PKFPYKYKS-------- 195
           +++HGY +    F +NL  L     +  ++A+DLPG G S   P  P   ++        
Sbjct: 86  VLLHGYASSAVSFHRNLAALGAQVEQ--LYALDLPGNGMSQELPLGPAAARALARRCGAR 143

Query: 196 -DPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMC 254
            D  A  +++  A  + W    GL    E      HS G YLA  YA ++P   ++L + 
Sbjct: 144 ADIRALADYYLDA-LERWRAANGL----ETLNAAGHSFGGYLAFKYALRHPARVQRLCLV 198

Query: 255 SPAGICNTPSNKQR-----------------------RLPPWWFAKLWDRNISPFSLVRN 291
           SP G+    + ++                         LPP  F +          ++R 
Sbjct: 199 SPLGVEAQTAGRRMPGRATRRRTRPPTPASPHYTRAAALPPLLFEQ-------QLRVLRW 251

Query: 292 SRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGG 351
              LG+ L   +    F ++    +         H+Y +A+ +        L   L  G 
Sbjct: 252 LGPLGAHLLWQYVNASFSRVPGREF---------HRYTFALLHRLALRP--LPRKLFTGL 300

Query: 352 DPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGK-KSKVEVV 410
                L R    + + + K     L LYGD DWMD   GR +   LN   G+  + + +V
Sbjct: 301 FTNALLARDPLLDSLAELKVPNVQL-LYGDHDWMDARAGRALVAELNALRGRPDASLAIV 359

Query: 411 HDSGHHLYFDNYEQFN 426
             +GH+L+ DN E F+
Sbjct: 360 PAAGHNLFLDNPEDFH 375

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 129/328 (39%), Gaps = 62/328 (18%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNL-IDNRWVIHAIDLPGYGFSSRP---------------- 187
           +++HGY A    F +N   L+  I N   +++ID+P  G SS P                
Sbjct: 130 LLIHGYAASSMSFFRNYPGLSKHIRN---LYSIDMPASGLSSVPSLEINTTTPLPLDIKF 186

Query: 188 ------KFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYA 241
                 K PY   ++    V   +   +   +E+  +     +  +V HS G YL+  YA
Sbjct: 187 IGENKFKVPYTINANHNKFVIQMYEDFYLDRIEQWRIDNKLGKMNVVGHSFGGYLSFKYA 246

Query: 242 NKYPNHFKKLVMCSPAGI------------CNTPSNKQRRLPPWWFAKLWDRNISP---- 285
            KYPN   KL + SP G+             NT      + P   F     RN+ P    
Sbjct: 247 VKYPNSVNKLCLVSPLGVERNIWSVNNNFHSNTLYTIDFKNPNSKFYS--KRNMIPKYLF 304

Query: 286 ---FSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYL 342
              F ++R    LG+KL   +    + ++ S  Y+         +Y + +F   G    +
Sbjct: 305 EQQFHILRMMGPLGAKLCWNYIMAAYSRVPSLAYK---------EYIFELFYGKGGIPEV 355

Query: 343 LSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLN---T 399
            +   K     R  L +    + +     K + L +YG  DWM+   G  +   LN    
Sbjct: 356 TTDIFKALFS-RCILAKDPLMDSLQYLNVK-KLLIVYGQYDWMNKKAGMFMVKELNNLKN 413

Query: 400 AMGKKSKVEVVHDSGHHLYFDNYEQFNR 427
            +   S +E +  SGH+L+ DN E FN+
Sbjct: 414 CLEGASYLE-IPSSGHNLFLDNPESFNQ 440

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 83/336 (24%), Positives = 129/336 (38%), Gaps = 77/336 (22%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFS---------SRP-------- 187
           +++HGY A    F +N E L+       ++AIDLP  G S         + P        
Sbjct: 100 LLLHGYAASSMAFHRNFEGLSKCIRD--LYAIDLPANGLSPPQPLEIRCTEPQPLKIEIS 157

Query: 188 ----KFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANK 243
               K PY   S         F   +   LE+  L        +VAHS G Y++  YA K
Sbjct: 158 NDTFKLPYTINSLHHKSAIQNFEDYYLDALEQWRLDNKLGPINIVAHSFGGYISFRYAVK 217

Query: 244 YPNHFKKLVMCSPAGI--------CNTPSNKQRRL-----------------PPWWFAKL 278
           YP+  K+L + SP G+         N  SN Q +L                 PP  F   
Sbjct: 218 YPHAVKRLCLLSPLGVERNIFSVNNNWRSNTQYKLDFENPASKFYIRKGPAIPPAIFELQ 277

Query: 279 WD--RNISPFSLVRNSRLLGSKLTSGWS---YRRFGQLLSEGYRGAQQFEAIHKYAYAIF 333
               R + P      +RL  + +T+ ++     ++ Q + E + G     A+ + +  IF
Sbjct: 278 TKVLRGLGPLG----ARLCWNYITAAYARVPSLKYKQYIFEMFYGKN---ALTQTSKDIF 330

