Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E05104g3.455ON1185118561430.0
Kwal_55.204643.455ON1189118137570.0
SAKL0F06886g3.455ON1183118327920.0
Ecym_44043.455ON1196119626140.0
AGR251C3.455ON1193118425300.0
YPR122W (AXL1)3.455ON1208121922540.0
Kpol_1050.883.455ON1213120722390.0
KLLA0D15631g3.455ON1170118222290.0
Skud_16.4123.455ON1208120622250.0
Smik_16.3713.455ON1208120722200.0
Suva_16.4513.455ON1218117021960.0
NDAI0A046503.455ON1199120321890.0
ZYRO0C06336g3.455ON1189119521880.0
NCAS0A116303.455ON1201115421460.0
TDEL0F034003.455ON1170114921340.0
KAFR0A053703.455ON1201120220850.0
TBLA0C054503.455ON1202116719880.0
KNAG0A077403.455ON1197117119230.0
TPHA0D040603.455ON1201115919090.0
CAGL0D04686g3.455ON1181118911621e-138
TDEL0E012504.246ON99510124571e-45
Kwal_23.42374.246ON10019734285e-42
AER053C4.246ON10139544251e-41
NCAS0J014704.246ON99510323946e-38
Suva_10.5064.246ON10239883883e-37
KLTH0D14278g4.246ON10015003794e-36
ZYRO0B12320g4.246ON9944943732e-35
SAKL0H03124g4.246ON10065173732e-35
TBLA0A080504.246ON9954133634e-34
TBLA0I029404.246ON9655153624e-34
Skud_12.4744.246ON10225643616e-34
CAGL0H06457g4.246ON10083403591e-33
NDAI0J022404.246ON9994963562e-33
KNAG0B060804.246ON9964433536e-33
KAFR0A059704.246ON10113973528e-33
YLR389C (STE23)4.246ON10275643501e-32
Ecym_32734.246ON10232263492e-32
Kpol_1055.834.246ON10205163482e-32
Smik_12.4764.246ON10255043439e-32
KLLA0E05105g4.246ON10042473439e-32
TPHA0B022604.246ON10412443251e-29
TPHA0C024508.376ON4692261568e-10
YLR163C (MAS1)8.376ON4621991362e-07
Kpol_1024.23singletonOFF4541851362e-07
Kpol_YGOB_1024.238.376ON4641851362e-07
AGL138C8.376ON4701991352e-07
Smik_12.2258.376ON4621991334e-07
Kwal_23.33458.376ON4581851316e-07
TBLA0H010108.376ON4992061301e-06
KNAG0A027608.376ON4671991282e-06
Suva_10.2608.376ON4621991263e-06
Skud_12.2308.376ON4621991263e-06
KLTH0F08954g8.376ON4581991254e-06
CAGL0H02739g8.376ON4651941237e-06
NCAS0C029708.376ON4611991211e-05
KAFR0H020308.376ON4621991165e-05
TDEL0F050008.376ON4561851139e-05
KLLA0D18095g8.376ON4691991122e-04
Ecym_41918.376ON4621851102e-04
NDAI0G023208.376ON4631941103e-04
SAKL0H14168g8.376ON4611991068e-04
ZYRO0C03806g8.376ON4651851020.002
NCAS0C049503.93ON1032209970.010
CAGL0I07535g3.93ON1021207880.12
Ecym_35853.93ON1032217870.18
TDEL0D053103.93ON1035214860.24
Kwal_26.9378singletonOFF9255760.35
TBLA0A105007.148ON23750810.47
SAKL0C09504g3.93ON106992830.50
NDAI0H023902.439ON48068791.4
NCAS0F011405.541ON988107791.5
KNAG0L019305.670ON64672781.9
NCAS0E033607.258ON801126763.0
NCAS0F015102.439ON52268753.4
TBLA0A069405.541ON991105753.9
KAFR0C014303.93ON1035102754.5
NDAI0G042803.93ON1034215737.1
TPHA0P010403.93ON103898737.7
Kwal_47.185775.541ON98752737.9
NDAI0E040207.418ON278641729.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E05104g
         (1185 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] ...  2370   0.0  
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...  1451   0.0  
SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} simil...  1080   0.0  
Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON...  1011   0.0  
AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON...   979   0.0  
YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Hapl...   872   0.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...   867   0.0  
KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} sim...   863   0.0  
Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR12...   861   0.0  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...   859   0.0  
Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR12...   850   0.0  
NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa]...   847   0.0  
ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} simil...   847   0.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...   831   0.0  
TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3....   826   0.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...   807   0.0  
TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa]...   770   0.0  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...   745   0.0  
TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3....   739   0.0  
CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} simil...   452   e-138
TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.2...   180   1e-45
Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389...   169   5e-42
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...   168   1e-41
NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {...   156   6e-38
Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa] ...   154   3e-37
KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa...   150   4e-36
ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {...   148   2e-35
SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} simil...   148   2e-35
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...   144   4e-34
TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {O...   144   4e-34
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...   143   6e-34
CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highl...   142   1e-33
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...   141   2e-33
KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa] ...   140   6e-33
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...   140   8e-33
YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}...   139   1e-32
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...   139   2e-32
Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON} (216...   138   2e-32
Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa] ...   136   9e-32
KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} simil...   136   9e-32
TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4....   129   1e-29
TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.3...    65   8e-10
YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON} ...    57   2e-07
Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF} (68467...    57   2e-07
Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON} AN...    57   2e-07
AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON} S...    57   2e-07
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    56   4e-07
Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C...    55   6e-07
TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.3...    55   1e-06
KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.3...    54   2e-06
Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {...    53   3e-06
Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {...    53   3e-06
KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly...    53   4e-06
CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly...    52   7e-06
NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376     51   1e-05
KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.3...    49   5e-05
TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {O...    48   9e-05
KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]...    48   2e-04
Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar t...    47   2e-04
NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.3...    47   3e-04
SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} high...    45   8e-04
ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {...    44   0.002
NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]...    42   0.010
CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa] ...    39   0.12 
Ecym_3585 Chr3 (1108374..1111472) [3099 bp, 1032 aa] {ON} simila...    38   0.18 
TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3....    38   0.24 
Kwal_26.9378 s26 complement(1189437..1189715) [279 bp, 92 aa] {O...    34   0.35 
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    36   0.47 
SAKL0C09504g Chr3 complement(865789..868998) [3210 bp, 1069 aa] ...    37   0.50 
NDAI0H02390 Chr8 complement(580589..582031) [1443 bp, 480 aa] {O...    35   1.4  
NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {O...    35   1.5  
KNAG0L01930 Chr12 (346371..348311) [1941 bp, 646 aa] {ON} Anc_5....    35   1.9  
NCAS0E03360 Chr5 (668230..670635) [2406 bp, 801 aa] {ON} Anc_7.2...    34   3.0  
NCAS0F01510 Chr6 complement(301616..303184) [1569 bp, 522 aa] {O...    33   3.4  
TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa] ...    33   3.9  
KAFR0C01430 Chr3 (292206..295313) [3108 bp, 1035 aa] {ON} Anc_3....    33   4.5  
NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON} Anc_...    33   7.1  
TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3...    33   7.7  
Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430...    33   7.9  
NDAI0E04020 Chr5 complement(890287..898647) [8361 bp, 2786 aa] {...    32   9.2  

>KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] {ON}
            similar to uniprot|P40851 Saccharomyces cerevisiae
            YPR122W AXL1 Haploid specific endoprotease that performs
            one of two N-terminal cleavages during maturation of a-
            factor mating pheromone required for axial budding
            pattern of haploid cells
          Length = 1185

 Score = 2370 bits (6143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1149/1185 (96%), Positives = 1149/1185 (96%)

Query: 1    MSGMSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXX 60
            MSGMSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLI                    
Sbjct: 1    MSGMSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLISDPADTSVSSSVSVASGSHA 60

Query: 61   XPDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASN 120
             PDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASN
Sbjct: 61   DPDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASN 120

Query: 121  DSGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANP 180
            DSGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANP
Sbjct: 121  DSGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANP 180

Query: 181  RHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLA 240
            RHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLA
Sbjct: 181  RHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLA 240

Query: 241  KKYFGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVPDTSNL 300
            KKYFGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVPDTSNL
Sbjct: 241  KKYFGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVPDTSNL 300

Query: 301  VAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLING 360
            VAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLING
Sbjct: 301  VAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLING 360

Query: 361  VVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSELN 420
            VVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSELN
Sbjct: 361  VVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSELN 420

Query: 421  CTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDYSE 480
            CTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDYSE
Sbjct: 421  CTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDYSE 480

Query: 481  STESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAYYEFTYQ 540
            STESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAYYEFTYQ
Sbjct: 481  STESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAYYEFTYQ 540

Query: 541  ISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTVVA 600
            ISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTVVA
Sbjct: 541  ISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTVVA 600

Query: 601  RNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLA 660
            RNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLA
Sbjct: 601  RNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLA 660

Query: 661  QLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLIN 720
            QLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLIN
Sbjct: 661  QLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLIN 720

Query: 721  SDTVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIE 780
            SDTVTPAMFRKARVAVRNKYEE               IVLEECMWPVEDRLDALEEIDIE
Sbjct: 721  SDTVTPAMFRKARVAVRNKYEEAASANSTTLATLGLLIVLEECMWPVEDRLDALEEIDIE 780

Query: 781  SFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPVTHAL 840
            SFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPVTHAL
Sbjct: 781  SFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPVTHAL 840

Query: 841  KPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQI 900
            KPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQI
Sbjct: 841  KPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQI 900

Query: 901  GYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIR 960
            GYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIR
Sbjct: 901  GYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIR 960

Query: 961  KFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRYNF 1020
            KFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRYNF
Sbjct: 961  KFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRYNF 1020

Query: 1021 TSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIAEKRLFLQI 1080
            TSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIAEKRLFLQI
Sbjct: 1021 TSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIAEKRLFLQI 1080

Query: 1081 ESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNVILKELSKAVV 1140
            ESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNVILKELSKAVV
Sbjct: 1081 ESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNVILKELSKAVV 1140

Query: 1141 LSLKPRPTNNNSAGVLQNVRKEVSTAVPLIEVQANHFRQRSPVTG 1185
            LSLKPRPTNNNSAGVLQNVRKEVSTAVPLIEVQANHFRQRSPVTG
Sbjct: 1141 LSLKPRPTNNNSAGVLQNVRKEVSTAVPLIEVQANHFRQRSPVTG 1185

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score = 1451 bits (3757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/1181 (59%), Positives = 886/1181 (75%), Gaps = 4/1181 (0%)

Query: 6    DAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEV 65
            ++ ++FD+ FYTPIS S++G +LC+L+NG+LV LI                     PDE 
Sbjct: 4    ESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEA 63

Query: 66   LGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGEL 125
            LGLAHLCEH ILS GSKK+P +++YHE++AQNGGSHNAYTTGE TTFYFELPA +DSGEL
Sbjct: 64   LGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAYTTGETTTFYFELPAISDSGEL 123

Query: 126  LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
             FDK LD LASS K P+FSD  INKEIYAIESEHN+NKA   KQLYHA+RLLANP HPFS
Sbjct: 124  HFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFS 183

Query: 186  RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
            RFCTGNF TLC  P+L+K N+KA L  + K  Y  + M+LCLRG QSLN L KLA ++FG
Sbjct: 184  RFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFG 243

Query: 246  DLPASRDRDPTRPPLKKRPSSGVASQDL-HVRPLDFKNSKQQTQVQDAFVPDTSNLVAIQ 304
            DLPAS  ++  RP      S+   +Q + + + L ++ + +   V+ AF   +SN+VAIQ
Sbjct: 244  DLPAS-GQNIARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDVR-AFSQGSSNVVAIQ 301

Query: 305  SSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVVAS 364
            SSK PVLRL+FPVSHKSTRL+S+DI   S  WCDFFGDE VGSL  CLK   LI+G+V+S
Sbjct: 302  SSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGLISGIVSS 361

Query: 365  VAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSELNCTDL 424
            V+HF+   DGLTLE TLT  GW +   I+ +LFD +IP+LIHDKT+DIA+CLSELN  +L
Sbjct: 362  VSHFATEEDGLTLELTLTQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLSELNAIEL 421

Query: 425  LTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDYSESTES 484
            L FLYQ  EKS M+MCA LS+ LL   ETLDPKCLLKGSPLIECNQ  S IGDYSE+TES
Sbjct: 422  LKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEHSRIGDYSENTES 481

Query: 485  RTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAYYEFTYQISKI 544
            +TWWIGRAIKFQN VSEFVNRQNLR VMLG+  KS+ L+SV S +KTDAYYEF Y+I+ +
Sbjct: 482  QTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTKTDAYYEFDYRIAYV 541

Query: 545  DMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTVVARNAY 604
            DMLS++ + Y  P + F  P YD FLP V RKL LIKQALQ SS R+Q++ L ++ R+ +
Sbjct: 542  DMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRAQSASLHLIPRSDF 601

Query: 605  LQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLG 664
            LQT PRLAGKNSN+E+WVKEE+ DLSF SKSI+S E+ SK++ A P  TM LE+L QLL 
Sbjct: 602  LQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLA 661

Query: 665  DSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTV 724
             +LS  LYPSEKLGYTYEISPS+KG  RL  T+SGFPEGV  ++++I+++ KS  + D +
Sbjct: 662  GTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDII 721

Query: 725  TPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRT 784
            +  +FR+AR+AVR+KYEE               I+LEECMWP+EDRL+ALEEI  E+F  
Sbjct: 722  SSKVFREARIAVRSKYEEAAAANCTALASLGLLIILEECMWPIEDRLEALEEISQETFTM 781

Query: 785  FCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPVTHALKPGT 844
            FCS F++ PTY+N+F QGD+S  E+I++FL   LTSHL     ++  VREP    LK GT
Sbjct: 782  FCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTREYQGPVREPGAKILKAGT 841

Query: 845  NMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAV 904
            N+F++R+AF +DP++SIVYFIQTG+R+DA+  + TCL EF +S+TLVPDLR KKQIGYAV
Sbjct: 842  NIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAV 901

Query: 905  FSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRA 964
            F GLRLLST++GLHITCMS+SPPEHLE QI++YL+Y+E  +L  M+EEEFQE YIRK+R 
Sbjct: 902  FGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEHYIRKYRV 961

Query: 965  MFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRYNFTSDL 1024
            M E   V      AGPADL+ QIEANV SGNL EQG+AMR HK  +NQIS  RYNF  + 
Sbjct: 962  MVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGSAMRLHKNTKNQISNRRYNFGMEE 1021

Query: 1025 EPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIAEKRLFLQIESYL 1084
            EP +  +LR +TL +FR FF EKISI S  RSKLSVM+ASP++A+EI++KRLFLQ+ES+L
Sbjct: 1022 EPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAEEISQKRLFLQVESFL 1081

Query: 1085 KLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNVILKELSKAVVLSLK 1144
            KLKGLKI SS+L  I+E+S G+ S ++RGLF++F A GET++LCNVI+KE+SKA+VLSLK
Sbjct: 1082 KLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVIIKEISKALVLSLK 1141

Query: 1145 PRPTNNNSAGVLQNVRKEVSTAVPLIEVQ-ANHFRQRSPVT 1184
                       L+ + K V++A+PL E++  N FR  + VT
Sbjct: 1142 NPSQRTRVDDALRGLSKIVTSALPLTEIKDVNQFRNLNEVT 1182

>SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1183

 Score = 1080 bits (2792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/1183 (47%), Positives = 770/1183 (65%), Gaps = 24/1183 (2%)

Query: 5    SDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDE 64
            S  V++FDV FYTPIS S++   + +L NG+LVLLI                     P E
Sbjct: 3    SFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKE 62

Query: 65   VLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGE 124
            +LGLAH CEH ILSAGSK +P  + YH+++++NGGS NA+TTGE TTF FELP  ++S E
Sbjct: 63   ILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDE 122

Query: 125  LLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPF 184
            L+FDKVLD  +SSFK P+F++  +NKEIYAI SEH  NK+S  K  YHATRLLAN  HPF
Sbjct: 123  LVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPF 182

Query: 185  SRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYF 244
            S+F TG+  TL D   L+KV+++  + +YFK N+ A  M LC++GPQSLN L KL    F
Sbjct: 183  SQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKF 242

Query: 245  GD---LPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFK----NSKQQTQVQDAFVP-D 296
             D   LP SR       P  K  S   ++    +    FK    N  Q+      F   D
Sbjct: 243  NDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCD 302

Query: 297  TSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNN 356
              N V + S K P LRL+FP+ H+ TRLT  +I  LS+ WC+ FGDE  GSL H +K N+
Sbjct: 303  NHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKND 362

Query: 357  LINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCL 416
             I  + A ++HF+  ++ L LE  LTN GW + Q+I+ V F+ ++P +I   T ++A+ L
Sbjct: 363  YITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFL 422

Query: 417  SELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIG 476
            SELNC +LL FLYQ    SSME C+ LSS LL+  E+L P  +LKG+P+ +CN+  S +G
Sbjct: 423  SELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSELG 482

Query: 477  DYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGN---CP--KSDLLSSVTSVSKT 531
             ++ES ESR WWIG AIKFQ+F+ EF+N +N+R+V++G+   CP  K+DL S   ++   
Sbjct: 483  SFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNI--- 539

Query: 532  DAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRS 591
            + YYEF Y   + D  + +  +  I  +SF +P  ++FLP+VG  L LIK AL ASSNRS
Sbjct: 540  EPYYEFEYHKCRSDQSNFKLTVEEI-SYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRS 598

Query: 592  QTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPS 651
            QT+ L++ ++NA    +P+L GKN  +E+WVKEED +L+FKSKSI++ E+ S  +   PS
Sbjct: 599  QTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPS 658

Query: 652  YTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVI 711
            YTM LE+L +LLGD LS+ LYPSEK+GYTYEI+ S+KG  R+ FT+SGF EGV  ++  I
Sbjct: 659  YTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKI 718

Query: 712  IDQTKSLINSDTVTPA-MFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDR 770
            +     ++ S+ V    +FRK+R+AVRNKYEE               IVLE+ MW +E R
Sbjct: 719  VGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESR 778

Query: 771  LDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEP 830
            L+ALE  D+ESF+ F S F    TY+N+F QGD +YT++I+ FLD  LT HLS++     
Sbjct: 779  LEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVK 838

Query: 831  AVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTL 890
             + EP +  LKPG+N+FI    F +DP++SIVYFIQTGDR D    +LT  T FL+S+TL
Sbjct: 839  ILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTL 898

Query: 891  VPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMS 950
            VPDLR +KQ+GY V  GLR LS+T+GLHIT  SSSPP  LE +I +YL+Y+E D+L  + 
Sbjct: 899  VPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLK 958

Query: 951  EEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIR 1010
             + F+E+Y++++  +     +  T     P +L+++I+ANV SGNL   G  M+ H+RIR
Sbjct: 959  PQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKSHRRIR 1018

Query: 1011 NQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADE 1070
             QIS  RYNF  + EP DL L+ +L    + +FF++KISI S+ RSK+SVMV+SP+S  E
Sbjct: 1019 AQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSRSE 1078

Query: 1071 IAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNV 1130
            I  +++FLQ+ES+LKLKG KI   +L+ IV  S GKP+ LM+ LF++F +RGE+L++C V
Sbjct: 1079 IYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICTV 1138

Query: 1131 ILKELSKAVVLSLKPRPTNNNSAGVLQNV-RKEVSTAVPLIEV 1172
            +LKE+++ +  SLK     N  A    N  R   S  VPL E+
Sbjct: 1139 MLKEITRQLSSSLK-----NLGARKSPNFERPNGSPTVPLTEI 1176

>Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON}
            similar to Ashbya gossypii AGR251C
          Length = 1196

 Score = 1011 bits (2614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/1196 (45%), Positives = 756/1196 (63%), Gaps = 38/1196 (3%)

Query: 11   FDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLGLAH 70
            FDV  YTPISSS +   + +L+N +L LLI                     P E+ GLAH
Sbjct: 10   FDVTLYTPISSSKRSHRIIQLSNNLLALLISDPSETIASCAISVATGSHNDPPELPGLAH 69

Query: 71   LCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLFDKV 130
             CEH +LS+GSKK+P  + +HE + +N GS NA+TTGE T+FYFE+P +  +   +F+++
Sbjct: 70   FCEHMVLSSGSKKYPEPNFFHESLTRNNGSKNAHTTGEQTSFYFEVPHTTSAELHVFEQL 129

Query: 131  LDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTG 190
            +D LA+SFK PVF D  +NKEIYAI SEH  NK++  K LYHATRLLAN  HPFS F TG
Sbjct: 130  IDILAASFKEPVFHDILVNKEIYAIHSEHMGNKSTLSKMLYHATRLLANENHPFSHFSTG 189

Query: 191  NFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLPAS 250
            N  TL + P ++K+N+K  L +YFK ++ A +M +C+RG QSLN L+KLA+  FGD+P S
Sbjct: 190  NVFTLTNMPRVNKLNLKTELIKYFKEHFRAEKMVVCIRGSQSLNQLSKLAQLKFGDIPGS 249

Query: 251  RDR-DPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQV-QDAFVPDTS---------- 298
                 PT  PLK +      S    V       S  ++++ +D ++P  S          
Sbjct: 250  AAAGSPTSSPLKLKSWRSSNSITSSVDTSSTLASLDESRILKDTWLPRYSKEPVFTPRPK 309

Query: 299  -NLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNL 357
             N + IQS K PV+R +FPV++ STR T  +I   ++ WCD  GDEG GS  H L+ NN 
Sbjct: 310  YNSMMIQSKKPPVIRFIFPVNYLSTRFTDKEIATYTKAWCDIIGDEGYGSFCHFLRQNNY 369

Query: 358  INGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLS 417
            I+ ++A  + F+  +DGL L+  LTN GW++  +I+ + +   +  ++      I + LS
Sbjct: 370  ISDLLAFSSSFAVNDDGLILQLHLTNYGWANVSIIVPLFWKYTVNTILDTSLSKIGQYLS 429

Query: 418  ELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLI-ECNQNP--SA 474
            ELN  DLL FLYQ  E+S ME CA L  +L+     + P  +LK S L+ +CN +P    
Sbjct: 430  ELNSIDLLKFLYQDVERSPMERCAELCDQLMQDLSVVPPPFILKTSGLMFDCN-DPRIQK 488

Query: 475  IGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAY 534
            IG YSES  S  WW G+AIKFQ FV EF   +N++++MLG   K    S+   ++  D +
Sbjct: 489  IGSYSESQNSTDWWRGQAIKFQTFVKEFTTIENVKMIMLGPLSKCPFYSNSMQLT-ADTH 547