Query: 334 NSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRV 393
               +   L           RD L   L H +  +       L +YGD DWM+   G  +
Sbjct: 331 TGLFTNRLL----------ARDPLLDSLCHVRSKKL------LLMYGDHDWMNRKAGLEM 374

Query: 394 SHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRIL 429
                  +G  ++   V  SGH+L+ DN E+ N ++
Sbjct: 375 VTEAK-KLGIDAQYGEVSSSGHNLFLDNPEESNELI 409

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 144/356 (40%), Gaps = 94/356 (26%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWV--IHAIDLPGYGFSSRP---------KFPYKY 193
           ++VHGYGA    + +    L+    R +  ++AIDLP  G S  P         K  +K 
Sbjct: 48  LLVHGYGASSMAYHRCFAPLS----RHIRDLYAIDLPANGLSEAPPLVAEGEAPKAKFKI 103

Query: 194 K-------------SDPAAQVEHWFHARFKTWLEKRGLLQH-------------PEQNM- 226
           +             ++P    +       +T  EKR  LQ               E N+ 
Sbjct: 104 EENKFTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQWRKENNLD 163

Query: 227 ---LVAHSMGAYLAALYANKYPNHFKKLVMCSPAG-------ICNT-------------P 263
              LV HS G YL+  YA KYP    KL + SP G       I NT             P
Sbjct: 164 KFNLVGHSFGGYLSYKYALKYPESVNKLCLLSPLGMERNIHSINNTFEENVVYELQESDP 223

Query: 264 SN----KQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGA 319
           S+    ++R+ P + F        + FS++R    +G KL   +    + ++ S+ Y+  
Sbjct: 224 SSYLYTRKRKAPKFLFE-------NQFSVLRWMGPIGDKLCLSFINSSYAKVPSQAYKD- 275

Query: 320 QQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLY 379
             FE+     +    +  + ++L +         R  L R    + +++ K   +    Y
Sbjct: 276 YLFESFLGKKHFAKQNVHALKHLFT---------RSLLARDPIMDTIDKLKVP-DVSVFY 325

Query: 380 GDQDWMDVGGG----RRVSHF--LNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRIL 429
           GD DWM+   G     R+  F   +T+ G  S +EV  D+GH+L+ DN + F++ L
Sbjct: 326 GDHDWMNSYAGYLMVERLKKFRVASTSGGSASYLEVP-DAGHNLFLDNPDYFSKKL 380

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 120/323 (37%), Gaps = 48/323 (14%)

Query: 144 LIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFS------------------- 184
           ++++HGY +    + +N   L+       ++AIDLP  G S                   
Sbjct: 111 VLLIHGYASSSMSYFRNFRGLS--SQCKDVYAIDLPANGLSREISLSEDADLKDLVKYSL 168

Query: 185 --------SRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYL 236
                    + K    Y +   A         +   +E+  +    +Q  LV HS G Y+
Sbjct: 169 QVKGLDSPGQVKVTKPYNNKLCATQLRILEDYYVDEIERWRVENQIDQLHLVGHSFGGYI 228

Query: 237 AALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRLLG 296
           +  YA KYP +  KL + SP G+     +    LP     +    + S  S +R   +  
Sbjct: 229 SYKYALKYPQNVMKLALISPLGVERNLYSVNNHLPQDSIVQGTFEDPSSPSYLRKLEVPR 288

Query: 297 SKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDA 356
               +     R+G     G  GA+        AYA   S    EYL       GG  + A
Sbjct: 289 YIFENQLKILRWG-----GPMGARLCWNYITSAYAKVPSREFKEYLFELFYGDGGITKTA 343

Query: 357 LE------------RRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKK 404
           L             R    + + + K K + ++ YG  DWM+   G R +  L       
Sbjct: 344 LTTFILLFTRNLLARDPIMDSIAELKVK-DVMFQYGQYDWMNKNAGARAAELLRKQPYNN 402

Query: 405 SKVEV-VHDSGHHLYFDNYEQFN 426
           S + + + +SGH+L+ D+ + FN
Sbjct: 403 SALYLEIPESGHNLFLDSPQSFN 425

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 123/344 (35%), Gaps = 84/344 (24%)

Query: 145 IIVHGYGAGLGFFLKNLEKL-NLIDNRWVIHAIDLPGYGFSSRPKF-------------- 189
           +++HGY A    F  N+  L N   +  V+   DLP  G S  P                
Sbjct: 84  VLIHGYAASSMAFHLNVAGLSNAFSDLCVV---DLPANGLSREPPMLGPKVKGQPVHWKE 140

Query: 190 --------------PYKYKS----DPAAQVEHWFHARFKTWLEKRGLLQHPEQNM-LVAH 230
                         P K  S    D     E +F  R + W      L H   N+ +V H
Sbjct: 141 LDKKTGSLTVVCEPPSKMSSSGVLDDPGVYEDYFVDRIEKWR-----LAHGFDNINVVGH 195

Query: 231 SMGAYLAALYANKYPNHFKKLVMCSPAGI---CNTPSNKQRRLPPWWFAKLWDRN----- 282
           S G Y++  YA KY  H  KLV+ SP G+    ++ SNK      W   K +D       
Sbjct: 196 SFGGYMSFKYAIKYSKHVDKLVLLSPLGVERNIDSVSNK------WDVGKTYDLTDIDAT 249

Query: 283 ----ISPFS-----------LVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHK 327
                 PF+           ++R    LG+ +       R+  +    Y        +H 
Sbjct: 250 SPLYYRPFTVPGYLFNNQLNVLRKMGPLGNHMAKRAIASRYSNVPGTAYHA-----YLHH 304

Query: 328 YAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDV 387
             Y     P +     +         RD L   +   K+N+       + +YGD DWM+ 
Sbjct: 305 VFYGAHTFPSANITAFTHLFTRQLLARDPLLDNIQRLKVNKL------MMVYGDHDWMNK 358

Query: 388 GGGRRVSHFLNTA--MGKKSKVEVVHDSGHHLYFDNYEQFNRIL 429
             G  +   +N    +  K+    +  +GH+L+ DN   FN++L
Sbjct: 359 EAGYGMVQEINKERYVPAKAVYAELPSAGHNLFLDNPSGFNKLL 402

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 77/342 (22%), Positives = 127/342 (37%), Gaps = 74/342 (21%)

Query: 145 IIVHGYGAGLGFFLKNLEKLN--LIDNRWVIHAIDLPGYGFSSRPKF---------PYKY 193
           +++HGY      F +    L+  + D    ++AID P  G S  P           PYK 
Sbjct: 107 LLLHGYATSSIAFFRTFGPLSKQIRD----LYAIDFPANGLSKAPPLNVNHLKKHTPYKV 162

Query: 194 K---SDPAAQVEHWFHARFK------------TWLEKRGLLQHPEQNMLVAHSMGAYLAA 238
           K    +   Q+ H    + +              + K  L    E+  LV HS G Y A 
Sbjct: 163 KFKDDNTKFQISHTVDVQLQKETIEHYENYYLDAVRKWQLTNKIEKFNLVGHSFGGYFAY 222

Query: 239 LYANKYPNHFKKLVMCSPAGI--------------------CNTPSNK----QRRLPPWW 274
            YA +YP+   KL + SP G+                       P++K      ++P   
Sbjct: 223 KYALRYPDSVDKLCLVSPLGVERNIYSVNNNFEDKKVYNLELEDPTSKYYGRTFQIPKCL 282

Query: 275 FAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFN 334
           F          F ++R    LG + T  W+Y      ++  YR     E   +Y + +  
Sbjct: 283 FE-------GQFDILRKFGPLGPRFT--WNY------INSSYRRVPSME-FKEYIFELLY 326

Query: 335 SPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVS 394
                  +L+         R+ L R    + +++ KA    L +YG +DWM+   G  + 
Sbjct: 327 GNRKTSPILTEVF-SNIVSRNLLARDPILDSIDELKASNVML-MYGQEDWMNSQAGYLMV 384

Query: 395 HFLNTAMGKKSKVEVVH--DSGHHLYFDNYEQFNRILEKEMK 434
             LN      +    V   ++GH+L+ DN + F   L + +K
Sbjct: 385 KELNEIRENPNAASYVEVPNAGHNLFLDNPDFFCSSLTRFLK 426

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 77/338 (22%), Positives = 129/338 (38%), Gaps = 68/338 (20%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSS--------------RPKF- 189
           +++HGY      + +N+ +L+  +    ++ IDLP  G S               +P+F 
Sbjct: 87  LLLHGYATSSMCYHRNMPQLS--EGIKHLYTIDLPANGLSKELPLELDIAKPIVFKPEFN 144

Query: 190 --------PYK----YKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLA 237
                   PY     +      ++E ++    + W  K  L        LV HS G Y++
Sbjct: 145 SVKSEFHIPYTIDGLHHRCAIQKLEDYYIDSIELWRRKNSL----GAINLVGHSFGGYIS 200

Query: 238 ALYANKYPNHFKKLVMCSPAGI---CNTPSNKQRRLPPWWF-------AKLWDRNISP-F 286
             Y+ KYP + KKL + SP G+     +  N  R   P+             ++ + P F
Sbjct: 201 FKYSIKYPQNVKKLCLISPIGVERNIYSVHNNWRSNCPYSIDYEDPSSKHFANKTMIPEF 260

Query: 287 SLVRNSRL------LGSKLTSGWSYRRFGQLLSEGYRGAQQF---EAIHKYAYAIFNSPG 337
                ++L      LG+KL  GW Y      ++  Y     F   E I    Y       
Sbjct: 261 VFNEQTKLLRLMGPLGAKL--GWKY------INAVYSKVPNFLYLEFIFTLIYGKNVMTD 312