Query: 535  YEFTYQISKIDMLSVREELYRIPG-FSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQT 593
            YE+ Y  + I++     EL  I   + F +P  + FL  VG KL  IK+AL A+S +S+ 
Sbjct: 548  YEYDYLKAYIEI----TELEAIDNEYEFHIPSPNQFLVPVGHKLSYIKKALLAASAQSEN 603

Query: 594  SLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYT 653
            S L +V ++  LQT P LAGKN+ +ELW KEED +LSFKSKSI+S+EV S T++  P YT
Sbjct: 604  SSLFIVTQSDLLQTTPSLAGKNAFYELWTKEEDINLSFKSKSIVSLEVISTTLKPAPEYT 663

Query: 654  MCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIID 713
            M LE+L QLL   +S VLYP+E+ GYTYE+S S+KG  RL  T+SGF EG+  ++ +I+D
Sbjct: 664  MQLEILGQLLFSIISPVLYPAERAGYTYELSLSSKGDVRLGITLSGFTEGIMGILNIILD 723

Query: 714  QTKSL-INSDTVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLD 772
                L  +S  ++  MFR+ARV VR KYEE               IVLE CMW +EDRL+
Sbjct: 724  SLLELGEDSVEISKGMFRRARVMVRTKYEEAASENCATLASLGLLIVLEGCMWTLEDRLN 783

Query: 773  ALEEIDIESFRTFCSGFISKPTYLNVFSQG-DLSYTEEISTFLDSGLTSHLSRRTWHEPA 831
            ALE+ID+ESF  F   FI+   YLN+  QG DLS  ++++  +D+ LT H+S     +  
Sbjct: 784  ALEDIDMESFVQFMKLFINGRNYLNLLVQGSDLSLADKVNDCVDAKLTHHMSSLETGKNI 843

Query: 832  VREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLV 891
            + EP TH +  G+N+ +++S   +DP++SIVYFIQTG RD+    +LT  TEFLMSMTLV
Sbjct: 844  LVEPTTHFIPRGSNLCVKKSGSHDDPNNSIVYFIQTGTRDNNYAYTLTVFTEFLMSMTLV 903

Query: 892  PDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSE 951
            PDLR KKQIGY V  GLR+LS T+GLHIT MSS+PPE+LE +ID+YL+Y+E  VL  ++ 
Sbjct: 904  PDLRGKKQIGYVVLGGLRVLSDTVGLHITTMSSNPPEYLEKKIDEYLSYLESMVLMKLNN 963

Query: 952  EEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGA-AMRQHKRIR 1010
            E+F+  Y+ KF  + E  +++     +GPA+L++QIEANV SG+  + G+ AM+ HKRIR
Sbjct: 964  EQFKMNYLNKFLRLVESNSLSKIEKTSGPANLMSQIEANVRSGS--QNGSMAMKSHKRIR 1021

Query: 1011 NQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADE 1070
            NQIS  RYNF  + EP +   +R LTL ++  FF EKIS+ S +R+K+SVMV SP+S DE
Sbjct: 1022 NQISYRRYNFEEEDEPINAKTIRNLTLREYMAFFHEKISVYSKSRAKMSVMVTSPMSKDE 1081

Query: 1071 IAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNV 1130
            +  K +FLQIES+LK+KG  IPS +L++I+  S GKP+ L++ LF +F  RGE+++L   
Sbjct: 1082 VQSKMMFLQIESFLKMKGFNIPSEDLKSIIVKSGGKPTVLLKHLFSYFRVRGESIKLLTA 1141

Query: 1131 ILKELSKAVVLSLKP-------RPTNNNSAGVLQNVRKEVSTAVPLIEV-QANHFR 1178
            I+KE+ K    S KP         T   ++G LQ + + V+ AVPLIEV   N +R
Sbjct: 1142 IVKEIVKQA--SNKPPGSAAKTSATPTGTSGTLQAMSQTVAPAVPLIEVTDVNSYR 1195

>AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR122W
            (AXL1)
          Length = 1193

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/1184 (44%), Positives = 748/1184 (63%), Gaps = 23/1184 (1%)

Query: 11   FDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLGLAH 70
            FDV  YTPISSSN+   + RL N +L  LI                     P E+ GLAH
Sbjct: 10   FDVKLYTPISSSNRSHRIIRLNNNLLTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69

Query: 71   LCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLFDKV 130
             CEH +LS+GSK+ P  + +HE +++N GS NA+T+GE T+FYFELP+S  S  L+FD+V
Sbjct: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129

Query: 131  LDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTG 190
            +  LA + K P+F D  INKEIYAI SEH  NK+S  K +YHA RLLA+P HPF +F TG
Sbjct: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189

Query: 191  NFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLPAS 250
            N  TL + P LHK+++K  L +YF+ ++ A  M LCLRGPQSLN L+K+A+  F D+P+ 
Sbjct: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249

Query: 251  RDRDPTRPPLKKRPSSGVASQDLHVRPLD-FKNSKQQTQVQDAFVP-----DTSNLVAIQ 304
                  R    +  SS   +++L VRPL+ F+  K     + A  P        N + +Q
Sbjct: 250  PTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQ 309

Query: 305  SSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVVAS 364
            SSK+PV+R VFP+++ STR T  ++   ++ WC+  GDE  GSL H L++++ I  ++A 
Sbjct: 310  SSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAY 369

Query: 365  VAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSELNCTDL 424
             ++F+  + GL L+  LTN GW + Q II +++   IP ++      +A+ +SELN  DL
Sbjct: 370  SSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDL 429

Query: 425  LTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGS-PLIECNQNPSA-IGDYSEST 482
            L FLYQ  E+S M+ CA L   LL     +D   LLK +    ECN    A +G Y E+ 
Sbjct: 430  LKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQ 489

Query: 483  ESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAYYEFTYQIS 542
             S+ WW G A+KFQ FV+EF+++  +RI++LGN  K     +   ++ TD Y+E+ Y   
Sbjct: 490  TSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDKIT-TDTYFEYEYVKI 548

Query: 543  KIDM--LSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTVVA 600
             ID+  L   +  YR     F +P  + F+  VG KL  IK AL ASS +S+ S L+VVA
Sbjct: 549  FIDLEVLGCDDIHYR-----FTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALSVVA 603

Query: 601  RNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLA 660
            ++  ++  PRLAGKNS +ELW+KEED DLSF+SKSI S+E+ S ++E  P YTM LE+L 
Sbjct: 604  QSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILG 663

Query: 661  QLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLIN 720
            QLL   L  +LYP+E+ GYTYE+S S+KG  RL  TISGF +G+  ++++I+D   +L  
Sbjct: 664  QLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQ 723

Query: 721  S-DTVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDI 779
              +++   +FRKAR+ VR KY+E               I+LE CMWP+EDRL+ALE+I +
Sbjct: 724  DLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYV 783

Query: 780  ESFRTFCSGFISKPTYLNVFSQG-DLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPVTH 838
            ESFR F   FI+   YLN+  QG D++  + I+ +L   LT H+SR   +   + EP T+
Sbjct: 784  ESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRLSEPATY 843

Query: 839  ALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKK 898
             +  G+N+F +R  F +DP++SIVYFIQTG+RD+  + +LT LTEF+MS TLVPDLR KK
Sbjct: 844  VIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKK 903

Query: 899  QIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERY 958
            QIGY V  GLR+LS T+GLHIT M+ SPPE LE +I++YLAY+E  VL+ ++  +F+  Y
Sbjct: 904  QIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFKHDY 963

Query: 959  IRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRY 1018
            + +  ++    ++      +GPA+L++QIEANVHSG       AM+ HKR+R QIS  RY
Sbjct: 964  VDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQ-RNTSLAMKSHKRLRTQISYRRY 1022

Query: 1019 NFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIAEKRLFL 1078
            NF  D EP D   L+ L L ++ RFF+++ISI S  R+KLS+MV S +S +E+  K L+L
Sbjct: 1023 NFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKMLYL 1082

Query: 1079 QIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNVILKELSKA 1138
            QIES+LK+KG  IPS +L AIV+ S+GKP+ L++GL  +F ++GE+L+L + +L+E+ K 
Sbjct: 1083 QIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVVKQ 1142

Query: 1139 V---VLSLKPRPTNNNSAGVLQNVRKEVSTAVPLIEV-QANHFR 1178
            +           T + + G LQ + + V+ A+ L +V + N +R
Sbjct: 1143 LFSKATPDSSSSTPSGTHGSLQAMSQHVTPAITLEQVPEVNSYR 1186

>YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Haploid
            specific endoprotease that performs one of two N-terminal
            cleavages during maturation of a-factor mating pheromone;
            required for axial budding pattern of haploid cells
          Length = 1208

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/1219 (39%), Positives = 708/1219 (58%), Gaps = 66/1219 (5%)

Query: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLG 67
            V +++V+FY P+S SN+  ++C+L NGIL L+I                     P ++ G
Sbjct: 6    VTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAG 65

Query: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127
            LAHLCEH ILSAGSKK+P    +H ++A+N GS NA+TTGE TTFYFELP + ++GE  F
Sbjct: 66   LAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTF 125

Query: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187
            + +LD  AS FK P+F+   I+KEIYAI+SEH  N +ST K  YHA R+LANP HPFSRF
Sbjct: 126  ESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRF 185

Query: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247
             TGN  +L   P L K+ +K++L  YF+ N+    + LC+RGPQS+N L KLA   FGD+
Sbjct: 186  STGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDI 245

Query: 248  PASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVPDTSNL------- 300
                           +P S V  + + +R   F+ SK   + QD+   D S+L       
Sbjct: 246  ---------------KPKSAVKERSISIRTRSFRRSKSLKKRQDSSKNDYSDLKTFKILN 290

Query: 301  ---------------------VAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDF 339
                                 + I S+K P++RL+FPVS K+TR T +DI   S  WC+ 
Sbjct: 291  TTWEKKYKNTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCEL 350

Query: 340  FGDEGVGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDL 399
            FGDE  GSL++ L +   + G  A  + F+ G+ GL LE  LTN GW + + I T++ + 
Sbjct: 351  FGDESPGSLSYYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWENIKRITTIVLNR 410

Query: 400  FIPRLIHDKTKDIAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCL 459
             +P         +   L E N  DL++FLYQ +E   ME C+ LS  L    E L P  +
Sbjct: 411  LLPSFYVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNI 470

Query: 460  LKG-SPLIECNQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPK 518
             KG   LIE + +P+ I  Y  +  +  WW G+AIKFQNF+  F+N  N+R+++LGN   
Sbjct: 471  FKGFKSLIEID-DPN-IEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKS 528

Query: 519  SDLLSSVTSVSK--TDAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRK 576
             ++   + + S   TD +YEF Y  + + + S   + +    + F  P  ++FLP     
Sbjct: 529  GNIFDKMKNKSDICTDFFYEFEYYTANVHLAS-DNKFHSNSSYEFNFPTGNLFLPDCVSD 587

Query: 577  LGLIKQALQASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSI 636
               ++Q     S +S+ + L     +   +T P+L  +N N+E+W+ +ED + +  +KS+
Sbjct: 588  PLKLQQLFLECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSV 647

Query: 637  ISIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFT 696
            +S EV    I+  P  T+ LEVLAQ L    S+ LYP+ ++GYTYEI+ S+KG+  L FT
Sbjct: 648  VSFEVLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFT 707

Query: 697  ISGFPEGVCAMVRVIIDQTKSLINSDT--VTPAMFRKARVAVRNKYEEXXXXXXXXXXXX 754
            ISGFPEGV  +V+  +D  K LI +D   ++    RKAR+ VRNKY+             
Sbjct: 708  ISGFPEGVFTIVKTFVDTLK-LIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASV 766

Query: 755  XXXIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFL 814
               IVLE+ +W +EDR++ALE  ++ESF  FC  F   P +L +F QG L Y + I+ +L
Sbjct: 767  GLLIVLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYL 826

Query: 815  DSGLTSHLS-RRTWHEPAVR---EPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDR 870
            ++  T HL       +P +R    P T  L  GTN FI  +   +DP++SIVYFIQT  R
Sbjct: 827  NNNFTQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQR 886

Query: 871  DDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHL 930
            DD + L+LT LTE+L S+TLVPDLR KKQIGY V  GLR+L+ T+G+HIT MS S   +L
Sbjct: 887  DDIKNLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNL 946

Query: 931  ESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEAN 990
            E++I++YL+Y++  VL+  +E +F+   +  F  + ++ +      +AGP DLL +I AN
Sbjct: 947  ETRINEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVAN 1006

Query: 991  VHSG-NLPEQGAAMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKIS 1049
            V +G N       MRQH+++RN+I+  R NF  D E  D+  L+ LTL ++  FF+ KIS
Sbjct: 1007 VQNGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKIS 1066

Query: 1050 ICSTTRSKLSVMVASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPST 1109
            I S  RSKLS+M+ SP++  EIA +++FLQ+E++LK+ G  I + +L+ IVE S+G P  
Sbjct: 1067 IYSAQRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPIL 1126

Query: 1110 LMRGLFKFFLARGETLRLCNVILKELSKAVVLSLKPRPTN----NNSAGVLQNVRK---- 1161
            L++ LF +F  R E  +L  V+L+E+ K + ++LK R  +    ++  G  Q + K    
Sbjct: 1127 LVKNLFTYFRRRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNN 1186

Query: 1162 EVSTAVPLIEV-QANHFRQ 1179
            + S  VPL E+ + N FR+
Sbjct: 1187 DTSPIVPLQELPEPNFFRK 1205

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/1207 (38%), Positives = 709/1207 (58%), Gaps = 41/1207 (3%)

Query: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLG 67
            V+++D+ FYTPIS   +  +LCRL NG+LVLLI                     P E+ G
Sbjct: 6    VKNYDIPFYTPISYRGRTNKLCRLPNGMLVLLISDPGESSFGCSLSVATGSHNDPKEIPG 65

Query: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127
            LAHLCEH IL+AGSKK+P    YHE++A+N G  NAYTTGE TTFYFELP  N +   +F
Sbjct: 66   LAHLCEHMILAAGSKKYPNPGLYHELIAKNKGLQNAYTTGEQTTFYFELPNVNQTSTPVF 125

Query: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187
            + ++D  AS FK+P+F+ +  +KEIYAIESEH  N ++  K  YHA RLLAN  HPFS F
Sbjct: 126  EDIIDVFASFFKDPLFNQTLTSKEIYAIESEHTGNTSNPTKIFYHAERLLANSNHPFSHF 185

Query: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247
             TGN  TL   P L K+N+K+ L  YFK N+ A  M LC++GPQS+N L K+A +YF D+
Sbjct: 186  STGNINTLSSGPQLRKINLKSLLDSYFKVNFKAENMTLCIKGPQSVNILTKIAIRYFSDI 245

Query: 248  PA-SRDRDPTRPPLKKR------------PSSGVASQDLHVRPLDFKNSKQQTQV-QDAF 293
               +  + P R    ++            PSS  + + +     +  +S   T++ ++ +
Sbjct: 246  KGLNSIKKPKRFGTIRKSISTSEKSIPLSPSSPTSCKSISSVLSETNSSLLSTKILENVW 305

Query: 294  VPDTSNLVA-----------IQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGD 342
             P  +N+V            ++S+K PVLRLVFPV     + +  +++     WC+  GD
Sbjct: 306  SPKYNNMVCFDPKPKYNTIIVKSNKKPVLRLVFPVVTNKGKFSKEELITFCNLWCETLGD 365

Query: 343  EGVGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIP 402
            E   S+ + L     I  ++A  + F+  N GL LEF+LT+ G ++   II  + +  IP
Sbjct: 366  ESENSICNILMNEEYITDILAFTSDFALNNIGLILEFSLTDKGLNNVSHIINSIMESAIP 425

Query: 403  RLIHDKTKDIAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKG 462
            +L  + T+++A+ LSE +  DLL FL++ +E S ME C+ LS  + +  + L P+CL K 
Sbjct: 426  KLSKEYTEELARFLSECDSIDLLNFLHKESELSPMEECSDLSGLMQTDLDILKPECLFKQ 485

Query: 463  SPLIECNQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLL 522
            SP+I  N+ P+ IG++ ES+ESR WW+ +A  +Q F+  ++N+  LRI +L +  +    
Sbjct: 486  SPMIVGNKYPT-IGNFGESSESRQWWLNKATMYQEFLEMYMNKDLLRIALLCDFSEKQYF 544

Query: 523  SSVTSVSK--TDAYYEFTYQISKIDMLSVREELYRIPGFS-FRVPCYDMFLPTVGRKLGL 579
                S  K  TD +YEF Y   K+ +L  +    ++  FS  + P  + ++P +GR L  
Sbjct: 545  GKNVSEQKLVTDTFYEFDY--IKLSVLPEKVPEDQVDIFSNLKFPAKNEYIPELGRSLLY 602

Query: 580  IKQALQASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISI 639
            +++ L+  S  S++ +L++   +   + IP+LA K   +E+WV E+    S + K+I++ 
Sbjct: 603  LREMLKKVSYESRSPILSLTTPSKATRPIPKLAEKGDMYEMWVMEDKFRPSTEKKTIVTF 662

Query: 640  EVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISG 699
            ++ S  +   P  TM LE+L Q+L   LS  LYPS KLGYTYEI+ S+KG  RLSFT+SG
Sbjct: 663  DLLSLDVPPTPKNTMHLEILGQILYVLLSPKLYPSLKLGYTYEIASSSKGDVRLSFTLSG 722

Query: 700  FPEGVCAMVRVIIDQTKSL-INSDTVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXI 758
            + +G+  +V+ +I    ++ I+ +  +  + R+AR+  R KYE                I
Sbjct: 723  YSDGLTEVVKTVIKTCFTIAIDDEIPSKRLLRRARILTRRKYESAAAENCAKLASVGLII 782

Query: 759  VLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGL 818
            +LE+ +WP+EDRL+ALEE DI SF+ FC  F+    YLN+  QG+L    EI+ +L+   
Sbjct: 783  MLEKYIWPLEDRLNALEESDIHSFKEFCIAFLRSKKYLNLIVQGNLKCANEINKYLNDSF 842

Query: 819  TSHLSRRTWHEPAVRE--PVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQML 876
            T+HL  ++       +    T  L+PGTN         +DP++ IVYFIQTG RDD + L
Sbjct: 843  TNHLGEKSGKNTKSVDCSKTTKLLEPGTNCIFEHFGHPDDPNNCIVYFIQTGKRDDKKAL 902

Query: 877  SLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQ 936
            +LT  TE+L+S+TLVPDLR KKQIGY VF G+R+LS T+G+HIT MS S P  LE +ID+
Sbjct: 903  ALTSFTEYLLSLTLVPDLRNKKQIGYVVFGGMRVLSDTVGIHITVMSGSNPLDLEEKIDE 962

Query: 937  YLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNL 996
            YL ++E +VL  +SEE+F +++++ + +    ++       AGP ++L  I ANV +G+ 
Sbjct: 963  YLYFLESEVLKKLSEEQFGKKFVKDYLSTMGGDSTGDMMSTAGPPNVLDGIAANVQAGDF 1022

Query: 997  PEQGA-AMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTR 1055
                +  M  H+RI+N+I+  RYNF++D    DL  ++ LTL ++ +FF+E ISI S  R
Sbjct: 1023 SVLNSLQMITHRRIKNEITSKRYNFSNDDIETDLNFIKHLTLKKYLKFFEENISISSVNR 1082

Query: 1056 SKLSVMVASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLF 1115
            SKLSV + SP++  EI  ++ FLQ+E +LKL G  I +  L+++V  SQG+P  L + LF
Sbjct: 1083 SKLSVAITSPMATQEIMNRKFFLQLEGFLKLNGFTINNDTLKSMVSESQGRPGKLFKLLF 1142

Query: 1116 KFFLARGETLRLCNVILKELSKAVVLSLKPR-----PTNNNS-AGVLQNVRKEVSTAVPL 1169
             +F  RGE  + C ++  E+ K + +S+KP      P++  S +  +Q     V  A+ L
Sbjct: 1143 NYFSNRGEGWKFCKIVTSEVLKIIAISVKPNFSGIFPSSKQSDSSNIQTWSSSVKPAITL 1202

Query: 1170 IEVQANH 1176
             +V   H
Sbjct: 1203 TKVNDVH 1209

>KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} similar
            to uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1170

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1182 (39%), Positives = 715/1182 (60%), Gaps = 45/1182 (3%)

Query: 7    AVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVL 66
             VQ  DV  YTPIS+SN+  +  +L+NGI  LLI                     PDEV 
Sbjct: 5    TVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVP 64

Query: 67   GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASND-SGEL 125
            GLAHLCEH I+S+ SKKFP+ SHYH+++ +  G+ NA+TTGE T+FYFE+P SN+ +G+ 
Sbjct: 65   GLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKP 124

Query: 126  LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
            +FD+++  +A    +P+F  + INKEI AI++EH  NK    K LYH T+ LA  R  FS
Sbjct: 125  IFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFS 184

Query: 186  RFCTGNFATLCDEPNLHK--VNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKY 243
            RF TGN  TL   P +    +N+K  L +++  N+ A  +++ +RG QSL+ L KL +  
Sbjct: 185  RFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTT 244

Query: 244  FGDLPAS---RDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVPDTSNL 300
            FGD       + +  +    KK      A    +  PL    SKQ+        P+T N 
Sbjct: 245  FGDFRTKSTIKSQSFSIESFKKLQKVWAAR---YTEPL---FSKQE--------PETPNS 290

Query: 301  VAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLING 360
            + IQSSK P+LRLVFPVSH+    + +++   S+ W D FGDE  GS+       N++  
Sbjct: 291  ILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFSARNILTR 350

Query: 361  VVASVAHFSAGNDGLTLEFTLTNLGWSSA-QLIITVLFDLFIPRLIHDKTKDIAKCLSEL 419
             V  ++ F+  ++GL L+F LTN GW +  + ++T LF  F+P        +IA+ L+E 
Sbjct: 351  QVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDEIAQYLNEW 410

Query: 420  NCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDYS 479
            N  +LL F+YQ  + S+M+ C+ L S LL   +  DP+ +L  S    CN+  S IG Y 
Sbjct: 411  NTINLLQFMYQDLDNSTMDKCSDLCSELL---QCEDPQFILNNSIAFSCNRKGSDIGSYY 467