Query: 338 SGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFL 397
           +   + ++        RD +   L H  +++       L LYG+ DW+    G+ +    
Sbjct: 313 TSRNIFTYLFTNSLLARDPMLDSLEHLHVDKL------LMLYGEHDWVRSQPGKMMVEEF 366

Query: 398 NTAMGKKS-KVEVVHDSGHHLYFDNYEQFNRILEKEMK 434
           N      S  + VV D+ H+L+ DN   FN  L   +K
Sbjct: 367 NKQRSHPSGTLTVVPDASHNLFLDNPVFFNVALLNFLK 404

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 82/343 (23%), Positives = 125/343 (36%), Gaps = 90/343 (26%)

Query: 145 IIVHGYGAGLGFFLKNLEKL--NLIDNRWVIHAIDLPGYGFSSR---------PKFPYKY 193
           +++HG+ +    F +N   L  +++D    ++AIDLP  G S           PK   K+
Sbjct: 91  LLLHGFASSSMSFFRNFTGLSQDIMD----LYAIDLPANGLSRSLSTKFYRVSPKETRKF 146

Query: 194 KSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNML-----------------VAHSMGAYL 236
                   +   H  +     ++ L+Q  E   +                 VAHS G YL
Sbjct: 147 DMLDDIHFQLLSHGNYHA---EKELIQKCEDYYIDTIERWRRSNELHKINIVAHSFGGYL 203

Query: 237 AALYANKYPNHFKKLVMCSPAGI------CNTPSN-----KQRRLPPWWFAKLWDRNI-- 283
           +  YA KYP    KL + SP G+       N   N        RL P     + +  I  
Sbjct: 204 SFKYALKYPESINKLCLVSPLGVEANIYSINNNFNVGETYTVNRLDPSSCCYINENEIPK 263

Query: 284 ----SPFSLVRNSRLLGSKLTSGW---SYRRFGQLLSEGY-------RGAQQFEAIHKYA 329
               + F ++R S  +G+KL   +   SY R   L  + Y       +G     AI+ + 
Sbjct: 264 YVFDNLFKILRLSGPIGAKLCWNYVLSSYSRISSLDFKRYVFELLYGKGGMTATAINLFT 323

Query: 330 YAIFNSPGSGEYLLSFA--LKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDV 387
                   + + L+  A  L C G                        L LYG+ DWM  
Sbjct: 324 QLFTTRLLARDPLMDSAHSLSCNG-----------------------ILLLYGEYDWMAK 360

Query: 388 GGGRRV---SHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNR 427
             G+ +       N     K+K   V  SGH+L+ DN   FN+
Sbjct: 361 NAGKSLLTNCKADNKGSASKTKYLEVPKSGHNLFLDNPAFFNK 403

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 76/341 (22%), Positives = 129/341 (37%), Gaps = 84/341 (24%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFS----------SRPKFPYKYK 194
           +++HGY A    F +    L+  +N   ++AIDLP  G S           +  +  KYK
Sbjct: 98  LLLHGYAASSMSFYRTFAPLS--NNFKNLYAIDLPANGLSVAIPLKITKQRKRLYEVKYK 155

Query: 195 SDP----------------AAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAA 238
            +                   Q E+++    ++W     +  + E+  LV HS G Y + 
Sbjct: 156 ENNKFSISYPVPIEEQKPLIEQYENYYLDAMRSW----QVANNIEKFNLVGHSFGGYFSF 211

Query: 239 LYANKYPNHFKKLVMCSPAGI--------------------CNTPSN----KQRRLPPWW 274
            YA ++P+   KL + SP G+                       P++    K+ ++P + 
Sbjct: 212 KYALRFPDSINKLCLVSPLGMESNIFSIHNKFEENKIYNVNLTDPTSPFYGKKFQIPNYL 271

Query: 275 FAKLWD--RNISPFS--LVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAY 330
           F    D  R + PF   L  N  L   K      Y+ +   L E + G +Q         
Sbjct: 272 FENQLDVIRKLGPFGARLCWNYILSAYKRVPSMEYKEY---LFELFYGNRQV-------- 320

Query: 331 AIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGG 390
               SP   E   +         R+ L R    + ++Q +     L +YG+ DWM+   G
Sbjct: 321 ----SPILCELFTNLL------TRNLLARDPILDSIDQLQL-SNVLVMYGEHDWMNRYAG 369

Query: 391 RRVSHFLNTAMGKKSKVEVVH--DSGHHLYFDNYEQFNRIL 429
             +   LN      +  + +    +GH+L+ DN E F+  L
Sbjct: 370 YCMVSRLNNIRRTPNTAQYLQVPAAGHNLFLDNPEYFSSAL 410

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 74/324 (22%), Positives = 124/324 (38%), Gaps = 66/324 (20%)

Query: 145 IIVHGYGAG-LGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRP---------------- 187
           +++HGY A  L FF   +     I N   ++A DLPG G S                   
Sbjct: 112 LLLHGYAASSLCFFRTFVPLSRSIKN---LYATDLPGNGLSKNKSFFSVMYGNEYMKVKY 168