Query: 480  ESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSS--VTSVSKTDAYYEF 537
            ES +S+ WW  +A KF +FV  +++  N +++ LG+   +D L S  V +  K D +Y F
Sbjct: 468  ESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPTNVKFDEHYRF 527

Query: 538  TYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLT 597
             Y++S I +  V+     +    FR+P    FL  + + L  +KQ+L A   +SQ S L+
Sbjct: 528  QYELSLIKLNHVK-----MSPKDFRLPSSTAFLFGLEKNLSALKQSLTAVLRKSQGSALS 582

Query: 598  VVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLE 657
            ++ ++  LQT PRL  KN N+ELWVKEE+S L + S+S+I+IE+ +  +E     TM LE
Sbjct: 583  IITQSKLLQTTPRLMSKNENYELWVKEENS-LEYSSRSVITIELINMGMEPSAKNTMNLE 641

Query: 658  VLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKS 717
            +L QLL   ++  LYPSE++GY Y+I+ + +G  RL+ TI+GFP+GV  ++++I+D+   
Sbjct: 642  ILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVD 701

Query: 718  LINSD-TVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEE 776
            +   D  +T +MFR +R+ VR KYEE               I+LE+ +  +E+RLDALE+
Sbjct: 702  IGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVLILLEKELTTLEERLDALED 761

Query: 777  IDIESFRTFCSG-FISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAV--- 832
            IDIESF+ FC   +I K  Y+N+  QGDLS  E ++ ++D G+  HLS    ++ +V   
Sbjct: 762  IDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMD-GIIHHLSGPNVNQTSVFRL 820

Query: 833  REPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVP 892
            REP T  L  G+N FI  ++F EDP++S+VYFI+TGDR +    +++ L E+ MSMTLVP
Sbjct: 821  REPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVP 880

Query: 893  DLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEE 952
            DLR KKQIGY V  GLRLL+ T+G+HI+ MS+ PP  +E +I++YL Y+E +VL AM+E 
Sbjct: 881  DLRNKKQIGYVVLGGLRLLTDTLGIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEA 940

Query: 953  EFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLP----EQGAAMRQHKR 1008
            EFQ+  ++K+  + +  ++      AGPA+L+AQIEA+VHSGN P     QG  + QHK+
Sbjct: 941  EFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPSNLQSQGYTVGQHKK 1000

Query: 1009 IRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSA 1068
            ++++IS   Y F+      D+ LL  LTL +F+R F EKISI S  R KLSV   +P++ 
Sbjct: 1001 LKDEISFRTYAFSET--KVDVCLLSKLTLQEFKRLFMEKISILSLQRRKLSVRFKTPMTK 1058

Query: 1069 DEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLC 1128
             +I    + +Q++ +LK KG  I   EL+ IV  + GKP++L + LF  F  +G++LRLC
Sbjct: 1059 PDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKELFHHFRTQGQSLRLC 1118

Query: 1129 NVILKELSKAVVLSLKPRPTNNNSAGVLQNVRKEVSTAVPLI 1170
             ++LKE+ K  +L++ P  +++++  + QN++ ++ T +  I
Sbjct: 1119 TLVLKEIVKQ-ILAVTPSSSSSSNTKLTQNIKTQIPTEIQSI 1159

>Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1206 (40%), Positives = 703/1206 (58%), Gaps = 40/1206 (3%)

Query: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLG 67
            V +++V  Y P+S SN+  ++C+L NGIL LLI                     P + LG
Sbjct: 6    VINYEVPIYIPLSYSNRTHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDPKDTLG 65

Query: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127
            LAHLCEH IL+AGSK++P +  +H ++A+N GS NAYTTGE TTFYFELP S  +GE  F
Sbjct: 66   LAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAF 125

Query: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187
            + +LD  AS FKNP+F+   I+KEIYAI+SEH  N +ST K  YHA RLLAN  HPFSRF
Sbjct: 126  EFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRF 185

Query: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247
             TGN  +L   P L K+N+K +L  YFK NY    + +C+RGPQS+N LAKLA   FGD+
Sbjct: 186  STGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDI 245

Query: 248  PASRDRDPTRPPLK----KR----PSSGVASQDLHVRPLDFK----NSKQQTQVQDAFV- 294
                  +     ++    +R     S+G  S++ H +   FK      +++ +    F  
Sbjct: 246  KPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEH 305

Query: 295  PDTSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKT 354
            P   N + I S+K+PV+R +FPVS K+TR T  DI   S  WC+ FGDE  GSL   L +
Sbjct: 306  PPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVS 365

Query: 355  NNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAK 414
               I    A  + F+ GN GL LE  LTN GW S + I T +F   +P         +  
Sbjct: 366  RGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNIDYLIT 425

Query: 415  CLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKG-SPLIECNQNPS 473
             L E N  D+  FLYQ +E   ME C+ LS+ L    E L P  + KG   LIE + +P+
Sbjct: 426  FLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEID-DPN 484

Query: 474  AIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSK--T 531
             I  Y  S  +  WWIG+AIKFQNF+   +N +N R+++LGN    ++   +   S+  T
Sbjct: 485  -IDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSEMYT 543

Query: 532  DAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRS 591
            D +YEF Y   K+D L+  +E Y    + F  P  ++FLP        ++Q     S +S
Sbjct: 544  DFFYEFEYYTGKVD-LTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSLKS 602

Query: 592  QTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPS 651
            + + L    ++   + +P+L  KN N+E+WV +ED +    +KSI+S E+    I+  P 
Sbjct: 603  KFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPSPE 662

Query: 652  YTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVI 711
             T+ LEVLAQ+L    S+ LYP+ ++GYTYEI+ S+KG+  L FTISGF EGV  + +  
Sbjct: 663  ATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAKTF 722

Query: 712  IDQTKSLINSDT-VTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDR 770
            +D  K +    T ++    RKAR+ VR KYE                IVLEE MW ++DR
Sbjct: 723  VDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQDR 782

Query: 771  LDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTW-HE 829
            +DALE  +  SF+ FC  F + P  L +  QG+L Y +EI+ +L++  T HL      + 
Sbjct: 783  IDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNEDNR 842

Query: 830  PAV---REPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLM 886
            P +     P T  L  GTN F+  +   +DP++SIVYFIQT  R+D + ++LT LTE+L 
Sbjct: 843  PTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEYLF 902

Query: 887  SMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVL 946
            S+TLVPDLR KKQIGY V  GLR+L+ T+G+HIT MS  P  +LE++I++YL+Y++  VL
Sbjct: 903  SLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQVL 962

Query: 947  SAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSG-NLPEQGAAMRQ 1005
            +  +E +F+   +  F A+ ++ +      ++GP +LL +I ANV +G N       M+Q
Sbjct: 963  NTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQMKQ 1022

Query: 1006 HKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASP 1065
            H++IRN+I   R++F  + E  D+  L+ LTL ++  FF+ KISI S  RSKLS+M+ SP
Sbjct: 1023 HRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMITSP 1082

Query: 1066 VSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETL 1125
            ++ ++I  +++FLQ+E++LK+KG  I S +L++IV++S+G P  L++ LF  F  R E  
Sbjct: 1083 MAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNEAF 1142

Query: 1126 RLCNVILKELSKAVVLSLKPR-------PTNNNSAGVLQNVRKEVSTAV-PLIEVQA--- 1174
            +L  V+L+E+SK +++S K R       P + N     Q++ K   T + P+I +Q    
Sbjct: 1143 KLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEH---QDIEKFWKTDIKPIIPLQGLPD 1199

Query: 1175 -NHFRQ 1179
             N FR+
Sbjct: 1200 PNVFRR 1205

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1207 (40%), Positives = 708/1207 (58%), Gaps = 42/1207 (3%)

Query: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLG 67
            V +++V+F+ P+S SN+  ++C+L NGIL LLI                     P ++ G
Sbjct: 6    VTNYEVSFHIPLSYSNRAHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDPMDIPG 65

Query: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127
            LAHLCEH ILSAGSKK+P    +H ++A+N GS NAYTTGE TTFYFELP + ++GE  F
Sbjct: 66   LAHLCEHMILSAGSKKYPDPGLFHALIAKNNGSQNAYTTGEQTTFYFELPNTQNNGEFAF 125

Query: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187
            + +LD  AS FK+P+F+   I+KEIYAI+SEH  N +ST K  YHA R+LAN  HPFSRF
Sbjct: 126  ESILDVFASFFKDPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANSDHPFSRF 185

Query: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247
             TGN  +L   P L K+N+K++L  YF++N+    + LC+RG QS+N L KLA   FGD+
Sbjct: 186  STGNIHSLSSIPQLKKINLKSSLNTYFRSNFFGENITLCIRGSQSVNILTKLAISKFGDV 245

Query: 248  -PAS----RDRDPTRPPLKKRPS--SGVASQDLHVRPL-DFK------NSKQQTQVQDAF 293
             P S    R     + P +K  S    + S     R L DFK        K Q  +    
Sbjct: 246  KPKSIVKERHFSIGKGPFRKSTSLRRSLNSPKNDYRNLEDFKILDTVWEKKYQNTMCFQH 305

Query: 294  VPDTSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLK 353
             P+  N + I S+K PV+R +FPVS ++TR T +DI   S  WC+ FGDE  GSL+H L 
Sbjct: 306  APEC-NSIFINSNKMPVMRFLFPVSDRNTRFTKDDIKIYSHLWCELFGDESPGSLSHYLV 364

Query: 354  TNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIA 413
            +   I    A  + F+ G+ GL LE  LTN GW S + I T +F   +P         + 
Sbjct: 365  SRGWITKCFAFTSEFAIGDIGLILELELTNSGWKSIKNITTTIFSELLPSFYVKNIDHLV 424

Query: 414  KCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKG-SPLIECNQNP 472
              L E N  DL  FLYQ +E   ME C+ LSS L    E L P  + KG   LIE + +P
Sbjct: 425  TFLKEQNLIDLARFLYQSSENLPMEECSNLSSFLQENLECLTPSNVFKGFKSLIEID-DP 483

Query: 473  SAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVS--K 530
            + I  Y E+  +  WW G+AIKFQNF+   +   N R+++LG+     +   + + S  +
Sbjct: 484  N-IEKYEETKANVRWWTGQAIKFQNFLKSHMKHDNTRLLLLGDIKSHKIFHIIENKSEIR 542

Query: 531  TDAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNR 590
            TD +YEF Y    +  L+   + Y    + F  P  ++FLP        ++Q     S +
Sbjct: 543  TDFFYEFEYYTGSVH-LAEENKYYPKSSYEFNFPKSNLFLPDYISDPLKLRQLFLECSLK 601

Query: 591  SQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACP 650
            S+ + L     +   +  P+L  +N N+E+W+ +ED + +  +KS++S EV    I+  P
Sbjct: 602  SKFATLRPQIYSEPTRREPQLVSENLNYEMWILKEDPNFASNNKSVVSFEVLGLGIKPSP 661

Query: 651  SYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRV 710
              T+ LEVLAQ+L    S+ LYP+ ++GYTYEI+ S+KG   L FTISGFPEGV  +V+ 
Sbjct: 662  EATIHLEVLAQVLFIITSSHLYPALRIGYTYEIASSSKGSVTLRFTISGFPEGVFKIVKT 721

Query: 711  IIDQTKSLINSDT--VTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVE 768
             +D  K LI +D   ++    RKAR+ VR+KYE                IVLEE +W ++
Sbjct: 722  FVDTLK-LIATDPTFLSKDTLRKARIFVRSKYESASSDNCVKLASIGLLIVLEEFIWTLQ 780

Query: 769  DRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHL------ 822
            DR++ALE  ++ESF+ FCS F   P  L +  QG L Y +EI+ +L+   T HL      
Sbjct: 781  DRINALELTEMESFKEFCSLFWKNPKQLVLLVQGSLDYADEINHYLNRNFTQHLKVCNEG 840

Query: 823  SRRTWHEPAVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLT 882
            S+ T H      P T  L  GTN FI  +   +DP++SIVYFIQT  RDD + L+LT LT
Sbjct: 841  SKSTIH--LYPSPSTKNLDEGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIENLALTFLT 898

Query: 883  EFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYME 942
            E+L S+TLVPDLR +KQIGY V  GLR+L+ T+G+H+T MS S   +LE++I++YL+Y+E
Sbjct: 899  EYLFSLTLVPDLRNRKQIGYIVLGGLRVLTDTVGIHVTVMSGSSAHNLETKINEYLSYLE 958

Query: 943  HDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSG-NLPEQGA 1001
              VL  ++E +F++  +  F  + ++ ++T   ++AGP DLL +I ANV +G N      
Sbjct: 959  LQVLDNLTEIDFRKMLLEPFLTLLKQNSITKFEESAGPVDLLNEIVANVQNGDNYTLNNR 1018

Query: 1002 AMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVM 1061
             M+QH+++RN+I+  R NF  + E  ++  L+ LTL ++ RFFQ KISI ST RSK+S+M
Sbjct: 1019 QMKQHRKVRNKITEKRLNFQEEYEMVNIPFLQKLTLKKYLRFFQAKISIYSTQRSKISIM 1078

Query: 1062 VASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLAR 1121
            +ASP++ ++IA +R+FLQ+E++LK+KG  I + +L+ IVE S+G P  L++ LF  F  R
Sbjct: 1079 IASPMAEEKIASRRIFLQLEAFLKIKGFAIKNEDLKKIVEHSEGSPMLLVKNLFTHFRKR 1138

Query: 1122 GETLRLCNVILKELSKAVVLSLKPRP------TNNNSAG--VLQNVRKEVSTAVPLIEV- 1172
             E  +L  V+L+E+ K + ++ K         +++NS G  V    + ++   +PL E+ 
Sbjct: 1139 NEAFKLGTVVLQEILKIIGMNFKQGYGSVLGFSSHNSEGQDVKNFWKNDIEPVIPLQELP 1198

Query: 1173 QANHFRQ 1179
              N FR+
Sbjct: 1199 DPNFFRK 1205

>Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR122W
            (REAL)
          Length = 1218

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/1170 (40%), Positives = 670/1170 (57%), Gaps = 37/1170 (3%)

Query: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLG 67
            V ++++ FY P+S  N+  ++C+L NGIL L+I                     P+++ G
Sbjct: 6    VSNYEIPFYIPLSYGNRTHKICKLPNGILALIISDPTDSSSSCSLSVCTGSHNDPEDIPG 65

Query: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127
            LAHLCEH IL+AGSKK+P    +H ++A+N GS NA+TTGE TTFYFELP +  +GEL F
Sbjct: 66   LAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSNGELAF 125

Query: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187
            +  LD  AS FK P+F+   I KEIYAI+SEH  N +ST K  YHA R+LAN  HPFS F
Sbjct: 126  ESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADHPFSHF 185

Query: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247
             TGN  +L   P+L K+NVK +L  YFK N+    M LC+RG QS+N L KLA   FGD+
Sbjct: 186  STGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAISKFGDI 245

Query: 248  PASRDRDPTRPPLK---------------KRPSSGVASQDLHVRPLDFKNSKQQTQVQDA 292
                D   +   +K                  +    S+  +    + +NSK    V + 
Sbjct: 246  SLKNDIKGSNFSIKAGSFRRSRSLRRSQDASKTGSPTSESSNTSSYNLENSKISDTVWEE 305

Query: 293  FV--------PDTSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEG 344
                      P   N + I SSK P++R +FPVS K+TR T  DI   S  W + FGDE 
Sbjct: 306  KYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWRELFGDES 365

Query: 345  VGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRL 404
             GSL+H L +        A ++ F+ GN GL LE  LT  GW S + I T +F   +P  
Sbjct: 366  PGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSKLLPSF 425

Query: 405  IHDKTKDIAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKG-S 463
                   +   L E N  D+  FLYQ +E   ME C+ LS  L    E L P  + KG  
Sbjct: 426  CTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNIFKGFK 485

Query: 464  PLIECNQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLS 523
             LIE N +P+ I  Y  +  +  WW G+AIKFQNF+  F+N +N RI++LG+    +L  
Sbjct: 486  SLIEIN-DPN-IEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHNLFD 543

Query: 524  SVTSVSK--TDAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIK 581
             +   S+  T+ +YEF Y + ++  LS   + +    + F  P  + FLP        ++
Sbjct: 544  KIEDESEIHTEFFYEFEYYMGRVH-LSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLKLQ 602

Query: 582  QALQASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEV 641
            Q     S +S+ + L    ++  ++ +P+L  KN N+E+WV +ED + +  + S++S EV
Sbjct: 603  QLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSFEV 662

Query: 642  ASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFP 701
                I+  P  T+ LEVLAQ+L  + S+ LYP+ + GYTYEI+ S+KG+  L FTISGF 
Sbjct: 663  IGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISGFS 722

Query: 702  EGVCAMVRVIIDQTKSLINSDTVTPA--MFRKARVAVRNKYEEXXXXXXXXXXXXXXXIV 759
            EGV  + +  +D  K LI +D   P+    RKAR+ VR+KYE                IV
Sbjct: 723  EGVFKITKAFVDTLK-LIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLIV 781

Query: 760  LEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLT 819
            LEE MW ++DR+DALE  D+ES + FCS F   P  L +  QG+L Y +EI+ +L++  T
Sbjct: 782  LEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNFT 841

Query: 820  SHLSR-RTWHEPAVR---EPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQM 875
             HL      + P +R    P T  + PGTN FI  +   +DP++S+ YFIQT  RD+ + 
Sbjct: 842  QHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIEN 901

Query: 876  LSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQID 935
            L+LT LTE++ S TLVPDLR KKQIGY V SGLR+L+ T+G+HIT MS S    LE++I+
Sbjct: 902  LTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKIN 961

Query: 936  QYLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSG- 994
            +YL+Y+E  VL+  +E  F+   +  F A+ ++ N       +GP++LL +I ANV +G 
Sbjct: 962  EYLSYLEFQVLNNFTESTFRTMLLEPFLALLKKNNFNKLKTLSGPSNLLNEIVANVQNGD 1021

Query: 995  NLPEQGAAMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTT 1054
            +       M+ H+RIRN IS  R +F  + E  D+  L+ LTL ++  FF  +ISI S  
Sbjct: 1022 DYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSRQ 1081

Query: 1055 RSKLSVMVASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGL 1114
            RSKLS+M+ SP++ +EIA +++FLQ+E++LK+KG  I S +L  IVE S+G P  L++ L
Sbjct: 1082 RSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKNL 1141

Query: 1115 FKFFLARGETLRLCNVILKELSKAVVLSLK 1144
            F FF  R E  +L  V+LKE+SK + ++ K
Sbjct: 1142 FTFFRKRSEAFKLGTVVLKEISKIIAINFK 1171

>NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1199

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/1203 (38%), Positives = 699/1203 (58%), Gaps = 43/1203 (3%)

Query: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLG 67
            V+++D  FY P   S++  +LCRL NGIL LLI                     P ++ G
Sbjct: 6    VENYDTPFYIPRCYSDRVHKLCRLPNGILTLLISDPKDTISACSLSVATGSHNDPADLPG 65

Query: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127
            LAHLCEH +L+AGSK +P +  YH ++ +N G+ NA+TTGE TTFYFE+P + +SGEL+F
Sbjct: 66   LAHLCEHMVLAAGSKDYPNAGLYHSMLTKNNGTQNAFTTGEQTTFYFEVPTTQNSGELIF 125

Query: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187
            DK++D  +S FK P+F+    NKEIYAI+SEH  N +S  K LYHATRL+AN  HPFS+F
Sbjct: 126  DKLVDVFSSFFKEPLFNPLLTNKEIYAIQSEHEGNISSLNKILYHATRLMANKDHPFSQF 185

Query: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247
             TGN  TL   P L K+N+K  L  YF  N+  ++M LC+RGPQS+N L KL    FGD+
Sbjct: 186  STGNINTLSSIPQLKKINLKKALLDYFARNFYGSKMTLCVRGPQSVNTLTKLVVSKFGDI 245

Query: 248  PASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVP------------ 295
             A+     ++        S  + Q    +P D    +Q   ++  + P            
Sbjct: 246  RANNGLKRSKFGSISSRLSISSFQSKERQPTDL---EQYNILKSTWKPKYREAPCFTHDS 302

Query: 296  DTSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTN 355
            D++N++ I+S+K   LR +FPV  K ++ +S  +      WC+ FGDE  GSL + L   
Sbjct: 303  DSANMIFIRSNKQSTLRFLFPVEDKFSKFSSKTVSLFKNFWCELFGDETKGSLCYLLVGK 362

Query: 356  NLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKC 415
            + I    A  + FS+G+ GL L+F LTN GW +   II ++ D  I   I   T  ++  
Sbjct: 363  SWITDCFAYTSEFSSGSYGLILQFALTNTGWDNVDKIINIVLDNTIAAFIDKPTDQLSCF 422

Query: 416  LSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLI-ECNQNPSA 474
            L E N  DL+ FLYQ  EKS ME C+ +S  L    E LD   L KG+P I +C  N + 
Sbjct: 423  LKEQNTIDLIRFLYQPTEKSPMEECSNISCLLQEDLEDLDISYLFKGAPTISDCYSNDNN 482

Query: 475  IGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAY 534
              D  E  +    W+ +A +FQ F+  F+NR N+ + +LGN   +  L S+  +      
Sbjct: 483  TVDMIEYEQE--CWLKQAREFQEFLKVFMNRSNVFLFLLGNEKIAHSLRSIIRIR----- 535

Query: 535  YEFTYQISKIDMLSVREELY-RIPG-----FSFRVPCYDMFLPTVGRKLGLIKQALQASS 588
            Y    Q   +++L+V   +Y R P      ++F+VP  + F+P   + + +++Q    SS
Sbjct: 536  YFLLMQCMSLNILNV---IYLRFPKLLSTQYTFQVPPPNAFIPPSCQDVTILQQLFLESS 592

Query: 589  NRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEA 648
             +S+ S   +   N  L  +P L  +NS++E+W  +   D S   KSI+S E+ ++++  
Sbjct: 593  LKSRFSTFRLQLLNTNLGNVPHLISRNSSYEMWALDNPIDASIDKKSIMSFEIFNRSMIP 652

Query: 649  CPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMV 708
             P  ++ LE+L+Q+L   +S  LYPS +LGY+YEIS S KG  +L  TI GF EG+ +++
Sbjct: 653  SPENSINLEILSQILSTLISPQLYPSIRLGYSYEISSSPKGDIQLKVTIGGFSEGIISIL 712

Query: 709  RVIIDQTKSLINSDTV-TPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPV 767
              I+     ++ +    +  + R++RV VRN YE                I+LE  MW +
Sbjct: 713  DTIVKTLLFIMKTPQFPSKELLRRSRVLVRNLYEAAASDNCVTLASMGLLIILERNMWTL 772

Query: 768  EDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLS-RRT 826
            +DRL+ALEEID+ SF+ FC  F+ +P Y+N+  QG+L Y EEI+ +L++ LT HL     
Sbjct: 773  QDRLEALEEIDMVSFKEFCVQFLEEPMYMNLLIQGNLDYGEEINNYLNTNLTHHLECSNV 832

Query: 827  WHEPAVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLM 886
             +E       T  L+PG+N + + +  ++DP++SIVYFIQTG R + + ++LT  TE++M
Sbjct: 833  KNEKQSSTLSTILLEPGSNFYAKYNGHMDDPNNSIVYFIQTGLRTNRRTVTLTYFTEYIM 892

Query: 887  SMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVL 946
            S+TLVPDLR K+QIGYAVF GLR L++T+G+HIT MS   P  LE +ID+Y+AY+E  +L
Sbjct: 893  SLTLVPDLRNKRQIGYAVFGGLRELTSTIGIHITVMSGISPSDLEIKIDEYIAYLEETLL 952

Query: 947  SAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAA-MRQ 1005
            ++++E +F  +Y + +  +           + GPADLL ++ ANV SGN  E  +  M+ 
Sbjct: 953  NSLTENQFTLQYKQGYLDLLSNHKFMELEKSGGPADLLNEVVANVQSGNADELNSHFMKS 1012

Query: 1006 HKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASP 1065
            HK   N+IS  RY F  D E  D+ +++ LT  +F +FF+EK+SI S  RSK+SVM+ SP
Sbjct: 1013 HKHFFNEISNKRYQFKGDSELVDIEVIKNLTKKEFLKFFREKVSIKSKVRSKISVMIESP 1072

Query: 1066 VSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETL 1125
            ++  EI  ++ FLQ++++LKL+G  I S  LR IVE + G+PS L++ LFK+F  R E L
Sbjct: 1073 MAEMEIVNRKTFLQLQAFLKLEGFTINSEILRDIVERANGRPSALIKDLFKYFRERNEAL 1132

Query: 1126 RLCNVILKELSKAVVLSLKPRPTNNNSAGVLQ-------NVRKEVSTAVPLIEVQ-ANHF 1177
            RLC VILKE+ K    SLK R T   S+  ++       N  ++   A+PL E++  N F
Sbjct: 1133 RLCTVILKEVVKVSASSLKHRYTPKVSSSKMKPKRQSSSNWDQDTEPAIPLKEIKDLNEF 1192

Query: 1178 RQR 1180
            + R
Sbjct: 1193 KGR 1195

>ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1189

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/1195 (40%), Positives = 710/1195 (59%), Gaps = 22/1195 (1%)

Query: 4    MSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPD 63
            +S  ++++D+ F TP S   +  +LC+L NG+L LLI                     P 
Sbjct: 2    VSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENSSACSLSVASGSHNDPS 61

Query: 64   EVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSG 123
            E+ GLAHLCEH +L+AGS+K+P   +YHE++ +NGGS NA+TTGE T+FYFELP    S 
Sbjct: 62   EIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSL 121

Query: 124  ELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHP 183
            +  FD+ LD  AS F  P+F+ + INKE YAIESEH+VN +S  K  Y ATRLLAN  HP
Sbjct: 122  QEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHP 181

Query: 184  FSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKY 243
            FSRF TGN +TL   P+L  +N+K  L +YFK N+ A++M LCLRGPQS+++LAKLA   
Sbjct: 182  FSRFSTGNISTLNSIPHLKNLNLKNLLHEYFKENFCASKMTLCLRGPQSIHSLAKLALTK 241

Query: 244  FGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQ----QTQVQDAFVPD-TS 298
            F  +  +  R    PP+    S   +++ + V P +   SK     + + Q  F  D   
Sbjct: 242  FSLIKNNPQRYRPSPPVSPSKSKRSSNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQE 301

Query: 299  NLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLI 358
              + I+SSKNP +R +FP   ++TR TS DI  L+  W + FGDE  GS +H L++   +
Sbjct: 302  KFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWV 361

Query: 359  NGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSE 418
                A V+  + GN  L LE  LT  G+ +   I  VLF+  IP L    T ++A+ +S+
Sbjct: 362  TYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMSK 421

Query: 419  LNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDY 478
             NC DL+ FLYQ AE S ME C  LSS +    E LDP  + KGSP++  ++    IG+Y
Sbjct: 422  QNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMM-IDEQHHNIGNY 480

Query: 479  SESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAYYEFT 538
             E+ ES  WWIG+AIKFQ+F+ +F+ + N+R+V+ GN  +S L    +   + D +YEF 
Sbjct: 481  GENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNSRESQLEELSSQEFQVDLFYEFE 540

Query: 539  YQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTV 598
            Y   K D +  ++ L     ++F++P  D  +P + +    +K+ L  SS +SQ++ L+ 
Sbjct: 541  Y--FKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQSAPLSF 598

Query: 599  VARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEV 658
               N  L+ +P L  +N  HE+WV  +D D S   KSI+S E+    +EACP  TM LE+
Sbjct: 599  TIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRNTMNLEI 658

Query: 659  LAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSL 718
            L Q++   LS  +YPS KLG+T EI+ S KG  RL FTISGF + + + V+ II+  K +
Sbjct: 659  LGQIIFILLSPEIYPSLKLGFTCEIT-SNKGDIRLGFTISGFSKQLTSFVKSIIETIKRI 717

Query: 719  I-NSDTVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEI 777
              + D ++    R+AR+ VRNKYE                IVLE+ MW +EDRL+ALE+I
Sbjct: 718  SQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDI 777

Query: 778  DIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPV- 836
            D+++F+ FC  F+    YL++F QGDLS  +E++ +L    T HL    +        V 
Sbjct: 778  DMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQGKTFTVE 837

Query: 837  -THALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLR 895
             T  L+PGTN  ++     +DP++SI+YFIQTG R+D  + +LT  T F+MS+ L  +LR
Sbjct: 838  TTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELR 897

Query: 896  TKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQ 955
             K+Q+GY V  GLRLLS ++GLHIT MS   P  LE++ID+YL Y+E   L  + E+ F 
Sbjct: 898  NKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQ-LQKLDEQTFH 956

Query: 956  ERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGN---LPEQGAAMRQHKRIRNQ 1012
            + Y+R +  + +       ++++GPADLL+++ ANV  G+   L  Q   M++HK+++ Q
Sbjct: 957  QEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQ--TMKRHKKLQTQ 1014

Query: 1013 ISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIA 1072
            I   +Y+F ++ E  D  L+  ++L Q+  FF+  ISI S  RSK+S+M++S ++  +I 
Sbjct: 1015 IIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRSKISIMISSSIAEKDII 1074

Query: 1073 EKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNVIL 1132
             K++FLQ+E++LK+KG  IP+ EL+ IVE S GKP  L   L+  F  R + LRLC+VIL
Sbjct: 1075 NKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLCSVIL 1134

Query: 1133 KELSKAVVLSLKPRPTN----NNSAGVLQNVRKEVSTAVPLIEVQANHFRQRSPV 1183
             EL K +  SL+ R  N    + S   LQ    +V  A+ L  ++  +F +R  +
Sbjct: 1135 AELFKMLAKSLRHRYGNLAHDDTSKRDLQEWSTDVKPALDLKVIEDINFFKRVQI 1189

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/1154 (40%), Positives = 687/1154 (59%), Gaps = 24/1154 (2%)

Query: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLG 67
            ++ FDV  Y P++ SN+  +LC L NG+L LLI                     P ++ G
Sbjct: 6    IKDFDVPLYLPLAYSNRVHKLCLLPNGLLTLLISDPADTVTSCSLSVASGSHNDPKDIQG 65

Query: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127
            LAHLCEH IL+AGSK +P    YHE +++N G HNA+TTGE TTFYFE+P  +  GEL+F
Sbjct: 66   LAHLCEHMILAAGSKSYPDPGLYHETLSKNNGVHNAFTTGEQTTFYFEVPNVHHGGELVF 125

Query: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187
            D++LD  AS FK P+F+    NKEIYAI+SEH+ N +S  K LYHATR+L++P HPFS+F
Sbjct: 126  DEILDIFASFFKEPLFNPLLTNKEIYAIQSEHDGNMSSVTKILYHATRMLSDPGHPFSQF 185

Query: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247
             TGN  TL   P L  VN++ TL QYFK NY A++M LCLRGPQS+N L K A   FGD+
Sbjct: 186  STGNMNTLASIPKLQGVNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKYALSKFGDI 245

Query: 248  PA----SRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKN------SKQQTQVQDAFVPDT 297
                  +R R  +   +  + SS  ++++ H    D ++      S +Q        P+ 
Sbjct: 246  KENTALTRSRFGSMSSISTKRSSKSSTEN-HSTKNDLESFNILEESWRQKYCDIPCFPEI 304

Query: 298  S--NLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTN 355
            S  N++ I+SSK P LR++FPV+   TR T  +I    + WC+ FGDE  GSL + L   
Sbjct: 305  SKENMIFIKSSKQPTLRILFPVTDNKTRFTKGEIKIFGDLWCELFGDETKGSLCYYLVGK 364

Query: 356  NLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKC 415
            + I    A  + F+ GN GL +E TLT+ GW ++  II ++    +         ++A  
Sbjct: 365  SWITSCYAYTSSFALGNIGLIIELTLTSTGWENSDTIIEIVLGKLVETFSEQYVHELANF 424

Query: 416  LSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAI 475
            + + N  DL+ FLYQ  +K+ ME C+ LS  L +  +  +   + KGSP I      +  
Sbjct: 425  MEDQNSIDLIRFLYQVPKKNPMEECSNLSELLQNDLKAPNMAYIFKGSPPITDMHEGNVG 484

Query: 476  GDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLL--SSVTSVSKTDA 533
            G  SE   ++ WWI +AIKFQ+F+ +F+N  N R+++LG+  +   L    + +   T+ 
Sbjct: 485  GINSE--HNQEWWIDQAIKFQSFMKKFMNSSNARVILLGSLERIPELFKKEIQNTLTTEP 542

Query: 534  YYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQT 593
            +YEF Y+IS I++ + +     +  + F +P  + F+P+  +  G+++Q    SS +SQ 
Sbjct: 543  FYEFEYKISTINLKASQS----VNTYEFCIPHKNKFIPSACKGDGVLEQLFLESSLKSQY 598

Query: 594  SLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYT 653
            S L +   +   +  P+L G+N  +E+W  +ED +     KSI+S EV S  ++  P  T
Sbjct: 599  SNLHLQINSMSFENKPQLVGRNQRYEMWTLKEDLNSIMDLKSIVSFEVLSTDMKGSPENT 658

Query: 654  MCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIID 713
            + LE+L Q++   +S  LYP+ KLGY YEIS S+KG  +L FTI GF EG+  ++ +II 
Sbjct: 659  IHLEILNQIIFTLISPQLYPAIKLGYFYEISASSKGDVQLRFTIGGFSEGILMLIEIIIK 718

Query: 714  QTKSLINS-DTVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLD 772
                +  + D  +  + R+ARV VR+ YE                IVLEE MW +EDR+D
Sbjct: 719  TIIFITTTPDFPSKELLRRARVLVRSNYENAAADNCVKLASLGLLIVLEENMWSLEDRID 778

Query: 773  ALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLS-RRTWHEPA 831
            ALE++ + SF+ FC  F++   YL +F QG+LSY ++I+ FL+   T HL   +    P 
Sbjct: 779  ALEDVTMASFKEFCQSFLNGSKYLTLFIQGNLSYADKINQFLNLNFTKHLDINKDTSLPL 838

Query: 832  VREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLV 891
                 TH LKPGTN+F      ++DP++SIVYFIQTG R D  + +LT  TE++MS+TLV
Sbjct: 839  NAHTSTHILKPGTNIFAEYPGPLDDPNNSIVYFIQTGLRSDTDLCTLTSFTEYIMSLTLV 898

Query: 892  PDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSE 951
            P+LR KKQIGY V  GLR+L+ T+G++IT MS S P  LES+ID+Y+A++E+ VL+ ++E
Sbjct: 899  PELRNKKQIGYLVMGGLRVLTDTIGVYITVMSGSEPIDLESKIDEYIAFIENGVLNRLTE 958

Query: 952  EEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPE-QGAAMRQHKRIR 1010
              F+  Y + +  +    N       +GPA+LL +I  NV  G+  +    +M+ H+R R
Sbjct: 959  ATFEREYKQAYLTLLGDNNQNKGGKLSGPANLLNEIVPNVQVGSSDQLNSTSMKLHRRFR 1018

Query: 1011 NQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADE 1070
            NQIS  +YNFT +    D+ L+  LTL  +  FF++KISI S TRSKLS+M+ S ++A +
Sbjct: 1019 NQISDKQYNFTDEELHIDIPLIEKLTLSSYLNFFKDKISIFSPTRSKLSIMITSSMAAKD 1078

Query: 1071 IAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNV 1130
            I  ++ +LQ+E++LK+KG  I   +L+ IV+S+ G  S L++ LF +F +R E  +LC V
Sbjct: 1079 IINRKTYLQLEAFLKIKGFTIKKEKLQEIVDSADGNSSLLIKNLFNYFRSRNEGWKLCTV 1138

Query: 1131 ILKELSKAVVLSLK 1144
            +LKE+ K  + SLK
Sbjct: 1139 VLKEVVKMSITSLK 1152

>TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3.455
            YPR122W
          Length = 1170

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/1149 (38%), Positives = 674/1149 (58%), Gaps = 28/1149 (2%)

Query: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLG 67
            V+H +V F+TP+S SN+  +LC+L NGIL+LLI                      D+V G
Sbjct: 6    VKHINVPFFTPLSYSNRTHKLCQLPNGILLLLISDPTESVSACSLTVAAGSYNDSDDVPG 65

Query: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127
            +AHLCEH +L+ GSKK+P    YH+++ +N GS+NA+TTGE TTFYFELP  N + E  F
Sbjct: 66   VAHLCEHMLLAGGSKKYPSPGCYHDMITKNNGSYNAFTTGEQTTFYFELPDFNQAPEAGF 125

Query: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187
            +K +D  AS F  P+F  + INKEIYAI++EH+ N ++  K LYHATRLL +  HPFSRF
Sbjct: 126  EKAIDIFASFFSEPLFDHTLINKEIYAIQNEHDSNVSNVTKILYHATRLLGDKSHPFSRF 185

Query: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247
             TGN ++L +   L    ++  L  +F+ NY  +RM +CLRGP S+N LAKLA   FG+L
Sbjct: 186  ATGNMSSLKNTLRLKGPTLRNLLSNHFRENYAPSRMTICLRGPSSVNGLAKLAISKFGEL 245

Query: 248  PASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVPDT--SNLVAIQS 305
               +  +  +  L   P+ G     L  R          T+  +   P     N + + S
Sbjct: 246  RPHKANEKVQAALT--PNDGF--NILQTR-------WGHTKAANNCFPSCLERNTICVDS 294

Query: 306  SKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVVASV 365
             K P++R +FPV  K TR T  D +     W + FGDE  GS  H L     I    A +
Sbjct: 295  GKLPIMRFLFPVWQKFTRFTKKDFLIFERFWFELFGDESAGSFCHFLVEKGWITNCYAYI 354

Query: 366  AHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSELNCTDLL 425
            + FS  N GL LE +LTN GW + +LI   L    +P+   + T  +A+ LSE    DL+
Sbjct: 355  SRFSTDNTGLILELSLTNSGWHNIELIAQTLIFYLVPKFSREHTVQLARFLSEQFSIDLI 414

Query: 426  TFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDYSESTESR 485
             FLY  AE S M  C+ L   L      LD  C+  GSP++   Q  S  G +SE+ ES+
Sbjct: 415  RFLYSNAENSPMTECSNLCEVLQEDINGLDNSCIFMGSPMVLNEQ--STQGLFSENEESQ 472

Query: 486  TWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTS--VSKTDAYYEFTYQISK 543
             WWIG+AIKFQ+F+ EF+N  N+R+++LG      L ++ T   ++ TD +Y+F Y   K
Sbjct: 473  KWWIGQAIKFQSFLKEFMNHSNMRLILLGCLEDCSLSTTATQGKIAGTDPFYDFAYFTCK 532

Query: 544  IDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTVVARNA 603
            + +      +  +  + F +P  + F P+       + + L  SS +SQ + L    ++ 
Sbjct: 533  LSLRKPHANI--LNDYKFSIPPKNEFKPSWAENFPSLMRKLYYSSTKSQQASLGFAIKSD 590

Query: 604  YLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLL 663
                 P+L  +N N+++WV  +    S +SK+I+S E++   I+  P  TM LE+LAQ++
Sbjct: 591  EGTRTPQLVSQNENYDMWVLSDCPASSHQSKAIVSFEISCWEIQPSPENTMNLEILAQVI 650

Query: 664  GDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDT 723
              +L++ LYPS KLG+T+EI PS++G  RL   ISG+ + +  ++  +    + L  S+ 
Sbjct: 651  NLTLASDLYPSLKLGFTFEIYPSSRGDVRLGLVISGYSKRLGKVIESLSSIIRRL-KSEK 709

Query: 724  VTPA--MFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIES 781
              P+  +FRKAR++VR+ Y++               +V+E+ MW ++DR+DA+E ID+++
Sbjct: 710  SFPSRELFRKARISVRSNYDKAEDNSSINVASIGLLVVMEKYMWSLQDRIDAIECIDLQT 769

Query: 782  FRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREP---VTH 838
            F+ F + F     +L +F QGDLS+ ++I+  LD  LT+HL          REP    T 
Sbjct: 770  FKAFAASFADYRKFLRLFIQGDLSHADDINACLDRNLTNHLHGT--QTDFQREPEYCSTK 827

Query: 839  ALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKK 898
             L P TN ++      +DP++S VY+IQTG RDD    +LT L+ ++MS TL P+LR K+
Sbjct: 828  LLDPATNFYVEYPGRKDDPTNSTVYYIQTGPRDDCTAYTLTALSAYMMSFTLKPELRNKR 887

Query: 899  QIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERY 958
            QIGY V  GLRLL   +GLHI+ MS+  P  LE +I++YL Y+E +VL+ M+E+ F+ +Y
Sbjct: 888  QIGYVVMGGLRLLRNAVGLHISIMSTLEPLALEEKINEYLLYLEREVLTPMTEDTFRNKY 947

Query: 959  IRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAA-MRQHKRIRNQISIHR 1017
            ++ F  +  + N+      +GPADL+ QI ANV SG+     ++ M++HKR+RNQI+  R
Sbjct: 948  LKDFLNLQSKGNLDKLRKDSGPADLMDQIVANVQSGDSDILNSSFMKKHKRLRNQIADGR 1007

Query: 1018 YNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIAEKRLF 1077
            Y F       +  LL+ LT+  +  FF+E+ISI S TR+KLSVMV SP++ +EI  ++++
Sbjct: 1008 YTFADRDSAINTTLLQELTIDHYLCFFRERISIHSKTRAKLSVMVKSPMTDEEIVNRQIY 1067

Query: 1078 LQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNVILKELSK 1137
             Q++++LKL GL I +++LR +V+ S+GKP  L + L++ F +R ET +LC V+L+EL K
Sbjct: 1068 SQVDAFLKLHGLTIETAKLRELVQRSKGKPMLLAKELYQSFHSRHETWKLCTVMLRELLK 1127

Query: 1138 AVVLSLKPR 1146
             + ++LK R
Sbjct: 1128 MLTVNLKFR 1136

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1202 (39%), Positives = 689/1202 (57%), Gaps = 51/1202 (4%)

Query: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLG 67
            V+H DV   TP+S SN+  +LC L NGI  LLI                     P  + G
Sbjct: 6    VRHHDVQLCTPLSYSNRTHKLCTLPNGIPTLLISDPADTSSACSLTVATGSHNDPPNIPG 65

Query: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127
            LAHL EH IL+AGSK++P    YHE++++N GS NA+TTGE TTFYFELP ++  GEL F
Sbjct: 66   LAHLAEHMILAAGSKQYPDPGLYHELISKNNGSQNAFTTGEQTTFYFELPDTHKQGELEF 125

Query: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187
            DKVLD  AS FKNP+F+ S INKEIYAIE+EH  N +   K LYH+TRLLAN  HPFS+F
Sbjct: 126  DKVLDVFASFFKNPLFNSSIINKEIYAIENEHTNNMSRQTKILYHSTRLLANKFHPFSQF 185

Query: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247
             TGN  +L +   L  +++K+ L  YF  ++ A +M LCLRGP S+N L KLA   F D+
Sbjct: 186  TTGNIFSLDNNSQLRSISIKSLLVNYFAEHFKANKMTLCLRGPHSVNVLTKLAIAKFSDI 245

Query: 248  PASRD------------RDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVP 295
             +  D            RD  +P   ++  S + S ++    L+   SK+   +   FV 
Sbjct: 246  KSQNDLQRNKFGSISSKRDSRQP---RQGYSKIESSNI----LENIWSKRYANLP-CFVN 297

Query: 296  DTS--NLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLK 353
            ++   N + I+S K P++R +FP+S +ST  T  +I+  S  WC  FGDE  GSL H L 
Sbjct: 298  ESKKVNSIFIKSKKKPLVRFLFPLSSQSTIFTQREIILFSNFWCTLFGDESEGSLMHFLV 357

Query: 354  TNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIA 413
                     + V+ F+ G+ GL +E  LTN G      II VLF+  +  L    T  +A
Sbjct: 358  EKGWSTSGHSYVSTFAVGSIGLVIELALTNSGVGQITDIINVLFEKIVKILTTKHTTLMA 417

Query: 414  KCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPS 473
              L+E N  + + FLY+G EK  ME C+ LS  L    + LD K L KGSP I   Q  S
Sbjct: 418  DFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKYLFKGSPSI--TQLYS 475

Query: 474  AIGDYSES-TESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSK-- 530
                YSES T+ +  W   AIKFQNF+  F+N +NLR++ LG+  K   L  +T   K  
Sbjct: 476  GKNQYSESMTDGKIQWTAYAIKFQNFLLTFMNYENLRLLFLGSNAKETRL--ITKEKKRI 533

Query: 531  ---TDAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQAS 587
               TD +YEF +  +  D      ++     + F +P  ++F+P   R    ++QA Q S
Sbjct: 534  EFETDFFYEFDFYRTFTDFRKCSSDI-ETENYIFTLPSSNLFIPKSCRSYTYLQQAFQES 592