Query: 188 ----KFPYKY------KSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLA 237
               KF  KY      +++     E ++    + W     L   P+ N LV HS G YL+
Sbjct: 169 EENNKFSIKYLNSLKDQTNSIKHSEDYYIDAIREWQLSNNL---PKIN-LVGHSFGGYLS 224

Query: 238 ALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWF---------AKLWDRNIS---- 284
             YA +YP++  KL + SP G+ +   +    L   +          +  + RN +    
Sbjct: 225 FKYALRYPDNVNKLCLVSPLGVESNLYSVNNSLKENYLYDVDYSDPKSSYYSRNFAIPKS 284

Query: 285 ----PFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGE 340
                F ++R    +G+++   +    + ++ S  Y+    F  +   A  +  S  +  
Sbjct: 285 LFEGQFGILRWMGPIGARVCWNYILSSYKRVPSMKYK-EYLFHLLFGNAKKLVTSAKTFT 343

Query: 341 YLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLW-LYGDQDWMDVGGGRRVSHFLNT 399
            L +  L       D++E           K +CE L  +YG  DWM+   G  +   LN 
Sbjct: 344 NLFTRNLLAKDPIMDSIE-----------KLQCEKLMVMYGQHDWMNKYAGYCLIAKLNN 392

Query: 400 AMGKKSK--VEVVHDSGHHLYFDN 421
               K       + ++GH+L  DN
Sbjct: 393 YRSTKDAGYFTEIPEAGHNLILDN 416

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 74/323 (22%), Positives = 126/323 (39%), Gaps = 61/323 (18%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRP----------------- 187
           +++HGY A    F +++  LN   +   ++ IDLPG G S  P                 
Sbjct: 110 VLIHGYAATSTAFFRSIPYLN--RDIKDLYTIDLPGNGLSFTPSLDLEVSKPLPLKIENI 167

Query: 188 ------KFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYA 241
                 + PY   S     V       +   +E+  L     +  +VAHS G YL+  YA
Sbjct: 168 DDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQWRLDNKLGKINVVAHSYGGYLSFNYA 227

Query: 242 NKYPNHFKKLVMCSPAGI------CNTPSNKQRRLPPWW---FAKLWDRNISPFSLVRNS 292
            KYP +   L + SP G+       N   + +      W    +  +DR       +   
Sbjct: 228 LKYPANINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKFKLNDYLFQK 287

Query: 293 RL--------LGSKLTSGWSYRR--FGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYL 342
           +L        +G+KL   W+Y R  + ++ S  Y+    FE      Y     P     +
Sbjct: 288 QLKPLRWLGPIGAKLC--WNYIRSAYARVPSIDYKDY-TFETF----YGRGGLPEQTSQI 340

Query: 343 LSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMG 402
            +  L      RD L      + ++Q +   + + +YG  DWM+  GG+ ++   N    
Sbjct: 341 FTSLLTSSLLARDPLL-----DHVSQLQVP-KLIMMYGQYDWMNKNGGKLMTQIFN---- 390

Query: 403 KKSKVEVVHDSGHHLYFDNYEQF 425
            ++K   + ++GH+L+ DN   F
Sbjct: 391 GETKYIDIPNAGHNLFLDNPSDF 413

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 88/220 (40%), Gaps = 38/220 (17%)

Query: 72  RSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVR 131
           R++++ V  Y    +D  TL  Q+       P    D     + T   EQ   +N   VR
Sbjct: 23  RTLEDIVSSY----EDGPTLSSQITD-----PANAGDFRLNFIST--HEQYCTVNGIKVR 71

Query: 132 PAMPHPSGTLRHL-IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFP 190
                 +   + L I +HG G  L  F   L+ L+L +  +V  AIDLPG+G S      
Sbjct: 72  VCHNLSTANGKTLSIFIHGLGGSLDQFFPLLKLLDLSEKYFV--AIDLPGFGKSD----- 124

Query: 191 YKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLA----ALYANKYPN 246
            ++   P  QV     A     L +  L     +  L+ HSMG YL      L++ KY  
Sbjct: 125 -EHTDYPMIQVVKHIDAVISELLNEARLAFDTVR--LIGHSMGCYLTLHFMTLFSKKY-- 179

Query: 247 HFKKLVMCSPAGICNTPSNKQRRL----------PPWWFA 276
              K+V+ +P        NK +RL           PW F+
Sbjct: 180 RIGKVVLLAPPKPEMIELNKDKRLVQVALNVLFRVPWVFS 219

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 59/117 (50%), Gaps = 16/117 (13%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHW 204
           I +HG G  L  FL  L KL  + N+  I A+DLPG+G   + +F  +Y       + ++
Sbjct: 93  IFIHGLGGSLEQFLP-LLKLTDLSNKSFI-AVDLPGFG---QSEFNDEYN------IANY 141