Query: 588  SNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVK--EEDSDLSFKSKSIISIEVASKT 645
            S +S+ + L    +   +   P L   + N+E+W      +S  S +SK+I++ E+ S  
Sbjct: 593  SLKSKLASLRPQVQIEKIHFAPTLVSDSPNYEMWTLPCAINSSPSLRSKTIVTFELISTN 652

Query: 646  IEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVC 705
            +      T+ LE+LAQLL   +S+ LYPS KLGY+Y+I+ S+KG  RL FTISGF EG+ 
Sbjct: 653  MIPSAESTIHLEILAQLLFYLVSSKLYPSLKLGYSYDIASSSKGDVRLKFTISGFSEGLL 712

Query: 706  AMVRVIIDQTKSLINSDT----VTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLE 761
             ++  II Q+   I  D     VT  + RKARV VR KY+E               I+LE
Sbjct: 713  LVLEEII-QSVLHIAKDKENIYVTNELLRKARVLVRRKYDEACCENCAKLGSVGLLILLE 771

Query: 762  ECMWPVEDRLDALEEIDIESFRTFCSGFISKP-TYLNVFSQGDLSYTEEISTFLDSGLTS 820
              +W +EDR+DALE+ D+ SF+ F + F+ +   Y  +F QG+L    EI  +L+  LT 
Sbjct: 772  SFLWTLEDRIDALEDTDMTSFKNFVNEFLFESFNYFTLFIQGNLDRAHEIHHYLNDNLTH 831

Query: 821  HLSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTC 880
            HL      +  + +P T  L+ G+N F+      EDP+++IVYFIQ+G R D+   +LT 
Sbjct: 832  HLDILP-EKVILNKPRTKILQEGSNFFVAYDGHEEDPNNAIVYFIQSGLRSDSIAYTLTA 890

Query: 881  LTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAY 940
             TE+LMSMTL+PDLR KKQIGY V  G+R+L  ++GLHIT +S +PP+ LE +ID+Y+ +
Sbjct: 891  FTEYLMSMTLLPDLRHKKQIGYIVVGGMRVLVDSIGLHITVVSGTPPQDLEDKIDEYMNF 950

Query: 941  MEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLP-EQ 999
            +E  +L  ++EEEF+ +Y++ +  M   +N  + +  AG  +LL  I +NV +G      
Sbjct: 951  LERIILGRLTEEEFRNQYVQNYLDMLNGKNNGTLNGTAGAHNLLNDIVSNVANGEYEILN 1010

Query: 1000 GAAMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLS 1059
             + MR+HKR+ NQIS   ++F  D+E  +  ++  LTL  + +FF++KISI S  RSKLS
Sbjct: 1011 SSEMREHKRLWNQISDDDHSFLDDIELINREVIETLTLKGYMQFFKKKISIHSNKRSKLS 1070

Query: 1060 VMVASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFL 1119
            VMV SP+  +EI  ++LFLQ+E++LK+KG  I S++L+ IV+ + GKPS +++ L   F 
Sbjct: 1071 VMVTSPMPENEIINRKLFLQLEAFLKIKGFAIKSNQLKEIVDKADGKPSVVLKLLLSEFR 1130

Query: 1120 ARGETLRLCNVILKELSKAVVLSLK-------PRPT-NNNSAGVLQNVRKEVSTAVPLIE 1171
             R E  +L   +LKE+ K    +LK       P PT ++NSA + ++    V   +PL  
Sbjct: 1131 ERNEAWKLLRAVLKEVLKTTGQTLKHRYGKVLPSPTKSDNSASLEKSSNYSVKPVIPLKR 1190

Query: 1172 VQ 1173
            ++
Sbjct: 1191 IE 1192

>TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1202

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1167 (37%), Positives = 660/1167 (56%), Gaps = 45/1167 (3%)

Query: 11   FDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLGLAH 70
            FD+ FY P S SN+  +LCRL NGIL LLI                     P ++ G+AH
Sbjct: 9    FDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAH 68

Query: 71   LCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLFDKV 130
            LCEH IL+AGSKK+P+   +HE++A N GS NA+TTGE TTFYFELP S    +  F ++
Sbjct: 69   LCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFGEI 128

Query: 131  LDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTG 190
            LD  +S FK P+F++   NKEIYAIESEH+ N ++T K LYHA RLL+N  HPF  F TG
Sbjct: 129  LDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTG 188

Query: 191  NFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLPAS 250
            N  TL    NL K N+K  L +YFK NY +  M +C++GPQSLN+L KLA   FGD+   
Sbjct: 189  NIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDI--- 245

Query: 251  RDRDP-TRPPLKK-RPSSGV----------------ASQDLHVRPLDFKNSKQQTQVQDA 292
            +D+D  T+  +   +P   +                 +++L +      ++    +  D 
Sbjct: 246  KDKDELTKFHINSIKPQKSLRISKSRSSISSCNSFKTNENLDLENFKLLDNAWLDKYGDN 305

Query: 293  FVPDTS---NLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLT 349
                TS   N + + SSK P+LRL+FP+S K TR T  DI   S  WC  FGDE  GS  
Sbjct: 306  VCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDETKGSFC 365

Query: 350  HCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKT 409
              L  NN I    A  + F+ GN  L LE  LTN G    Q II +L    +  L+ + T
Sbjct: 366  DYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLLVDNFT 425

Query: 410  KDIAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECN 469
            +++A  L+E N   +L F+    E + M+ C+ LS  L   F+  +PK L  GS  +   
Sbjct: 426  ENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSEFLLLE 485

Query: 470  QNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPK-SDLLSSVTSV 528
                   +      S T+WIG+AIKFQ F+ EF+N +N++IV +G+  +  ++L+ V  +
Sbjct: 486  NESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNVLNIVKEM 545

Query: 529  SK-TDAYYEFTYQ---ISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVG--RKLGLIKQ 582
            SK TD YYEF YQ   ISK   +  R+       + F  P  + +LP  G    L     
Sbjct: 546  SKKTDLYYEFEYQKLKISKKSRICPRD-------YPFTYPIKNEYLPKFGYNLGLLRNIL 598

Query: 583  ALQASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDS-DLSFKSKSIISIEV 641
                 S+R+ +  +  V+     +   +L  +N  H+LWV  ++S D   +S  I+S ++
Sbjct: 599  LNNLESSRTVSFYMPQVSEE---EDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSFKL 655

Query: 642  ASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFP 701
             + +I+  P  TM LE++ QLL   L   LYP+  +GYT+EISPS +G   LSFT+SGF 
Sbjct: 656  VNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGFS 715

Query: 702  EGVCAMVRVIIDQTKSLINSDTVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLE 761
            EG+  +++  I+    L +SD +T   FR+AR+ VR+KYE+               I+LE
Sbjct: 716  EGIFKIIKECINIFGELTSSDLITKKEFRRARILVRDKYEDAASDSCVKLASVGLLILLE 775

Query: 762  ECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSH 821
              MW +E+R+DALE ID+E F  F   F  +  +L+++ +G+L Y + I+++    L  H
Sbjct: 776  RKMWTLEERIDALELIDLEMFLEFAQKFF-QNLFLSLYIEGNLEYADLINSYFSDKLVHH 834

Query: 822  LSRRTWH--EPAVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLT 879
            L++R  +  E  ++   +  L  GTN++      V+DP++SIVYFIQTGD  + ++LSLT
Sbjct: 835  LTKRLDYPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILSLT 894

Query: 880  CLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLA 939
             LT F++S +LVP+LR KKQIGY VF GLR LS T+GLHIT MS   P  +E +I++Y++
Sbjct: 895  SLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYIS 954

Query: 940  YMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQ 999
            Y+E D+L  + +E FQ  Y+ K+  +       ST   +GP +++ +I ANVH G+    
Sbjct: 955  YLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGGDSAIL 1014

Query: 1000 GAAMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLS 1059
             +   ++ +            T +L+  D+  L+ L L ++ +FF+  IS  S  RSKLS
Sbjct: 1015 NSEKIKNHKKNKNELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNSKRRSKLS 1074

Query: 1060 VMVASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFL 1119
            + + SP+   E+  ++LFLQ++++LK+KG  I S+EL+ IVE + G+P+ L + LF  F 
Sbjct: 1075 IHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFKELFACFK 1134

Query: 1120 ARGETLRLCNVILKELSKAVVLSLKPR 1146
            AR E+ +  +++LKE+ K + +S+K +
Sbjct: 1135 ARDESWKFISIVLKEILKVISMSIKQQ 1161

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1197

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1171 (36%), Positives = 660/1171 (56%), Gaps = 35/1171 (2%)

Query: 7    AVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVL 66
            AVQ++D+ F  P++ S++  +LC+L NG+L LLI                     P  V 
Sbjct: 5    AVQNYDIQFRIPLAFSHRTHKLCKLPNGVLALLISDPEDNASVCSVTVATGSHNDPKGVP 64

Query: 67   GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELL 126
            GLAHLCEH + +AGSKK+P    YH+ +++ GG+HNAYTTGE TTF+  +P  N  GEL 
Sbjct: 65   GLAHLCEHMLFAAGSKKYPDVDKYHQTLSKTGGTHNAYTTGEQTTFHISVPNMNREGELE 124

Query: 127  FDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSR 186
            FD +LD  +S  K P+F+ +++NKEIYAI+SEH+ N +S  K LY A RL+AN  HPFS+
Sbjct: 125  FDCILDMFSSFLKEPLFNSTAMNKEIYAIQSEHDSNVSSLSKILYQAIRLMANGNHPFSQ 184

Query: 187  FCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGD 246
            F TGN  TL + P +  +N++  L  YF+TN+    + +C++G QS+N L KLA   FG 
Sbjct: 185  FSTGNIHTLKNMPLVTGMNLRTLLVNYFETNFQPRNITVCIKGSQSVNILTKLALTNFGY 244

Query: 247  LPASR--DRDPTRPPLKKRPSSGVASQDL-HVRPLDFKNSKQQTQVQD-AFVPDTSNLVA 302
            + +SR    +  R  + KR S     + L  +          + + +D     D +N + 
Sbjct: 245  IQSSRAAKGNVIRRSISKRDSIRSNGKKLKKIESFRILEKAWKAKYKDIKCFDDRNNFMI 304

Query: 303  IQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVV 362
            I+S+K   +R +FPV+      T  ++   S  W + FGDE  GSL       + I    
Sbjct: 305  IKSNKQSTMRFLFPVNESGANFTPKELKIFSGIWRELFGDESKGSLHSYFIEKSWITETT 364

Query: 363  ASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSELNCT 422
              ++ F+ G  GL L+F+LT  GW + + II+ +F   +  +  +    +++ L E    
Sbjct: 365  TYISDFTYGVYGLILQFSLTASGWENLREIISKVFKGTLELVRWENLNSLSRILFEHTTI 424

Query: 423  DLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSP-LIECNQNPSAIGDYSES 481
            + + +LYQ  E  S + C+ L+  L     T + + L K SP LIE N       D+SE+
Sbjct: 425  EYINYLYQEQEVLSSDFCSELTELLQHSLRTPELEYLFKESPNLIELN------NDHSEN 478

Query: 482  TESRT-WWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSK---TDAYYEF 537
              + T WW  +A+KFQNF++EF+   N+++ +LG+  K +    + S +K   TDAYY F
Sbjct: 479  LMTVTPWWFDQAMKFQNFINEFMKVTNVKLFLLGSELKHNAFFELGSQNKDWSTDAYYGF 538

Query: 538  TYQISKIDMLSVREE-LYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLL 596
             Y  S ++   + +E    +  +S  +P  ++F+P   + L  ++Q     S RS+ ++L
Sbjct: 539  DYIKSHLNFKQIIDEPCTTVNDYSLALPSKNLFIPQFFQNLANLQQIFMEYSLRSRFAVL 598

Query: 597  TVVARNAYL-QTIPRLAGKNSNHELWV----KEEDSDLS---FKSKSIISIEVASKTIEA 648
                  + L    PRL  ++S++E+W+    KE +S  S      +S ++  + S T+  
Sbjct: 599  QPQVPTSMLPNQKPRLVNRSSHYEMWILPIDKEPESVASPDRIPKQSTVTFSIESLTMTP 658

Query: 649  CPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMV 708
                TM LE+L ++L   L++ LYPS +L Y YEI+ S KG  +L  TI GF +GV  + 
Sbjct: 659  SSMNTMHLEILGEVLNFLLTSDLYPSLQLSYAYEIATSLKGDVQLCCTICGFSDGVVKIT 718

Query: 709  RVIIDQTKSL---INSDTVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMW 765
              I+   + +     ++ VT ++ RKAR+ VR+KYE                IVLE  MW
Sbjct: 719  DYILSTLRLIGDPATANIVTNSLLRKARIQVRSKYEAASSEICVKLASMGLLIVLERGMW 778

Query: 766  PVEDRLDALEEIDIESFRTFCSGFISKPT--YLNVFSQGDLSYTEEISTFLDSGLTSHLS 823
             +EDRL+ALE+ D+ SF+ FC  F+   +  YLN+F QGD+ Y +E++  + S LT HL+
Sbjct: 779  TLEDRLEALEDSDMSSFQQFCHEFVMNDSGNYLNLFVQGDMRYADEVNCLIHSKLTHHLN 838

Query: 824  RRTWHEPAV-REPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLT 882
                  P       T  LKPG N ++      +DP++SIV+F+Q G R+D    +L   T
Sbjct: 839  SSRCSTPTTDYRRSTTVLKPGVNYYVEYPGQGDDPNNSIVHFVQVGLRNDRAAFTLAHFT 898

Query: 883  EFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYME 942
             +LM +TLVPDLR KKQIGY V  GLR+++ T+GLHIT MS+     LE +ID+Y+ Y+E
Sbjct: 899  AYLMHLTLVPDLRYKKQIGYVVLGGLRIMTDTVGLHITVMSAGQCLDLEDKIDEYMMYLE 958

Query: 943  HDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPE-QGA 1001
              VL+A++E +F+E Y++ +  +     V     + GP +LL++I  NV +G+    +G 
Sbjct: 959  DTVLNALTESQFEEIYLKPYIRLIGEHTVGEMDTSGGPTNLLSEIYPNVQNGHSSVLEGI 1018

Query: 1002 AMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVM 1061
             M++HK++ N I    Y+F    +  D  +++ LTL ++  FF+EK+S  STTRSK+S+M
Sbjct: 1019 DMKRHKQLWNLIQAKEYDFLQGNDILDRTVVQGLTLHRYMTFFKEKLSARSTTRSKISIM 1078

Query: 1062 VASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLAR 1121
            + SP+  +EI  +++FLQ+E++LK+KG  I  +ELR IV  SQG P+ L+R L   F  R
Sbjct: 1079 IDSPMKREEIMNRQMFLQMETFLKMKGFAIKDTELRDIVNKSQGSPTQLLRHLLAHFKTR 1138

Query: 1122 GETLRLCNVILKELSKAVVL----SLKPRPT 1148
            GE  +LC VI KE+ K + L    SL  RPT
Sbjct: 1139 GENWKLCRVIAKEVGKLLALGVRRSLTLRPT 1169

>TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1159 (36%), Positives = 652/1159 (56%), Gaps = 56/1159 (4%)

Query: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLG 67
            V+++D+  Y P SS     +LCRL NGIL ++I                     P  + G
Sbjct: 6    VKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPG 65

Query: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127
            LAHLCEH ILSAGSKK+P  + YH++++++ GSHNAYTTGE TTFYFE+P    S E  F
Sbjct: 66   LAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNF 125

Query: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187
            +++LD  +SSFK+P+F ++S+NKEIYAIESEH+ N  +  K LYHATRLLAN +HPFSRF
Sbjct: 126  ERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRF 185

Query: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247
             TGN  TL     L K   K  L  YFKTNY+A+ M LC++GPQS+N L K A  YF  +
Sbjct: 186  STGNITTLGKGAKLLKTTSKKLLESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGI 245

Query: 248  PASRDRDPT-----RPP--LKKRPSSGVASQDLHVRPLDFKNSKQQTQVQD------AFV 294
              S   D T     + P  + +R S    SQ+  +     K +++  +++D      A+ 
Sbjct: 246  DDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMS----KGNEEDCRLEDFHILSNAYN 301

Query: 295  PD-----------TSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDE 343
            P              N + I+S+K P+LRL+FP+         +D++     WC+ FGDE
Sbjct: 302  PKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGDE 361

Query: 344  GVGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPR 403
               SL + LK +NLI    A  ++F+  + GL +E +LT  G  + +LII  + +  I +
Sbjct: 362  NDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIEK 421

Query: 404  LIHDKTKDIAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGS 463
            L      ++A+ LSE N  D++ F+ +G E +SM+  + +SSRL        P  LLK  
Sbjct: 422  LSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKEF 481

Query: 464  PLIECNQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNC--PKSDL 521
            P I  + + + I ++ E+  S+ WW+ +A  FQ F+  +VNR+NLRI+ LG+   PK   
Sbjct: 482  PFIN-DYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFTT 540

Query: 522  LSSVTSVSKTDAYYEFTYQISKI----DMLSVREELYRIPGFSFRVPCYDMFLPTVGRKL 577
            L+    V  TD +Y+F Y   K     + L   ++++R  G    +P  + F+P +G+ L
Sbjct: 541  LTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIG----IPKRNTFMPEIGKSL 596

Query: 578  GLIKQALQASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSII 637
             ++   L+A   R+++    ++  N+ +++ P L  KNSN E WV       S    SI 
Sbjct: 597  AILSANLEAILKRNESIGYPIIYNNS-IESKPGLVLKNSNQETWVLNSPLQHSSTESSIF 655

Query: 638  SIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTI 697
            S E+ + +I+  P+ TM LEVL QLLG  ++  LYP+ +LGYTYEI  S  G  +L  TI
Sbjct: 656  SFEITNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITI 715

Query: 698  SGFPEGVCAMVRVIIDQTKSL-INSDTVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXX 756
            SGF  G+ ++++ II    S+ I + TVT +   +ARV  R KYE+              
Sbjct: 716  SGFQSGIMSLLQNIIKICNSISIKNPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGL 775

Query: 757  XIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDS 816
             I+LE+ MW +EDR DALEE DI SF  FCS F     Y+  F  G    T E++  L  
Sbjct: 776  LIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISG----TNELAMKLSH 831

Query: 817  GLTSH------LSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDR 870
             +  H      +S   + +  +    T  LKPG N++ +      D ++ I YFIQTG+R
Sbjct: 832  LIYDHWILSDTISLNYFEKNNILS--TCFLKPGENVYFQHPGDEGDINNCINYFIQTGER 889

Query: 871  DDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHL 930
            ++  + +LT LT+++M   LV +LR +KQ+GY VF G+R L+ T+GLHIT MS + PE L
Sbjct: 890  NNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDL 949

Query: 931  ESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEAN 990
            E  ID+Y+  +E+D + +++E  F+  ++  F    +++     ++     +L+  + AN
Sbjct: 950  ERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDTNNPFNNVTN-VNLVDDVVAN 1008

Query: 991  VHSGN-LPEQGAAMRQHKRIRNQISIHRYNFTSDL-EPADLGLLRALTLGQFRRFFQEKI 1048
            V +G+ +  +   M+ H  ++ +I  +R        E  DL +++ LTL ++  FF+  I
Sbjct: 1009 VQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATI 1068

Query: 1049 SICSTTRSKLSVMVASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPS 1108
            SI S  RSK+S+ + S ++ +EIA ++LFLQ+ ++LK+KGL I   EL+ IVE S+GKPS
Sbjct: 1069 SINSKNRSKISIHIISLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPS 1128

Query: 1109 TLMRGLFKFFLARGETLRL 1127
             L++ + K+F  + E  +L
Sbjct: 1129 KLLKEIVKYFKKKDEAKKL 1147

>CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122w AXL1
            protease
          Length = 1181

 Score =  452 bits (1162), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 331/1189 (27%), Positives = 564/1189 (47%), Gaps = 95/1189 (7%)

Query: 4    MSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPD 63
            M   V+ F V FY P+   N+  +L +L NGI V++I                     P 
Sbjct: 1    MITDVKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENYNSCSLTVAAGSHNDPA 60

Query: 64   EVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELP-ASNDS 122
             V GLAHLCEH IL+AGS   P    +H ++A+  G  NAYTTGE T+FYF++P  +N  
Sbjct: 61   TVPGLAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYTTGEQTSFYFQVPQVANSE 120

Query: 123  GELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRH 182
            G L F+++L   +S+FK P+F+ S +NKEIYAI+SEH  NK +  K LY ATRLLAN  H
Sbjct: 121  GTLAFEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENNKTNPGKVLYQATRLLANKNH 180

Query: 183  PFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKK 242
            PFSRFCTG+  TL   P+   +N++  L  YF  N+    + LC+RGPQSLN L KL  +
Sbjct: 181  PFSRFCTGDMNTLKTFPSTENINIRKELISYFNDNFYGENITLCVRGPQSLNHLVKLCMQ 240

Query: 243  YFGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVPDTS---- 298
             F D+           PL   P++   ++D      + +  K+   + D + P  +    
Sbjct: 241  NFNDI----------KPLPVLPTAIGNNRDSDTELFE-ETLKRLNILYDVWAPRYTSLPC 289

Query: 299  -------NLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHC 351
                   N++ + S      R+V P+    TR  +      +    +  G+E VGS  H 
Sbjct: 290  FHIGYKNNVILVNSDMEQSFRIVIPLITNDTREDAIFTEVFTNICVELLGNEEVGSFCHF 349

Query: 352  LKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKD 411
            LK  + +       + F+ G  G+ LEF   + G+S  + I+ VLF   IP  ++  + D
Sbjct: 350  LKEISWVRECYVYRSEFAVGAAGIVLEFKCFDTGFSQIENIVNVLFQTLIPMYLNMPSDD 409

Query: 412  IAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQN 471
            +A+ + E    + + F+Y     S ME  + LS +L         K LL  S        
Sbjct: 410  LARFIKEQTIIETIDFMYTWKHLSPMEESSDLSMQLQKDLHNRGIKYLLMKS-------- 461

Query: 472  PSAIGDYSE--STESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTS-- 527
            PS + +Y E   TE   +W     KF+ F+   +   N ++++  + P +  + ++    
Sbjct: 462  PSFLHNYEEMSKTEKLHYWPLIVEKFKVFLRRHMILPNAKVIIPTSEPFTKTVRNLFKNA 521

Query: 528  -----VSKTDAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQ 582
                  S+TD YYEF Y +  +     R     I  + F  P  + F+P   R L  + +
Sbjct: 522  QQMEVTSETDPYYEFNYSVYSVSFPESR----VIFPYQFSFPGPNEFIPPKYRNLDTLLE 577

Query: 583  ALQASSNRSQTSLLTVVAR--NAYLQTIPRLAGKNSNHELWV---------KEEDSDLSF 631
             L   S R+  S L  + R  N+  ++ P+L  +  + E+W          K  ++D+  
Sbjct: 578  MLFGISERANFSPLRPIVRLKNSRARSAPKLVHQTEDVEIWTANIVDGIFSKVVNADI-- 635

Query: 632  KSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHA 691
              KS ++I++ ++ I   P  ++ L ++ +++   L   LY   KLG+++ +  +  G  
Sbjct: 636  --KSYVTIKIVNQCIRPTPISSLHLGMMVEIMNMFLLPRLYSCTKLGFSFHLQAALDGSM 693

Query: 692  RLSFTISGFPEGVCAMVRVIIDQTKSLINSD--TVTPAMFRKARVAVRNKYEEXXXXXXX 749
                 ++G   G+  ++  + D  + ++      +T A  RKARVA+R++YE        
Sbjct: 694  SFDIVVTGIMAGIIKILEKVTDLIEIIVTKPGYILTNAFIRKARVAIRSRYEAATKGSSV 753

Query: 750  XXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQ-GDLSYTE 808
                    + LE  +W  E+R+DALEE DIE F  F + F     +  VF+Q    S  +
Sbjct: 754  KIGTTGLLVDLEPHVWSFEERVDALEESDIEVFFQFINTFFRTHKHTKVFAQSSSTSNID 813

Query: 809  EISTFLDSGLTS---HLSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFI 865
            +I+ ++   + +           E    +  T  LKPG    I+      DP++ +  ++
Sbjct: 814  KIARYVVQRIVTPGIPEGNDALVECVRDDGHTRMLKPGEERHIKLIGRDNDPNNCVFSYL 873

Query: 866  QTGDRDDAQM--LSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMS 923
            +    +   +    +   T++L  +TLVP+LR K+Q+GYAV  GL +L+  +G+++  +S
Sbjct: 874  EMAPLEGISLKQYRMIEFTDYLFQLTLVPELRNKRQVGYAVDGGLVILNNVVGVNVVVVS 933

Query: 924  SSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADL 983
            S+ PEH+E +I+ Y A++    LS   ++ +++      + + +R+ +    D     D+
Sbjct: 934  STSPEHIEQEIESYYAHVRQ-YLSDNVDQIWRDYS----KIINDRDPLMYLLD----HDV 984

Query: 984  LAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRYNFTSDLEPADLGL-------LRALT 1036
               IE    + ++PE     R H  + N   + +Y    +L   D  +           +
Sbjct: 985  WYNIER--ENSDIPEYS---RDH--VANCQRVFKYKDLIELLVVDTPISGRHPDYTPPFS 1037

Query: 1037 LGQFRRFFQEKISICSTTRSK-----LSVMVASPVSADEIAEKRLFLQIESYLKLKGLKI 1091
            + ++ +F    I      R       +SV V SP+   ++ ++++  Q+ES+LKLKGL I
Sbjct: 1038 MQEYLQFLDSSIGTYKHKRHHNGTRSVSVWVYSPMDKRDVFQRQVKYQLESFLKLKGLVI 1097

Query: 1092 PSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNVILKELSKAVV 1140
            P  +L  I+  + GK +T+ + L++ F  + E  +  N +  E  K+++
Sbjct: 1098 PERDLADIIREAGGKQTTMFKLLYRRFKRQNEAGKFVNSVATETFKSIL 1146

>TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.246
           YLR389C
          Length = 995

 Score =  180 bits (457), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 233/1012 (23%), Positives = 407/1012 (40%), Gaps = 167/1012 (16%)

Query: 4   MSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPD 63
           +S+  +  +  F  P    ++     +L N +  L+I                     P+
Sbjct: 29  LSNGYKQLESDFIKP-DLDDRSYRFIQLPNDLKALIIQDPTTDKSAAALDVNIGAFSDPE 87

Query: 64  EVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSG 123
           E+ GLAH CEH +L  GS+KFP  + Y   ++++GGS NAYT  +NT +YF++   +  G
Sbjct: 88  ELPGLAHFCEH-LLFMGSRKFPDENEYSSFLSKHGGSSNAYTGAQNTNYYFQVNHEHLKG 146

Query: 124 ELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHP 183
                  LD  +  F  P+FS  S +KEI A++SE+  N  +   +LY   + L+NP HP
Sbjct: 147 ------ALDRFSGFFTGPLFSKDSTDKEINAVDSENKKNLQNDIWRLYQLDKSLSNPSHP 200

Query: 184 FSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKY 243
           + +F TGN  TL + P    V+V+  L  ++   Y A  M LC+ G + L+ L+  A + 
Sbjct: 201 YHKFSTGNLKTLNEIPKSKGVDVRNELLNFYSKYYSANLMKLCVLGREDLDTLSDWAYEL 260

Query: 244 FGDLPASRDRDPTRPPLKKRPS---SGVASQDLHVRPLDFKNSKQQTQVQDAF-VPDTSN 299
           F D+P     +  RP  +   S        + +HV+P+     K  T+++  F VPD  +
Sbjct: 261 FSDVP-----NLPRPAPEFEASILDGAYLKKFIHVKPV-----KDLTKLEVTFVVPDVED 310

Query: 300 LVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLIN 359
               +S  N +L      SH                     G EG GSL   LK+    N
Sbjct: 311 --HWESKPNHIL------SH-------------------LIGHEGSGSLLAHLKSLGWAN 343

Query: 360 GVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLF------IP-RLIHDKTKDI 412
            + A     S  N    ++  LT+ G    + +   +F         +P   I+ + +DI
Sbjct: 344 ELSAGGHTVSKSNAFFCIDIDLTDEGLKHHEDVTHTIFQYIEMLKNSLPEEWIYLELEDI 403

Query: 413 AKCLSEL----NCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIEC 468
           +K   +     N +  ++ L +  EK  + + ++L++ LLS +E                
Sbjct: 404 SKASFKFEQKKNSSGTVSSLAKALEKDYIPVKSILATSLLSKYE---------------- 447

Query: 469 NQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSV 528
              P  I  Y +S                     +N +N RIV++    K+D      SV
Sbjct: 448 ---PDLITKYVQS---------------------LNVENCRIVLICKTFKTD------SV 477

Query: 529 SKTDAYYEFTYQISKIDMLSVREELYRIPGFS--FRVPCYDMFLPTVGRKLGLIKQALQA 586
            K   +Y   Y  S +D  +   +  + PG +    +P  + F+ T              
Sbjct: 478 EK---WYGTEY--STVDFSADLLKRLQHPGLNSHLHLPRPNEFIAT-------------- 518

Query: 587 SSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTI 646
             N +   L  V          P L   +   +LW K++D    ++ +  I         
Sbjct: 519 --NFNVDKLENVEPLEE-----PLLLKDDKISKLWYKKDDR--FWQPRGYIYTTFKLPHT 569

Query: 647 EACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCA 706
            A    +M   +  QL+ D L  + Y +           + +G   L  TI+GF + +  
Sbjct: 570 HASIVNSMLSTLYVQLINDYLKDLQYDASCADLHLSFIKTNEG---LDITITGFNDKLII 626

Query: 707 MVRVIIDQTKSLINSDTVTPAMFR-KARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMW 765
           ++   ++  K+    D     +F+ K++  + N+  E                ++ E  W
Sbjct: 627 LLTRFLEGLKAF-KPDRKRFEIFKEKSKQHLNNQLYEIPYSQVSSLYNS----LVNERSW 681

Query: 766 PVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTE--EISTFLDSGLTSHLS 823
             E++L+ +E++  E    F    I +  +      G++ Y E  +I + +    ++ +S
Sbjct: 682 TAEEKLEVVEQLTFEQLEAFIPT-IFEEMFFETLVHGNIKYEEADQIDSLIQMLRSNSVS 740

Query: 824 RRTWHEPAVREPVTHALKPG-TNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLT 882
                   +R   ++ L  G T+ +  + A  ++ +S I Y IQ G  D+A    L+ + 
Sbjct: 741 NSQIKNARIR---SYVLPLGKTHRYEAKLADTQNVNSCIQYVIQLGVYDEA----LSAIG 793

Query: 883 EFLMSMTLVP---DLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLA 939
                M   P    LRTK+Q+GY VFS       T  + I   S     +LE +I+ +L 
Sbjct: 794 RLFAQMLHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRIESFLE 853

Query: 940 YMEHDVLSAMSEEEFQER-------YIRKFRAMFERENVTSTSDAAGPADLL 984
                 L  MS+ +F+          ++K++ M E  +  + S   G  + L
Sbjct: 854 QFG-KTLKEMSDRDFENHKDALCKTLLQKYKNMKEESSRYTASIYLGDYNFL 904

>Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389C
           (STE23) - involved in a-factor processing [contig 1]
           FULL
          Length = 1001

 Score =  169 bits (428), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 226/973 (23%), Positives = 388/973 (39%), Gaps = 129/973 (13%)

Query: 4   MSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPD 63
           M+  V H ++ F  P+   ++      L N + VLLI                     P+
Sbjct: 38  MASYVNH-NIEFKKPLLD-DREYRFIELPNKLKVLLIQDVNTDKAAAALDVNVGSFEDPE 95

Query: 64  EVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSG 123
            + GLAH CEH +L  GS K+P  + Y   ++++GG  NAYT+ +NT ++F++   N  G
Sbjct: 96  NLPGLAHFCEH-LLFMGSSKYPNENEYSSYLSKHGGGSNAYTSSQNTNYFFQVNQGNLHG 154

Query: 124 ELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHP 183
                  LD  +  F  P+F+  S +KEI A++SE+  N  S   +LY   +  ++P HP
Sbjct: 155 ------ALDRFSGFFSCPLFNKDSTDKEINAVDSENKKNLQSDLWRLYQLDKSQSSPEHP 208

Query: 184 FSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKY 243
           + +F TGN  TL + P    ++V+  L +++  +Y A  M LC+ G + L+ L++     
Sbjct: 209 YHKFSTGNLKTLGELPKSQNLDVRDELLKFYNRSYSANLMKLCVLGREDLDVLSQWVYDL 268

Query: 244 FGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFV-PDTSNLVA 302
           F D+P   +RD    P+   P+  +  Q+L  + +  K  K   +V+  FV PD   +  
Sbjct: 269 FKDVP---NRD---VPVPSYPTRLLLPQNLE-QIISAKPVKDIKRVEVNFVAPD---MDP 318

Query: 303 IQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVV 362
              SK           H  + L                G EG GSL   LK+    N + 
Sbjct: 319 YWDSK---------PGHYLSHL---------------IGHEGSGSLLAYLKSKGWANELS 354

Query: 363 ASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSELNCT 422
           A     S  N   ++   LT+ G ++ + ++  +F  +I  L  +  ++      EL  T
Sbjct: 355 AGSHTVSKDNGFFSISIDLTDEGIANYEDVVISVFQ-YIEMLKKELPQEW--VFQELRDT 411

Query: 423 DLLTFLYQ--GAEKSSME-MCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDYS 479
              +F +Q  G   S++  +   L    + V + L    L K         +P  I +Y 
Sbjct: 412 AEASFKFQQKGHPASTVSALSKALEKEYIPVGDILSASLLRK--------YDPELISEY- 462

Query: 480 ESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAYYEFTY 539
                              V+E +  +N R+ ++     +D      SV K   +Y   Y
Sbjct: 463 -------------------VAE-LKPENSRVTLIHKNATTD------SVEK---WYGTEY 493

Query: 540 QISK-IDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTV 598
            I++  D L  R                 M  P    +L L +     SSN     L  V
Sbjct: 494 AITRYTDSLVER-----------------MKSPGRNAQLHLPRPNEFISSNFDVEKLENV 536

Query: 599 VARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEV 658
             R       P L  ++    LW K++D     K    +S+++         S  M   +
Sbjct: 537 EPRQE-----PLLLLQDGQSRLWYKKDDRFWVPKGHIYVSMKLVHTYSSIVNS--MLTSL 589

Query: 659 LAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSL 718
              L+ D L  + Y S+    T     + +G   L   +SG+ E +  ++   ++     
Sbjct: 590 YVDLVNDFLKDIQYDSQVASLTVSFRKTNQG---LDLALSGYNEKMPILLTSYLEG---- 642

Query: 719 INSDTVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEID 778
           I+        F+  +  +  K                   ++ E  W ++D+L+ +E++ 
Sbjct: 643 ISRFKPNQERFKIFQAKLIQKLNNHLYEIPYSQASDVYNSLINERSWTIKDKLEVVEQLT 702

Query: 779 IESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVR--EPV 836
            +    F    I +  +      G+ SY   +       L   L+        ++  +P 
Sbjct: 703 FQHLENFLPT-IFEQFFFEALVHGNFSYETAVEI---HKLVKALAPNDIKNCLLKSSKPR 758

Query: 837 THALKPGTNMFI-RRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLR 895
           +  + PG   +  +R A  ++ +S I +  Q G   + ++ +   L   L+       LR
Sbjct: 759 SLHIPPGRAYYYEQRLADEKNINSCIQHVNQFGTYSE-ELAAKAALFAQLIDEPAFDTLR 817

Query: 896 TKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQ 955
           TK+Q+GY VFS       T+ L I   S      LES+ID +LA M   +L  MSEEEF+
Sbjct: 818 TKEQLGYVVFSSALNTHGTVNLRILIQSERDTAFLESRIDAFLAKMGQ-ILQDMSEEEFE 876

Query: 956 ERYIRKFRAMFER 968
                  + + +R
Sbjct: 877 RHRTALCKTLLQR 889

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score =  168 bits (425), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 215/954 (22%), Positives = 372/954 (38%), Gaps = 164/954 (17%)

Query: 31  LANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLGLAHLCEHTILSAGSKKFPRSSHY 90
           L N + VLL+                     P+++ GLAH CEH +L  GSKKFP  + Y
Sbjct: 74  LPNHLRVLLVHDKNTDKSAASLDVNVGAFEDPEDLPGLAHFCEH-LLFMGSKKFPNENEY 132

Query: 91  HEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLFDKVLDTLASSFKNPVFSDSSINK 150
              ++++GG+ NAYT  +NT +YF +   N     L+D  LD  +  F  P+F++SS  K
Sbjct: 133 ASFLSKHGGASNAYTASQNTNYYFHVNHEN-----LYD-ALDRFSGFFSCPLFNESSTEK 186

Query: 151 EIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTGNFATLCDEPNLHKVNVKATL 210
           EI A++SE+  N  +   +LY   + L NP HP+ +F TGNF TL   P    VNV+  L
Sbjct: 187 EIKAVDSENKKNLQNDMWRLYQLGKSLTNPIHPYHKFSTGNFETLWSIPRSKGVNVRDEL 246

Query: 211 CQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLPASRDRDPTRPPLKKRPSSGVAS 270
            +++  +Y A  M L + G + L+ LA+ A + F D+P    + P        P   +  
Sbjct: 247 LKFYNRSYSANLMKLVILGREDLDTLAQWAYELFKDVPNHGTKVPEYHAQAFTPEHLM-- 304

Query: 271 QDLHVRPLDFKNSKQQTQVQDAFV-PDTSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDI 329
           + + V+P+  KN K    V+ +FV PD      ++ ++         +SH          
Sbjct: 305 KVIKVKPV--KNLKS---VEISFVVPDMDKHWQVKPARY--------LSH---------- 341

Query: 330 VALSENWCDFFGDEGVGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSA 389
                      G EG  SL   LK N+    + A     S GN   ++   LT+ G    
Sbjct: 342 ---------LIGHEGTDSLLAYLKNNSWAIDLSAGATTVSEGNAYFSVNVDLTDEGVVQY 392

Query: 390 QLIITVLFDLF------IPR-LIHDKTKDIA----KCLSELNCTDLLTFLYQGAEKSSME 438
           + +I  +F         +P+  +  + KDI     K   + N    ++ L +  +K+ + 
Sbjct: 393 EAVICAVFQYINMLKEVLPQEWVFTELKDIGEAHFKFKQKGNPAATVSSLSKNLQKAYLP 452

Query: 439 MCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDYSESTESRTWWIGRAIKFQNF 498
           +  +L++ L+  +E                   P  I +Y  S                 
Sbjct: 453 VQVILNTSLMRQYE-------------------PGLIMEYLNS----------------- 476

Query: 499 VSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAYYEFTYQISKIDMLSVREELYRIPG 558
               +  +N R++++    +++L         + A Y   + +SKI  L     L     
Sbjct: 477 ----LTLENSRVMLISQKVETNLSERWYGTEYSVADYTKDF-VSKIRSLGANPAL----- 526

Query: 559 FSFRVPCYDMFLPT---VGRKLGLIKQALQASSNRSQTSLLTVVARNAYLQTIPRLAGKN 615
              ++P  + F+ T   V +  G +K  L+                       P L   +
Sbjct: 527 ---KIPAPNEFIATRFDVHKDEGNVKPLLE-----------------------PFLLRDD 560

Query: 616 SNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSE 675
              +LW K++D  + +  K  I I +      +    +M   +    + DSL  + Y +E
Sbjct: 561 RCGKLWYKKDD--MFWVPKGYIYISMKLPHTHSSIVNSMLCTLYVDHINDSLKDLAYNAE 618

Query: 676 KLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAMFRKARVA 735
             G    +  + +G   L  ++SG+ + +  ++    +  + L     +    F   +  
Sbjct: 619 CAGLEISLRKTNQG---LDLSLSGYNDKLLVLLARFFEGIQKLF----LREERFMVLKQR 671

Query: 736 VRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTY 795
           +  K                   ++ E  W  +++LD  E++  +    F    I +  Y
Sbjct: 672 LIQKLHNHLYDTPYTQIGRLYSSLINERSWTTQEKLDITEQLTFDHLANFVPT-IYEQMY 730

Query: 796 LNVFSQGDLSYTEEISTF-LDSGLTSHLSRRTWHEPAVREPVTHALKPGTNMFIRRSAFV 854
             +   G+ S+ E +  + L S L  +  R +         +     P    +   +A  
Sbjct: 731 FELLVHGNFSHEEALEVYDLVSSLVPNEIRNS---EGRNSKLRSYFIPAGGAYHYETALA 787

Query: 855 --EDPSSSIVYFIQTGDRDD---------AQMLSLTCLTEFLMSMTLVPDLRTKKQIGYA 903
             E+ +S I   IQ G   +         AQM++  C             LRT++Q+GY 
Sbjct: 788 DKENVNSCIQKVIQLGAYSELLSAKGSLLAQMVNEPCFNT----------LRTEEQLGYV 837

Query: 904 VFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQER 957
           VFS       T+ L I   S     +LES+ID          L  MS  EF++ 
Sbjct: 838 VFSSKLNTHGTVNLRILVQSERSSSYLESRIDTSCQKFG-STLEMMSNAEFEKH 890

>NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {ON}
            Anc_4.246
          Length = 995

 Score =  156 bits (394), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 233/1032 (22%), Positives = 407/1032 (39%), Gaps = 187/1032 (18%)

Query: 62   PDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASND 121
            P+ + GLAH CEH +L  GS+KFP  + Y   ++++GG  NAYT   NT ++FE+ A + 
Sbjct: 83   PEPLPGLAHFCEH-LLFMGSRKFPDENDYSSFLSKHGGHSNAYTGSSNTNYFFEINAEHL 141

Query: 122  SGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPR 181
             G       LD  +  F  P+F+ ++ +KEI A++SE+  N  +   ++Y   + L+N +
Sbjct: 142  FG------ALDRFSGFFTGPLFNKNATDKEINAVDSENKKNLQNDLWRIYQLDKSLSNLK 195

Query: 182  HPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAK 241
            HP+ +F TGN  TL   P    +N++  L +++  +Y A  M LC+ G + L+ LA+   
Sbjct: 196  HPYHKFSTGNIQTLKQLPESQGLNIRDELLKFYDDSYSANLMKLCIIGREDLDTLAQWTA 255

Query: 242  KYFGDLPASRDRDPTRPPLKKRPSSGVASQDLHV-RPLDFKNSKQQTQVQDAF-VPDTSN 299
              F D+   +++D   P  +      +  ++ H+ R +  +  K+  ++   F VPD   
Sbjct: 256  DLFNDV---KNKDKPLPVFQ----DPILLKEQHLQRIIQVEPVKELRKLDIEFCVPDYE- 307

Query: 300  LVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLIN 359
                  SK P +     +SH                     G EG GSL   LKT    N
Sbjct: 308  --KHWQSKIPHI-----LSH-------------------LIGHEGNGSLLSHLKTLGWAN 341

Query: 360  GVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHD--------KTKD 411
             + A     S  N   ++   LT  G +  + +  ++F  +I  L H         + ++
Sbjct: 342  ELSAGGHTVSENNAFFSIAIELTQKGLAHYKDVTHLIFQ-YIEMLRHSLPQEWIYLELQN 400

Query: 412  IAKCLSEL----NCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIE 467
            I K   +     N ++ ++ L +  EK  + +  +L++ L + +E   P+ + K   ++ 
Sbjct: 401  INKANFKFKQNGNPSNTVSSLSKMLEKEYIPVGDILATNLFTKYE---PELITKYLEMMT 457

Query: 468  CNQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTS 527
             + +   +      T+S   W G   K    V E+                +DL++ +TS
Sbjct: 458  FDNSRITLISKDLETDSFEKWYGTKYK----VIEY---------------PADLIAKITS 498

Query: 528  VSKTDAYYEFTYQISKIDMLSVREELYRIPGFS--FRVPCYDMFLPTVGRKLGLIKQALQ 585
                                         PG +  F +P  + F+               
Sbjct: 499  -----------------------------PGLNPNFHLPRPNEFI--------------- 514

Query: 586  ASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKT 645
             ++N   T L  V          P L  +    +LW K++D     +    IS ++    
Sbjct: 515  -ANNFQVTKLENVTPLEE-----PHLLKETELGKLWYKKDDRFWQPRGHIYISFKLPHTH 568

Query: 646  IEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVC 705
            +    S  M   +  QL+ DSL  + Y +        ++ + +G   L  T+SGF + + 
Sbjct: 569  LSLLNS--MLTTLYVQLINDSLKDLQYDASCANLHASLTKTNQG---LDITVSGFNDKLI 623