Query: 205 FHARFKTWLEKRGLLQHPEQN---MLVAHSMGAYLAALYANKYPNHF--KKLVMCSP 256
             +    +L+ +   ++   N   +L  HSMG YLA  +  +Y   +  +K+V+ +P
Sbjct: 142 SMSSIIGFLKSQVFSRYLTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 53/114 (46%), Gaps = 14/114 (12%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHW 204
           + +HG G  L  F   L  L+L +N+++  A+DLPG+G S       +Y+      V   
Sbjct: 93  LFIHGLGGVLEQFEPLLRLLDLNENKFL--ALDLPGFGKSD------EYEDYNMFDVISI 144

Query: 205 FHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAA-LYANKYPN-HFKKLVMCSP 256
            H      + +R         +LV HSMG Y++  L+   Y    FKKLV  SP
Sbjct: 145 IHTIVDRLIPERT----TSNIVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP 194

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 76/199 (38%), Gaps = 57/199 (28%)

Query: 114 VQTPVDEQANYINEFCVRPAMPHP---------------SGTLRH-LIIVHGYGAGLGFF 157
           +QT  D Q+  +++  +   M +                + T++   +++HGY A    +
Sbjct: 7   IQTLTDLQSKVMDDISISGTMDNSMAFNEINQWHFHNANASTIKTPTVLIHGYAASSMAY 66

Query: 158 LKNLEKL--NLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVE------------- 202
            K    L  ++ D    ++ IDLPG+G S+ PK      +   +Q +             
Sbjct: 67  YKTFRYLTGSIKD----LYTIDLPGFGLSASPKIIINDHNRKKSQFDIKLIDSKDSNNNK 122

Query: 203 ------------------HWFHARFKTW----LEKRGLLQHPEQNMLVAHSMGAYLAALY 240
                               F + F  +    +EK     +  +  ++ HS G Y++  Y
Sbjct: 123 FSISKKNLKLLENGNIEDKAFISAFDDYYIDRIEKWRKFNNLGKINVIGHSFGGYISFKY 182

Query: 241 ANKYPNHFKKLVMCSPAGI 259
           A KYP+  + L + SP G+
Sbjct: 183 AIKYPDSIENLCLVSPFGM 201

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 20/139 (14%)

Query: 295 LGSKLTSGWSYRRFGQLLSEGYRGA--QQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGD 352
           LGSKLT  +  RR+  + SE Y+    + F  +       F++  +              
Sbjct: 293 LGSKLTWSFISRRYEHIASEAYQNFLFKLFATVPNVTINNFSNMFT-------------- 338

Query: 353 PRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVH- 411
            R+ L +    + +N+ ++K + L  YG+ DWM+   G  ++  LN   G       +  
Sbjct: 339 -RNLLAKDPIMDSINKLQSK-KLLLFYGENDWMNKEAGFLMAEKLNILKGDSKYANWIEV 396

Query: 412 -DSGHHLYFDNYEQFNRIL 429
            +SGH+L  D+ + F++ L
Sbjct: 397 PNSGHNLILDDPKFFSKNL 415

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 20/116 (17%)

Query: 144 LIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSR-PKFPYKYKSDPAAQVE 202
            + +HG G  L  F   L  ++ +D R++  A+DLPG+G S    ++P     +   ++ 
Sbjct: 86  FLFIHGLGGELEQFEPLLRLVDAMDQRFL--ALDLPGFGKSDEWDEYPMLKVVETIEEIA 143

Query: 203 HWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKY--PNHFKKLVMCSP 256
             F+A                + +LV HSMG YL + +   Y   +   ++V+ SP
Sbjct: 144 AKFNA---------------AKIVLVGHSMGCYLTSHFYEAYHKVHSINRIVLLSP 184

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 58/139 (41%), Gaps = 9/139 (6%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHW 204
           + + G G  L  +   L  +++++ +++    DLPG+G S        Y      +V H 
Sbjct: 98  VFLPGLGGSLDQYEPLLRLMDILNEKFI--GFDLPGFGGSEEDTSEGGYN---MIKVCHI 152

Query: 205 FHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPN----HFKKLVMCSPAGIC 260
            +   ++ + +    +   +  LV HSMG YL   + N +         +L++ SP    
Sbjct: 153 INEALQSIITQNYSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKISQLILTSPPKKK 212

Query: 261 NTPSNKQRRLPPWWFAKLW 279
             P +K  RL  +    L+
Sbjct: 213 IEPLDKNNRLNQFGLQLLY 231

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 17/117 (14%)

Query: 144 LIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYK--YKSDPAAQV 201
            +++HG G  +  F   ++ L L+  R +  A+DLPG+G S      Y   Y +    +V
Sbjct: 78  FLLIHGLGGSMDQFQPLMKLLTLLKYRVI--ALDLPGFGQSGSSTNGYDMLYVTSVVKKV 135

Query: 202 EHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFK--KLVMCSP 256
                      +E +  +       +V HSMG Y+A+ +   Y   +   KLV+  P
Sbjct: 136 -------VDNNIENKTDIDFK----VVGHSMGCYIASHFVQMYHEEYNIDKLVLTCP 181