Query: 706  AMVRVIIDQTKSLI-NSDTVTPAMFRKARVA-VRNKYEEXXXXXXXXXXXXXXXIVLEEC 763
             ++   +   KS   NSD     +F+   +  ++N   E                ++ E 
Sbjct: 624  ILLTRFLQGIKSFKPNSDRF--QIFKDKTIQHLQNSLYEVPYSQMSTLYNS----LINER 677

Query: 764  MWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLS 823
             W   ++L AL++I  +   TF    I +  Y      G+L Y E +   +DS +   L+
Sbjct: 678  TWTTTEKLSALDKISYDQLLTFIPT-IFEELYFESLIHGNLKYDEAME--IDSLVKLLLT 734

Query: 824  RRTWHEPAVR-EPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLT 882
                    ++ + +   + P    F R    ++DP + +   IQ   + D     L+   
Sbjct: 735  ENNILNLQIQNDKLRSYILPKGKTF-RYETDLKDPKN-VNSCIQHVTQIDIYSEELSAKC 792

Query: 883  EFLMSMTLVP---DLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLA 939
                 M   P    LRTK+Q+GY VFS       T  + I   S     +LE +ID +  
Sbjct: 793  ALFAQMIHEPCFDTLRTKEQLGYVVFSSTLNNHGTANIRILVQSEKSTPYLEWRIDNFYK 852

Query: 940  YMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQ 999
                  L  MSE+ F +      +++ ++                          N+ E+
Sbjct: 853  IFGKS-LKTMSEDTFVKHKDALCKSLLQK------------------------YKNMNEE 887

Query: 1000 GAAMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLS 1059
             A      R  + I +  YNF      A   L+  LT  Q   FF+E  +I     SKL 
Sbjct: 888  SA------RYTSAIYLGDYNFLHRHRKA--ALVEKLTKDQMISFFEE--NIIGKEASKLI 937

Query: 1060 VMVASPVSADEI 1071
            V + S V  D +
Sbjct: 938  VHLQSQVEVDGV 949

>Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa]
           {ON} YLR389C (REAL)
          Length = 1023

 Score =  154 bits (388), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 216/988 (21%), Positives = 387/988 (39%), Gaps = 151/988 (15%)

Query: 4   MSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPD 63
           M+   + FD+ F  P     +      L N +  LLI                     P+
Sbjct: 54  MTANFKTFDLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNVGAFEDPE 112

Query: 64  EVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSG 123
            + GLAH CEH +L  GS+KFP  + Y   ++++GGS NAYT  +NT ++FE+   +  G
Sbjct: 113 NLPGLAHFCEH-LLFMGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEVNHQHLLG 171

Query: 124 ELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHP 183
                  LD  +  F  P+F   S +KEI A+ SE+  N  +   ++Y   + L N +HP
Sbjct: 172 ------ALDRFSGFFSCPLFQKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNSKHP 225

Query: 184 FSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKY 243
           + +F TGN  TL + P  + +N++  L ++ K  Y A  M LC+ G + L+ L++     
Sbjct: 226 YHKFSTGNIETLGESPKENGLNIRDELLKFHKHFYSANIMKLCILGREDLDTLSEWTYDL 285

Query: 244 FGDLPASRDRD-PTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAF-VPDTSNLV 301
           F D+ ++ DR+ P  P    +P      + + V P+     K   +++ +F VPD   + 
Sbjct: 286 FKDV-SNNDREVPYYPESIMQPEH--LQKIIQVNPV-----KDLKKLEISFTVPD---ME 334

Query: 302 AIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGV 361
               SK P +     +SH                     G EG GSL   LK     N +
Sbjct: 335 EHWKSKPPRI-----LSH-------------------LIGHEGSGSLLAHLKELGWANEL 370

Query: 362 VASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLF------IP-RLIHDKTKDIAK 414
            A     S GN    ++  LT+ G +  + +I ++F         +P + I  + +DI+ 
Sbjct: 371 SAGGHTVSKGNAFFAVDIDLTDNGLTHYRDVIVLIFQYIGMLKNSLPQKWIFTELQDISN 430

Query: 415 CLSEL----NCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQ 470
              +     N +  ++ L +  E+  + +  +L+  LL+ +E                  
Sbjct: 431 ATFKFKQAGNPSSTVSSLAKLLERDYIPVDKILAMGLLTEYE------------------ 472

Query: 471 NPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSK 530
            P  I  Y+E+                     +  +N R+ ++    ++D          
Sbjct: 473 -PDLITKYTEA---------------------LIPENSRVTLISRGLETD---------S 501

Query: 531 TDAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNR 590
           ++ +YE  Y+I     L   E+L +           D+  P +   L L +     S+N 
Sbjct: 502 SEKWYETKYKI-----LDYPEDLLK-----------DIKSPGLNPALNLPRPNEFVSTNF 545

Query: 591 SQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACP 650
               +  V   +      P L   +    LW K++D    ++ +  I +        A  
Sbjct: 546 KVNKIDGVKPTDE-----PMLLLSSGMSRLWYKKDDR--FWQPRGYIYLSFKLPHTHASV 598

Query: 651 SYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRV 710
             +M   +  Q++ D+L  + Y +           + +G   L  T SGF E +  ++  
Sbjct: 599 INSMLSTLYIQMINDALKDLQYDAACADLRISFVKTNQG---LDITASGFNEKLIVLLTR 655

Query: 711 IIDQTKSLINSDTVTPAMFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDR 770
            +    S          +  K    ++N   E                ++ E  W   ++
Sbjct: 656 FLQGVVSFEPKKDRFEILKDKTIRHLKNLLYEVPYSQMSNYYNS----LINERSWSTAEK 711

Query: 771 LDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEP 830
           L   E++  E   +F    I +  +      G++ + E I   +DS + S ++    +  
Sbjct: 712 LQVFEKLTFEQLNSFIPT-IYEGVFFETLVHGNIKHEEAIE--VDSLIKSLIANNIDNLQ 768

Query: 831 AVREPVTHALKPGTNMFIRRSAFVEDPS--SSIVYFIQTGDRDDAQMLSLTCLTEFLMSM 888
                +   L P    F R    ++DP   +S +  +   D    ++ +L+ L   L+  
Sbjct: 769 VSNNRLRSYLLPKGKSF-RYETDLKDPKNVNSCIQHVTQLDVYSEELSALSGLFAQLIHE 827

Query: 889 TLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQ-YLAYMEHDVLS 947
                LRTK+Q+GY VFS       T  + I   S     +LE +I+  Y  + +H  L 
Sbjct: 828 PCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRINNFYETFGQH--LK 885

Query: 948 AMSEEEFQER-------YIRKFRAMFER 968
            M++E+F +         ++KF+ M E 
Sbjct: 886 DMTQEDFDKHKEALCNSLLQKFKNMSEE 913

>KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa]
           {ON} similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 1001

 Score =  150 bits (379), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 138/500 (27%), Positives = 221/500 (44%), Gaps = 60/500 (12%)

Query: 4   MSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPD 63
           MS  + H  V F  P+   ++      L N +  LLI                     P+
Sbjct: 38  MSSYIDH-GVKFTKPLLD-DRNYRFIELPNKLKALLIQDPTTDKAAAALDVNVGSFEDPE 95

Query: 64  EVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSG 123
           ++ GLAH CEH +L  GS KFP  + Y   ++++GG  NAYT+  NT ++F++   +  G
Sbjct: 96  DLPGLAHFCEH-LLFMGSSKFPNENEYSSYLSKHGGGSNAYTSARNTNYFFQVNQESLHG 154

Query: 124 ELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHP 183
            LL        +  F  P+F+  S +KEI A++SE+  N  S   +LY   +  +NP HP
Sbjct: 155 ALL------RFSGFFSCPLFNKESTDKEINAVDSENKKNLQSDLWRLYQLDKSQSNPEHP 208

Query: 184 FSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKY 243
           F +F TGN  TL D P    V+++  L +++ ++Y A  M LC+ G + L+ +++     
Sbjct: 209 FHKFSTGNLKTLGDIPKSKDVDIRDELLKFYDSSYSANLMKLCVLGREDLDTMSQWVYDL 268

Query: 244 FGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFV-PDTSNLVA 302
           F D+P S    PT       P     +Q ++ +P+     K   +V+  FV PD    V 
Sbjct: 269 FKDVPNSDRPVPTYEAKMLPPQ--YLTQIINAKPV-----KDLKKVEITFVAPD----VD 317

Query: 303 IQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVV 362
            Q    P   L    SH                     G EG GSL   LK     N + 
Sbjct: 318 EQWDSKPGHYL----SH-------------------LIGHEGSGSLLAYLKLKGWANELS 354

Query: 363 ASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLF------IPR-LIHDKTKDIA-- 413
           A     S  N   +++  LT+ G  + + +I  +F         +P+  I+++ +D A  
Sbjct: 355 AGSHTVSEDNAFFSVDIDLTDEGVKNYESVIQSVFQYIELLKKELPQEWIYEELRDTAEA 414

Query: 414 --KCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKG-SPLIECNQ 470
             K   + N    ++ L +  EK  + +  VLS+ LL  +E   P+ ++K  + LI  N 
Sbjct: 415 SFKFKQKGNPASTVSSLSKALEKDYIPVGDVLSTSLLRKYE---PELVVKYIAHLIPENS 471

Query: 471 NPSAIGDYSESTESRTWWIG 490
             + I   + ST+S   W G
Sbjct: 472 RVTFIHK-NASTDSTEKWYG 490

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/365 (19%), Positives = 145/365 (39%), Gaps = 22/365 (6%)

Query: 609 PRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLS 668
           P L  ++   ++W K++D     K    +S+++A        S  M   +  +L+ D L 
Sbjct: 542 PLLLKQDRQSKVWYKKDDRFWVPKGHIYVSMKLAHTYSSVVNS--MLTTLYVELINDYLK 599

Query: 669 TVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPA- 727
            + Y ++          + +G   L  ++SG+ E +  +++  ++   +        PA 
Sbjct: 600 DLEYDAQVASLHISFRKTNQG---LDLSLSGYNEKMAILLKRYLEGIANF------QPAE 650

Query: 728 -MFRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFC 786
             F+  +  +  K                   V+ E  W + ++L+ ++++  E  + F 
Sbjct: 651 DRFKIYQDKLLQKLNNHLYEVPYSQVSDVFNSVINERAWTIANKLEVVKQLKFEHLKLFI 710

Query: 787 SGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPVTHA-LKPGTN 845
                + ++  +   G+ S    +       L   L+ R      ++     + L P   
Sbjct: 711 PAIFEQFSF-EILVHGNFSCEAALEA---DNLVRALAPRDVQNFQLKSSKPRSVLLPQGK 766

Query: 846 MFIRRSAFVEDPS--SSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYA 903
            F  +    +D +  S I +  Q G   + ++ +   L   L+       LRTK+Q+GY 
Sbjct: 767 TFCYQQMLADDKNINSCIQHVTQFGSYSE-ELSAKASLFAQLIDEPAFDTLRTKEQLGYV 825

Query: 904 VFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFR 963
           VFS       T+ L +   S     +LES+ID +L  M   VL  MS+EEF+   +   +
Sbjct: 826 VFSSALNTHGTVNLRLLIQSERDTAYLESRIDAFLVKMGQ-VLQEMSDEEFERHKVALCK 884

Query: 964 AMFER 968
            + +R
Sbjct: 885 TLLQR 889

>ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {ON}
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 994

 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 129/494 (26%), Positives = 212/494 (42%), Gaps = 54/494 (10%)

Query: 23  NKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLGLAHLCEHTILSAGSK 82
           ++     +L N +  LLI                     P+ + GLAH CEH +L  GS+
Sbjct: 46  DRSYRYIQLPNDLKALLIHDSKADKAAAALDVNVGAFEDPEGLPGLAHFCEH-LLFMGSE 104

Query: 83  KFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLFDKVLDTLASSFKNPV 142
           K+P  + Y   ++++GG+ NAYT  +NT +YFE+     + E LF   LD  A  F  P+
Sbjct: 105 KYPDENEYSSYLSKHGGASNAYTGSQNTNYYFEV-----NHEHLFG-ALDRFAGFFTCPL 158

Query: 143 FSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTGNFATLCDEPNLH 202
           F+  S +KEI A++SE+  N  S   +LY   + L N  HP+ +F TGNF TL + P  +
Sbjct: 159 FNRDSTDKEIKAVDSENKKNLQSDLWRLYQLDKSLTNEEHPYHKFSTGNFITLHEIPTSN 218

Query: 203 KVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLPASRDRDPTRPPLKK 262
            ++V+  L +++K +Y A  M LC+ G + L+ L+  A   F D+P              
Sbjct: 219 GIDVREELLKFYKKSYSANLMKLCVLGREDLDTLSNWACSLFQDVPNI-----------A 267

Query: 263 RPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVPDTSNLVAIQSSKNPVLRLVFPVSHKST 322
           RP     S+ L  R L       Q  +    V D   L    S+ +  L       H  +
Sbjct: 268 RPVPEYGSKMLDERSL-------QKVIHAKSVKDLKKLEVTFSAPDMDLEWESKPQHILS 320

Query: 323 RLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTLT 382
            L                G EG GSL   LK     N + A     S  N   +++  LT
Sbjct: 321 HLV---------------GHEGSGSLLAHLKDKGWANELSAGGHSVSKENAFFSIDIDLT 365

Query: 383 NLGWSSAQLIITVLFD------LFIP-RLIHDKTKDIAKCLSELN----CTDLLTFLYQG 431
           +LG    + +  ++F       L +P + I+ + +DIA+   +       +  ++ L + 
Sbjct: 366 DLGLKHYEDVTHIIFQYLEMLKLNLPKKWIYLELEDIARATFKFKQKSSASSTVSSLAKK 425

Query: 432 AEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDYSESTESRTWWIGR 491
            EK  + +  +LS+ LL  +   D   L+K    +    +   +      T+S+  W G 
Sbjct: 426 LEKEYVPVKYILSTELLREY---DADLLMKYLHTLTPENSRIMLASNETKTDSKEKWYGT 482

Query: 492 AIKFQNFVSEFVNR 505
             +  +F    + +
Sbjct: 483 EYRVTDFTHTLLKK 496

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 99/493 (20%), Positives = 172/493 (34%), Gaps = 96/493 (19%)

Query: 609  PRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLS 668
            P L   +   +LW K++D    ++ +  I I       +A    +M   +  QL+ D + 
Sbjct: 533  PLLLKDDKISKLWYKKDDR--FWQPRGYIYISFKLPHTQASIVNSMLSTLYVQLINDYIK 590

Query: 669  TVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAM 728
             + Y +         S + +G   L  T+ GF + +  ++   ++  KS           
Sbjct: 591  DLQYDAACADLHLSFSKTNQG---LDITVVGFNDKLTILLTRFLEGLKSFKPEKNRFQIF 647

Query: 729  FRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSG 788
              K    + N+  E                ++ E  W V+++L+ L+ +  E   T+   
Sbjct: 648  KDKCTRQLTNQLYEVPYLQVFPVYSS----LINERTWSVKEKLEVLKRLTFEQLVTYLPT 703

Query: 789  FISKPTYLNVFSQGDLSYTEEI-------------------------STFLDSGLTSHLS 823
             I +  +   F  G++ Y E I                         S FL  G T    
Sbjct: 704  -IYEEMFFEAFVHGNMKYEEAIEVDSLVQMLVPNDIRNFQTKNGKLRSYFLPQGETYRYE 762

Query: 824  RRTWHEPAVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTE 883
             +      +   + H  + G         + E+ S+    F        AQM+   C   
Sbjct: 763  TKLQDSQNLNSCIQHVTQLG--------VYSEEISAKASLF--------AQMIHEPCFDT 806

Query: 884  FLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEH 943
                      LRTK+Q+GY VFS       T  + I   S      LE +I+ +L     
Sbjct: 807  ----------LRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPFLEWRIESFLQGF-G 855

Query: 944  DVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAM 1003
             +L  MS+++F+                       G  D L +  A  +  N+ E+ +  
Sbjct: 856  KILQDMSDKDFE-----------------------GHKDALCKSLAQKYK-NMKEESS-- 889

Query: 1004 RQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVA 1063
                R    I +  YNFT     +   L+  LT  +   F+Q    I     SKL + + 
Sbjct: 890  ----RYAAAIYLGDYNFTHKQRKSQ--LVSQLTKEEIEEFYQN--FIVGPNASKLVLHIQ 941

Query: 1064 SPVSADEIAEKRL 1076
            S V++D++ E  L
Sbjct: 942  SQVTSDKLDESNL 954

>SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1006

 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 124/517 (23%), Positives = 228/517 (44%), Gaps = 58/517 (11%)

Query: 1   MSGMSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXX 60
           MS  +  + H  ++F  P    ++     +L N +  LLI                    
Sbjct: 39  MSSSNSYINH-KISFKKP-DLDDRNYRFIQLPNNLKALLIQDPATDKAAAALDINVGAFE 96

Query: 61  XPDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASN 120
            P+ + GLAH CEH +L  GS KFP  + Y   ++++GG+ NAYT  +NT +YF++   +
Sbjct: 97  DPENIPGLAHFCEH-LLFMGSSKFPDENEYSSFLSKHGGASNAYTGSQNTNYYFQVNHED 155

Query: 121 DSGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANP 180
             G       LD  +  F +P+F+ +S +KEI A++SE+  N  +   ++Y   +   +P
Sbjct: 156 LRG------ALDRFSGFFTSPLFNKNSTDKEINAVDSENKKNLQNDLWRMYQLDKSFTSP 209

Query: 181 RHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLA 240
            HP+ +F TGN  TL + P    ++++  L +++   Y A  M LC+ G + L+ +++  
Sbjct: 210 MHPYHKFSTGNLKTLGETPKNQGLDIRDELLKFYNKFYSANIMKLCVLGREDLDTMSEWV 269

Query: 241 KKYFGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAF-VPDTSN 299
            + F D+   R+ + + P      S  +   +   + +  K  K   +V+  F VPD   
Sbjct: 270 YELFKDV---RNNNCSVPEY----SIPLLPAEYKTKIIRAKPVKDLKKVEITFAVPD--- 319

Query: 300 LVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLIN 359
            V +     P   L    SH                     G EG GSL   LK     N
Sbjct: 320 -VDVHWESKPHHYL----SH-------------------LIGHEGSGSLLAYLKGQGWAN 355

Query: 360 GVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLF------IPR-LIHDKTKDI 412
            + A     S  N   +++  LTN G    Q +++ +F         +P+  I+ + KD+
Sbjct: 356 ELSAGAHTVSVNNAFFSVDIELTNNGLDHYQDVVSSVFQYIEMLKCSLPQSWIYTELKDV 415

Query: 413 A----KCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIEC 468
           A    K   + + +  ++ L +  EK  + +  +LS+ LL  +   DP+ +++ + ++  
Sbjct: 416 AQASFKFKQKGHASSTVSSLAKALEKEYIPVGDILSTSLLRKY---DPELIMQYTNILTP 472

Query: 469 NQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNR 505
             +   +      T+S+  W G      ++  EF+++
Sbjct: 473 ENSRITVISKDVETDSKEKWYGTEYSVIDYPKEFLDK 509

 Score = 52.4 bits (124), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 69/345 (20%), Positives = 139/345 (40%), Gaps = 20/345 (5%)

Query: 619 ELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLG 678
           +LW K++D+  + +    +S+++A        S  M   +  +L+ D L  + Y +E   
Sbjct: 556 KLWYKKDDTFWAPRGYIYVSMKLAHTHSSIVNS--MLTSLYVELINDHLKDLQYDAEVAN 613

Query: 679 YTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAM--FRKARVAV 736
                S + +G   L  ++ G+ E +  ++   ++  K        TP +  F+  +  +
Sbjct: 614 LHVSFSKTNQG---LDISLCGYNEKLTILLTRFLEGIKEF------TPKLDRFKIFQDKL 664

Query: 737 RNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYL 796
             K                   ++ E  W  +++LD  +++  E  + F    I +  Y 
Sbjct: 665 VRKLNNHLYEVPYSQLSGIFNSLINERSWSTKEKLDLTKQLTFEHLKNFIPT-IYEQLYY 723

Query: 797 NVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVED 856
            +   G+ S  +E +T ++  +   +     +       +   + P    F       ++
Sbjct: 724 EILVHGNFS--QEAATEINDLVKMMVPNDIKNLQVKNGKLRSYIIPQEKTFRMELPLADE 781

Query: 857 PS--SSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTT 914
            +  S I +  Q G   +  + + T L   L+       LRTK+Q+GY VFS       T
Sbjct: 782 KNVNSCIQHVTQFGIYSE-DLSAKTALLAQLIDEPCFDTLRTKEQLGYVVFSSALSTHGT 840

Query: 915 MGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYI 959
           + L +   S     +LES+ID +L     ++L  M EEEF++  +
Sbjct: 841 VNLRLLIQSERDSSYLESRIDSFLKKFG-NILREMPEEEFEKHKV 884

>TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON}
           Anc_4.246 YLR389C
          Length = 995

 Score =  144 bits (363), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 119/413 (28%), Positives = 194/413 (46%), Gaps = 57/413 (13%)

Query: 62  PDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASND 121
           P  + GLAH CEH +L  GSK FP  + Y   + QNGG  NAYT   NT ++FE+  +N 
Sbjct: 78  PSNLPGLAHFCEH-LLFMGSKNFPNENDYSSYLNQNGGFSNAYTGSMNTNYHFEINHAN- 135

Query: 122 SGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPR 181
               LF+  L   +  FK P+F++ S  KEI+AI+SE+  N  +   +LY   + L+N  
Sbjct: 136 ----LFE-ALRRFSCFFKTPLFNNDSTIKEIHAIDSENKKNLQNDYWRLYQLGKSLSNHE 190

Query: 182 HPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAK 241
           HP+ +F TG+  TL +      +N++  L +++   Y +  M LC+ G + L  L++ AK
Sbjct: 191 HPYHKFSTGSKLTLLENTETLNLNIREELIKFYNKWYSSNIMNLCIIGREDLGTLSRWAK 250

Query: 242 KYFGDLPASRDRDPTRPPLKKRPSSGVASQD--LHVRPLDFKNSKQQTQVQDAFVPDTSN 299
             F ++P      PT      +P   +A +   + V+P+     K   Q++  F      
Sbjct: 251 ILFENVPNKNVILPTF----SQPVWTIADKKKVISVKPV-----KDLKQLELTFHIKEDE 301

Query: 300 LVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLIN 359
           L   +S  + +L      SH                    FG +G GS++  LK   LI 
Sbjct: 302 LTTWKSKPSYIL------SH-------------------LFGHKGNGSISSLLKNQQLIT 336