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 19/118 (16%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHW 204
           + +HG G  L  F   L+ L+L++  +   ++DLPG+G S               +VE +
Sbjct: 133 VFIHGLGGTLAQFEPLLKLLSLLNKGFF--SMDLPGFGSSD--------------EVESY 176

Query: 205 FHARFKTWLEKRGLLQHPEQNM-LVAHSMGAYLAALYANKYPNH--FKKLVMCSPAGI 259
                   ++K      P +N+ L+ HSMG YLA  + + +     F++LV+ +P  +
Sbjct: 177 GMLEIVAIVQKTFAKLTPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAPPSL 234

>KAFR0A01130 Chr1 (219445..220758) [1314 bp, 437 aa] {ON} Anc_8.505
           YPL053C
          Length = 437

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 7   LQIYKAASLFRSAFSQVVGIQPKVRKPAFPCNSESASNPSITCRPSSPSAIPLRELVINL 66
             IY++    RS+ + +  +  K+ + AF  + E++ NPS+T   SS  A+   EL +  
Sbjct: 22  FTIYRSG---RSSTAPITVMDMKLEQEAFSTDDETSENPSLTSPVSSQDALEEEELRVKQ 78

Query: 67  PRLFPRSMKESVRDYFAFRKDAGTL 91
             +  R  K+S  D F +    G++
Sbjct: 79  EIINER--KKSKYDKFGYDTVQGSM 101

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 63/153 (41%), Gaps = 17/153 (11%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKS--DPAAQVE 202
           + +HG G  LG F   L   +L   +++   +DLPG+G S   +  Y  KS  +    V 
Sbjct: 85  LFIHGLGGSLGQFEPLLRLTHLKGKKFL--TLDLPGFGQSDELE-SYSMKSVIETIRSVV 141

Query: 203 HWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHF--KKLVMCSPAGIC 260
                  K+  E   L     + +L  HSMG YL   +   Y  ++  +K+ + SP    
Sbjct: 142 DLATGNQKSLGENTQL-----KLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSPPKPI 196

Query: 261 NTPSNKQRRLPPWWFAKLWDRNISP--FSLVRN 291
            T  +K+     W    LW     P  F L RN
Sbjct: 197 MTSLSKRNYWTQW---ALWGVFKLPFIFDLYRN 226

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 82   FAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMPHPSGTL 141
            F FR++   L+H L++     P    + +++ VQ+ ++    Y+N++ V P +      +
Sbjct: 1268 FKFREEETELKHVLVADADSRPTPSQEVISQAVQS-IENDPIYLNKYEVCPYLDR----I 1322

Query: 142  RHLIIVHGYGAGLGFFLKNLEKLNL 166
            R L     YG+ + F +K L+ L L
Sbjct: 1323 RQLETSVNYGSKIDFVIKLLKYLRL 1347

>Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 60/142 (42%), Gaps = 20/142 (14%)

Query: 146 IVHGYGAGLGFFLKNLEKL-NLIDN-RWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEH 203
           +V  +  GLG  L+  E L  L+D+ R    A D PG+G SS      ++   P  +V  
Sbjct: 87  VVFVFVPGLGGNLEQFEPLLKLLDSERKAFLAFDSPGFGQSS------EWNDYPMLKVVE 140

Query: 204 WFHARFKTWLEK--RGLLQHPEQNML-------VAHSMGAYLAA-LYANKYP--NHFKKL 251
                    L+K    + +  + N+L       V HSMG +LA  LY       N  K+ 
Sbjct: 141 LIFVLVCDVLKKWPTAVSKDDDTNLLNGRKIVLVGHSMGCFLACHLYEQHLAILNVVKRF 200

Query: 252 VMCSPAGICNTPSNKQRRLPPW 273
           V+ +P        +K RRL  W
Sbjct: 201 VLLTPPKAHIEQLSKDRRLFQW 222

>KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 336

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 47/114 (41%), Gaps = 17/114 (14%)

Query: 145 IIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHW 204
           +  HG G  L  F   L  L  ++  +V  A+DLPG+G S        Y+     QV   
Sbjct: 82  LFFHGLGGNLTQFEPLLRLLGELNEGFV--AMDLPGFGLSEEQD---GYQ---MLQVTQV 133

Query: 205 FHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHF--KKLVMCSP 256
            H  F    + + ++       LV HSMG +L   +A  +   F  K  V  SP
Sbjct: 134 IHDAFLQITDHKKII-------LVGHSMGCHLVLHFAILFGLEFDIKDSVFLSP 180

>ZYRO0B07018g Chr2 complement(551747..554551) [2805 bp, 934 aa] {ON}
           highly similar to uniprot|P32074 Saccharomyces
           cerevisiae YNL287W SEC21 Gamma subunit of coatomer a
           heptameric protein complex that together with Arf1p
           forms the COPI coat involved in ER to Golgi transport of
           selective cargo
          Length = 934

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 8/88 (9%)

Query: 44  NPSITCRPSSPSAIPLRELV-INLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFF 102
           N ++TC P +PS   L EL  +++ RL P    +    Y A+ K    +    L+ L F 
Sbjct: 733 NVTVTCTPENPSESSLEELFSLSIDRLSP---SQEAACYVAYNKSEEIVMEGFLNNLTFT 789

Query: 103 PVAGDDKVAEVVQTPVDEQANYINEFCV 130
               D +     Q P+D+   + +EF +
Sbjct: 790 TRELDPE----TQQPLDDTEGFQDEFDI 813

>Kwal_43.16490 s43 (51..911) [861 bp, 286 aa] {ON} YNR064C -
           Hypothetical ORF [contig 357] PARTIAL
          Length = 286

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 15/94 (15%)

Query: 166 LIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQN 225
           L ++ WVI A+DLPG G S +P   Y  ++            +    ++  GL ++    
Sbjct: 39  LAESYWVI-AVDLPGQGDSDKPGDGYDTQT---------LANKLHILIQSLGLSRY---- 84

Query: 226 MLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGI 259
            L AH +GA++A  Y+  +    +++ +   AGI
Sbjct: 85  FLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 117

>Kwal_26.9628 s26 (1300688..1301449) [762 bp, 254 aa] {ON} YNR064C -
           Hypothetical ORF [contig 363] PARTIAL
          Length = 254

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 15/94 (15%)

Query: 166 LIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQN 225
           L ++ WVI A+DLPG G S +P   Y  ++            +    ++  GL ++    
Sbjct: 56  LAESYWVI-AVDLPGQGDSDKPGDGYDTQT---------LANKLHILIQSLGLSRY---- 101

Query: 226 MLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGI 259
            L AH +GA++A  Y+  +    +++ +   AGI
Sbjct: 102 FLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 134

>YOR084W Chr15 (480587..481750) [1164 bp, 387 aa] {ON}  LPX1Oleic
           acid-inducible, peroxisomal matrix localized lipase;
           transcriptionally activated by Yrm1p along with genes
           involved in multidrug resistance; peroxisomal import is
           dependent on the PTS1 receptor, Pex5p and on
           self-interaction
          Length = 387

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%)

Query: 221 HPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQR-RLPP 272
           HP  N+++ HSMG + A       PN F  L++  P  I        R  LPP
Sbjct: 135 HPALNVVIGHSMGGFQALACDVLQPNLFHLLILIEPVVITRKAIGAGRPGLPP 187

>Kwal_26.6639 s26 complement(252..1163) [912 bp, 303 aa] {ON}
           YNR064C - Hypothetical ORF [contig 294] FULL
          Length = 303

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 15/94 (15%)

Query: 166 LIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQN 225
           L ++ WVI A+DLPG G S +P   Y  ++            +    ++  GL ++    
Sbjct: 56  LAESYWVI-AVDLPGQGDSDKPGDGYDTQT---------LANKLHILIQSLGLSRY---- 101

Query: 226 MLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGI 259
            L AH +GA++A  Y+  +    +++ +   AGI
Sbjct: 102 FLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 134

>Kwal_48.19391 s48 (3319..3870) [552 bp, 183 aa] {ON} YNR064C -
           Hypothetical ORF [contig 322] FULL
          Length = 183

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 15/94 (15%)

Query: 166 LIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQN 225
           L ++ WVI A+DLPG G S +P   Y  ++            +    ++  GL ++    
Sbjct: 56  LAESYWVI-AVDLPGQGDSDKPGDGYDTQT---------LANKLHILIQSLGLSRY---- 101

Query: 226 MLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGI 259
            L AH +GA++A  Y+  +    +++ +   AGI
Sbjct: 102 FLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 134

>Kwal_23.6592 s23 (1658078..1658572) [495 bp, 164 aa] {ON} [contig
           358] FULL
          Length = 164

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 15/94 (15%)

Query: 166 LIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQN 225
           L ++ WVI A+DLPG G S +P   Y  ++            +    ++  GL ++    
Sbjct: 37  LAESYWVI-AVDLPGQGDSDKPGDGYDTQT---------LANKLHILIQSLGLSRY---- 82

Query: 226 MLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGI 259
            L AH +GA++A  Y+  +    +++ +   AGI
Sbjct: 83  FLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 115

>KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {ON}
           similar to uniprot|P53750 Saccharomyces cerevisiae
           YNR064C
          Length = 294

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 144 LIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAA 199
           ++++HGY      F ++L  + LI +++ + A DLPG+GF+  P+  Y Y  D  A
Sbjct: 33  IVLLHGYPTSSTMF-RHL--IPLISDKFHVIAPDLPGFGFTEVPE-DYHYSFDNLA 84

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,207,189
Number of extensions: 2164995
Number of successful extensions: 4742
Number of sequences better than 10.0: 77
Number of HSP's gapped: 4681
Number of HSP's successfully gapped: 105
Length of query: 438
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 325
Effective length of database: 40,524,141
Effective search space: 13170345825
Effective search space used: 13170345825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)