Query: 360 GVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLF------IPR-LIHDKTKDI 412
           G+ +   + S  N   +L F LT  G +  + II ++F         +P+  I+++ K I
Sbjct: 337 GISSGSENISKENSLFSLNFDLTEDGINQYEKIIKIVFQYIKMLNSNLPQEWIYNELKGI 396

Query: 413 A----KCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLK 461
           +    K   ++N    ++ L +  EK+ + +  +LS  L   F   DP+ L K
Sbjct: 397 SDNSFKYKQKINPASTVSQLSKRMEKTFIPINNILSHEL---FYEYDPQQLNK 446

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 88/203 (43%), Gaps = 15/203 (7%)

Query: 759 VLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGL 818
           ++ E  W VE+ L  +++ID    + F    I +  +    + G++ Y  E +  +DS +
Sbjct: 669 LINERSWSVEENLKVVQDIDFPQLQDFIPT-IYQELFFETLAFGNIQY--EQAQEVDSLV 725

Query: 819 TSHLSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVEDPS---SSIVYFIQTGDRDDAQM 875
            + +     +     + +   + P    F +   F +D +   + I Y  Q G   +   
Sbjct: 726 RTLIPNTIKNSQVKNDRLRSYIIPSGKTF-KYEVFQKDKNNLNTCIQYICQFGIYSEYLA 784

Query: 876 LSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQID 935
             ++ L + +M       LRTK+Q+GY VFS       T  L I   S    ++L+ +I+
Sbjct: 785 AVVSLLAQ-IMHEPCFNTLRTKEQLGYIVFSSSLSNHGTCNLSIMVQSEYSTDYLQFRIE 843

Query: 936 QYLAYMEHDVLSAMSE---EEFQ 955
            +L     D LS + E   EEF+
Sbjct: 844 NFLK----DFLSYLKEMPREEFK 862

>TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {ON}
           Anc_4.246 YLR389C
          Length = 965

 Score =  144 bits (362), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 131/515 (25%), Positives = 222/515 (43%), Gaps = 59/515 (11%)

Query: 4   MSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPD 63
           MS   + +++ F  P    ++      L N + VLLI                     P+
Sbjct: 1   MSTPYKTYNLNFAKP-DLDDRNYRFIELPNSLKVLLIQDATTDKAAASLDVNIGAFEDPE 59

Query: 64  EVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSG 123
            + GLAH CEH +L  GS+K+P  + Y   ++ NGGS+NAYT   NT ++FE+   +  G
Sbjct: 60  GLPGLAHFCEH-LLFMGSEKYPDENEYSSFLSTNGGSYNAYTGALNTNYFFEINYEHLEG 118

Query: 124 ELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHP 183
                  LD  +  F  P+FS  S +KEI A++SE+  N  S   ++Y   + L+N +HP
Sbjct: 119 ------ALDRFSGFFSRPLFSKDSTDKEINAVDSENKKNLQSDVWRMYQLDKSLSNRKHP 172

Query: 184 FSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKY 243
           + +F TGN  TL   PN   ++++  L +++  +Y A  M L + G + L+ L   A   
Sbjct: 173 YHKFSTGNIQTLGTIPNEQGLDIRDELLKFYNNSYSANLMKLTILGREDLDILGDWAYSM 232

Query: 244 FGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAF-VPDTSNLVA 302
           F D+       P     +K  +     Q ++++P+     +   +++ +F VPD   L  
Sbjct: 233 FKDVKNLNRELPVYE--EKMLTEEYLMQIINIKPV-----QDMRKLELSFTVPD---LDK 282

Query: 303 IQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVV 362
              SK P +     +SH                     G EG GSL   LK       + 
Sbjct: 283 EWESKTPRI-----LSH-------------------LLGHEGSGSLLAHLKCLGWATELA 318

Query: 363 ASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLF-------DLFIPRLIHDKTKDIA-- 413
           A     S  N   +++  LT  G++  + +   +F       D      I+D+ + IA  
Sbjct: 319 AGGHTISDDNAVFSVDIDLTEEGFNHYEDVTVAIFQYINMLKDTLPQEWIYDELQAIANA 378

Query: 414 --KCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKG-SPLIECNQ 470
             K   + + +  ++ L +  EK  + +  +L++ L S +E   P+ L+   + L   N 
Sbjct: 379 EFKFKQKTSPSGTVSSLSKALEKEYIPVEKILATSLFSKYE---PELLMNYINELTPYNS 435

Query: 471 NPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNR 505
             S I    E+ E   W+ G   K   +  +F+ R
Sbjct: 436 RLSLISKDVETDEVEEWY-GTEYKSITYPKKFIKR 469

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/395 (20%), Positives = 162/395 (41%), Gaps = 43/395 (10%)

Query: 609 PRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLS 668
           P L   +   +LW K++D    ++ +  I I        A  + +M   +  QL+ D L 
Sbjct: 506 PYLLKDDQVSKLWFKKDDR--FWQPRGYIHIFTKLPHSHASITNSMLTSLYVQLVNDQLK 563

Query: 669 TVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAM 728
            + Y +         S + +G   L  T+SGF   +  ++   +   K+           
Sbjct: 564 DLQYDASCASLDISFSKTGQG---LDITVSGFNHKILILLESFLKGIKNF---------K 611

Query: 729 FRKARVAV-RNKY----EEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFR 783
             K+R  + + KY    +                 V+++  W ++++L  ++++  E   
Sbjct: 612 LEKSRFLIFQEKYIQQLKNMLFQVPYGQVSHYYNYVIDDRAWSIKEKLSTMQKLTFEDLE 671

Query: 784 TFCSGFISKPTYLNVFSQGDLSYTE--EISTFLDSGLTSHLSRRTWHEPAVREPV--THA 839
            F     ++  Y      G+   ++  E++  ++  ++  +     H P +R     ++ 
Sbjct: 672 NFLPTIFNE-VYFESLVHGNFEKSDAAEVNQLVEKYISGSI-----HNPQIRNDRLRSYV 725

Query: 840 LKPGTNMFIRRSAFVEDP---SSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRT 896
           L+ G     R    +EDP   +S I +  Q G  +D ++ +L+ L   +++      LRT
Sbjct: 726 LQKGETY--RYETLLEDPENVNSCIQHVTQIGLYND-RLAALSSLFAQIINEPCFNILRT 782

Query: 897 KKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQE 956
           K+Q+GY VFS       T  + I   S    E+LE +ID++   ++  +L+ M+ E F+ 
Sbjct: 783 KEQLGYVVFSSSLNNYGTTNIRILVQSEHTTEYLEWRIDEFYKSVK-TILTQMAPETFEN 841

Query: 957 R-------YIRKFRAMFERENVTSTSDAAGPADLL 984
                    ++K++ M E  +  S S   G  D L
Sbjct: 842 HKDALCKTLLQKYKNMKEESSRYSNSIFNGDYDYL 876

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score =  143 bits (361), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 146/564 (25%), Positives = 242/564 (42%), Gaps = 74/564 (13%)

Query: 4   MSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPD 63
           M+   + FD+ F  P     +      L N +  LLI                     P+
Sbjct: 53  MTSNFKTFDLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPE 111

Query: 64  EVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSG 123
            + GLAH CEH +L  GS+KFP  + Y   ++++GGS NAYT  +NT ++FE+   +  G
Sbjct: 112 SLPGLAHFCEH-LLFMGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEINHQHLFG 170

Query: 124 ELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHP 183
                  LD  A  F  P+F+  S +KEI A+ SE+  N  +   ++Y   + L NP HP
Sbjct: 171 ------ALDRFAGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNPNHP 224

Query: 184 FSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKY 243
           + +F TGN  TL   P  +  NV+  L Q+    Y A  M LC+ G + L+ L+      
Sbjct: 225 YHKFSTGNIETLGTLPKENGQNVRDELLQFHNNFYSANLMKLCILGREDLDTLSDWTYNL 284

Query: 244 FGDLPASRDRDPTRPPLKKRP--SSGVASQDLHVRPLDFKNSKQQTQVQDAF-VPDTSNL 300
           F D+ ++ DR+    P    P   S    + + V P+     K   +++ +F VPD   +
Sbjct: 285 FKDI-SNNDRE---VPHYAEPIMQSEYLQKIIQVHPV-----KDLKKLEISFTVPD---M 332

Query: 301 VAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLING 360
                SK P +     +SH                     G EG GSL   LK     N 
Sbjct: 333 DEKWESKPPRI-----LSH-------------------LIGHEGSGSLLAHLKNVGWANE 368

Query: 361 VVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLF------IP-RLIHDKTKDIA 413
           + A     S GN    ++  LT+ G +  + +I ++F         +P + I  + +DI 
Sbjct: 369 LSAGGHTVSKGNAFFAVDIDLTDNGLTHYRDVIVLVFQYIEMLKNSLPQKWIFSELQDIC 428

Query: 414 KCLSEL----NCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGS-PLIEC 468
               +     + +  ++ L +  EK  + +  +L+  LL+ +E   P  L + +  LI  
Sbjct: 429 NASFKFKQAGSPSSTVSSLAKFLEKEYIPVDRILAMGLLTKYE---PDLLTQYTDALIPE 485

Query: 469 NQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSV 528
           N   + I    E+  S  W+ G A K  ++ ++ V     R +      KS  L+   ++
Sbjct: 486 NSRVTLISKSLETNSSEKWY-GTAFKVLDYPADLV-----RDI------KSPGLNPALNL 533

Query: 529 SKTDAYYEFTYQISKIDMLSVREE 552
            + + +    +++ KID +   EE
Sbjct: 534 PRPNEFVSTNFKVDKIDGVKPLEE 557

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 70/370 (18%), Positives = 138/370 (37%), Gaps = 25/370 (6%)

Query: 609 PRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLS 668
           P L   +    LW K++D    ++ +  I +        A    +M   +  Q++ D+L 
Sbjct: 558 PMLLLSDGVSRLWYKKDDR--FWQPRGYIYLSFKLPHTHASIINSMLSTLYIQMVNDALK 615

Query: 669 TVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAM 728
            + Y ++  G     + + +G   L  T SG+ E +  ++   +    S          +
Sbjct: 616 DLQYDADCAGLRISFNKTNQG---LDITASGYNEKLIILLTRFLQGVISFEPKKNRFEIL 672

Query: 729 FRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSG 788
             K    ++N   E                ++ E  W   ++L   E++  E    F   
Sbjct: 673 KDKTIRHLKNLLYEVPYSQMSNYYNS----LINERSWSTAEKLQVFEKLSYEQLINFIPT 728

Query: 789 FISKPTYLNVFSQGDLSYTE--EISTFLDSGLTSHLSRRTWHEPAVREPVTHALKPGTNM 846
            I +  +      G++   E  E+ + + S +T +++        +R      L P    
Sbjct: 729 -IYEGAFFETLIHGNIKREEAMEVDSLIKSMITVNINNLQVSNNRLRS----YLLPKGKS 783

Query: 847 FIRRSAFVEDPS-SSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVF 905
           F   +A  +  + +S +  +   D    ++ +L+ L   L+       LRTK+Q+GY VF
Sbjct: 784 FRYETALKDSLNVNSCIQHVTQLDVYSEELSALSGLFTQLIHEPCFDTLRTKEQLGYVVF 843

Query: 906 SGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQER-------Y 958
           S       T  + I   S     +LE +I  +        L  M +E+F++         
Sbjct: 844 SSSLNNHGTANIRILIQSEHTTPYLEWRITNFYETFGQ-TLKDMKQEDFEKHKEALCNSL 902

Query: 959 IRKFRAMFER 968
           ++KF+ M E 
Sbjct: 903 LQKFKNMGEE 912

>CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389c STE23
          Length = 1008

 Score =  142 bits (359), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 99/340 (29%), Positives = 160/340 (47%), Gaps = 48/340 (14%)

Query: 62  PDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASND 121
           P+ + GLAH CEH +L  GS+KFP  + Y   ++++GGS NAYT  +NT ++FE+ A + 
Sbjct: 99  PENLPGLAHFCEH-LLFMGSEKFPDENEYSSYLSKHGGSSNAYTGSQNTNYFFEVNADHL 157

Query: 122 SGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPR 181
            G       LD  +  F  P+F+ +S +KEI A++SE+  N  +   ++Y   + L+N  
Sbjct: 158 HG------ALDRFSGFFSCPLFNQNSTDKEINAVDSENKKNLQNDIWRMYQLDKSLSNQD 211

Query: 182 HPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAK 241
           HP+ +F TGN  TL D+P    ++++  L +++  NY A  M LC+ G + L+ L++ A 
Sbjct: 212 HPYHKFSTGNLETLGDKPKAAGLDIREELLKFYNENYSANLMKLCILGKEDLDTLSEWAW 271

Query: 242 KYFGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVPDTSNLV 301
           + F D+                                 KNS +   V DA +   ++L 
Sbjct: 272 ELFKDV---------------------------------KNSDRALPVYDAPILKENDLK 298

Query: 302 AIQSSKNPV----LRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNL 357
            I   K       L + F V     +  +     +S  +    G EG GSL   LK+   
Sbjct: 299 KIIKVKPVKDLRKLDISFVVPDYEKKWEA----KISHIFSHLIGHEGSGSLLAHLKSLGW 354

Query: 358 INGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLF 397
            N + A     S GN    ++  LTN G    + I+ ++F
Sbjct: 355 ANELGAGGHTVSDGNAFFNVDIELTNEGLKHYKDIVVLIF 394

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 73/373 (19%), Positives = 144/373 (38%), Gaps = 30/373 (8%)

Query: 609 PRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLS 668
           P L   +   +LW K++D    ++ +  I + +      +    +M   +  Q++ D+L 
Sbjct: 548 PLLLKDDDVSKLWYKKDDR--FWQPRGYIYVTLKLPNTHSSIISSMLTTLYVQMVNDALK 605

Query: 669 TVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAM 728
            + Y +           + +G   L  TISGF E +  +++  ++  +            
Sbjct: 606 DLQYDAACANINLSFVKTNQG---LDITISGFNEKLLILLKRFVEGVQGFEPKKERFEVF 662

Query: 729 FRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSG 788
             K    ++N+  E                V+ E  WP +++L+  E++  E    F   
Sbjct: 663 KDKTVHHLKNQMMEVPYSQISGLYNS----VVNERTWPTKEKLEVAEKLKFEQLDNFVRA 718

Query: 789 FISKPTYLNVFSQGDLSYTEE------ISTFLDSGLTSHLSRRTWHEPAVREPVTHALKP 842
            I    Y   F  G+L   E       +STFL      ++  ++          ++ +  
Sbjct: 719 -IYDGMYYESFVHGNLESKEAREVDSLVSTFLKKDDIKNIDVQS------NRLRSYIIPK 771

Query: 843 GTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGY 902
           G +       + E+  +S +  +   D  + ++ +L+ L   ++       LRTK+Q+GY
Sbjct: 772 GKSYAYETDLYDENNVNSCIQHVVQLDVYNEKLSALSGLFAQMLHEPCFDILRTKEQLGY 831

Query: 903 AVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQER----- 957
            VFS       T  + I   S     +LE +ID++      + L  M EE+F +      
Sbjct: 832 VVFSSSLNNHGTANIRILVQSEHTTPYLEWRIDEFYKTF-GEKLRNMDEEDFNKHKEALC 890

Query: 958 --YIRKFRAMFER 968
              ++KF+ M E 
Sbjct: 891 KTLLQKFKNMKEE 903

>NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {ON}
           Anc_4.246
          Length = 999

 Score =  141 bits (356), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 130/496 (26%), Positives = 222/496 (44%), Gaps = 58/496 (11%)

Query: 23  NKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLGLAHLCEHTILSAGSK 82
           ++      L N +  LLI                     P+ + GLAH CEH +L  GS+
Sbjct: 49  DRSYRFIELPNKLKALLISDPTTDKAAASLDVNIGAFEDPESLPGLAHFCEH-LLFMGSE 107

Query: 83  KFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLFDKVLDTLASSFKNPV 142
           KFP  + Y   ++++GG  NAYT  +NT ++FE+   +  G       LD  +  F  P+
Sbjct: 108 KFPDENDYSSFLSKHGGHSNAYTGSQNTNYFFEINYEHLKG------ALDRFSGFFSCPL 161

Query: 143 FSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTGNFATLCDEPNLH 202
           F+  S +KEI A++SE+  N  S   ++Y   + L+   HP+ +F TGN  TL   P   
Sbjct: 162 FNIGSTDKEINAVDSENKKNLQSDMWRIYQLDKSLSLLDHPYHKFSTGNLETLKIIPESK 221

Query: 203 KVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLPASRDRDPTRPPLKK 262
            VNV+  L +++  NY A  M LC+ G + L+ L+   + +F D+   ++ D   P    
Sbjct: 222 NVNVRDELLKFYNANYSANLMKLCIIGREDLDTLSDYVQSFFKDV---KNIDKELPFY-- 276

Query: 263 RPSSGVASQDLHVRPLDFKNSKQQTQVQDAF-VPDTSNLVAIQSSKNPVLRLVFPVSHKS 321
              S + + D   + +  +  K+  +++ +F VPD         SK P +     +SH  
Sbjct: 277 --DSKILNDDQLTKIVSVEPVKELRKLEVSFVVPDYE---THWESKIPHI-----LSH-- 324

Query: 322 TRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTL 381
                              G EG GSL   LKT    N + A     S GN   +++  L
Sbjct: 325 -----------------LIGHEGNGSLLSHLKTLGWANELSAGGHTVSRGNAFFSIDIDL 367

Query: 382 TNLGWSSAQLIITVLFDLF------IP-RLIHDKTKDIA----KCLSELNCTDLLTFLYQ 430
           T  G  + + +I + F         +P + I+ + ++IA    K   + N +  ++ L +
Sbjct: 368 TENGLKNYEQVILLAFQYIEMLKNSLPQKWIYLELQNIANANFKFKQKGNPSSTVSSLSK 427

Query: 431 GAEKSSMEMCAVLSSRLLSVFETLDPKCLLKG-SPLIECNQNPSAIGDYSESTESRTWWI 489
             EK  + +  +LS+ L + +E   P+ + K  S +I  N   + I    E T+S+  W 
Sbjct: 428 LLEKEYIPVGNILSTGLFNKYE---PELVEKYLSEMIYSNSRITLISKNLE-TDSKEKWY 483

Query: 490 GRAIKFQNFVSEFVNR 505
           G   K +++  + +N+
Sbjct: 484 GTKYKLEDYSVDLINK 499

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 87/420 (20%), Positives = 168/420 (40%), Gaps = 31/420 (7%)

Query: 609  PRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLS 668
            P L    S  +LW K++D    ++ +  I I        +    +M   +  Q++ DSL 
Sbjct: 539  PLLLKDTSMGKLWYKKDDR--FWQPRGYIKISFKLPHTHSTLLNSMLTTLYVQMVNDSLK 596

Query: 669  TVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAM 728
             + Y +        +S + +G   L  ++SGF + +  ++   +   K        T   
Sbjct: 597  DLQYDASCANLHVSLSKTNQG---LDISLSGFNDKLIILLTRFLQGIKDF----KPTSER 649

Query: 729  FRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSG 788
            F+  +       +                 ++ E  W  E++L+ + ++ ++   +F   
Sbjct: 650  FQIFKDKTIQHLKNSMYEVPYSQMSSLYNALINEKTWLPEEKLNMMNKLTLDQLNSFIP- 708

Query: 789  FISKPTYLNVFSQGDLSYTE--EISTFLDSGLTS--HLSRRTWHEPAVREPVTHALKPGT 844
            FI    +   F  G+L Y E  EI + +D  ++S  +L+   +    +R      L P  
Sbjct: 709  FIFDELFFECFVHGNLKYDEAIEIESLIDLLMSSKENLTNSQYENEKLRS----YLLPKN 764

Query: 845  NMFIRRSAFVEDP---SSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIG 901
              + R    ++D    +S I + IQ  D    ++ ++  L   ++       LRTK+Q+G
Sbjct: 765  KTY-RYETLLKDRKNVNSCIQHVIQV-DIYSEELSAICGLFAQMLHEPCFDTLRTKEQLG 822

Query: 902  YAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQER---- 957
            Y VFS       T  + I   S     +LE +ID++      D+L+ MS+E+F +     
Sbjct: 823  YVVFSSTLNNHGTANIRILVQSEKSTPYLEWRIDEFYKKF-GDLLNGMSDEDFTKHKDAL 881

Query: 958  ---YIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQIS 1014
                 +KF+ M E     S++   G  + + +++       L +Q       K I N+ S
Sbjct: 882  CKSLTQKFKNMNEESIRYSSAIYLGDYNFMHRVKKAKLVEELTKQQIIEFYEKYIMNEDS 941

>KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa]
           {ON} Anc_4.246 YLR389C
          Length = 996

 Score =  140 bits (353), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 117/443 (26%), Positives = 200/443 (45%), Gaps = 55/443 (12%)

Query: 23  NKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLGLAHLCEHTILSAGSK 82
           ++     +L N +  LLI                     P+E+ GLAH CEH +L  GS 
Sbjct: 44  DRSYRYVQLPNNLKALLISDPTTDKAAAALDVNIGAFEDPEELPGLAHFCEH-LLFMGSS 102

Query: 83  KFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLFDKVLDTLASSFKNPV 142
           KFP  + Y   ++++GGS NAYT  +NT +YF++   +  G       LD  +  F  P+
Sbjct: 103 KFPNENEYSSYLSKHGGSSNAYTGAQNTNYYFQVNYEHLYG------ALDRFSGFFTGPL 156

Query: 143 FSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTGNFATLCDEPNLH 202
           F+  S +KEI A++SE+  N  +   +LY   + L N  HP+ +F TGN  TL   P   
Sbjct: 157 FNKESTDKEINAVDSENKKNLQNDLWRLYQLDKSLTNGGHPYHKFSTGNLETLGTTPKEL 216

Query: 203 KVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLPASRDRDPTRPPLKK 262
            ++++  L +++  +Y A  M LC+ G + L+ + K  ++ F D+   +  D   P    
Sbjct: 217 GLDIRDELLKFYNKSYSANLMKLCILGREDLDTMTKWVEELFQDV---KTLDRALPEYNT 273

Query: 263 RPSSGVASQD-LHVRPLDFKNSKQQTQVQDAF-VPDTSNLVAIQSSKNPVLRLVFPVSHK 320
           R       Q+ + V P+     K+  +V+ +F VPD         SK P +     +SH 
Sbjct: 274 RILDADHLQEIIKVHPV-----KELKKVEVSFVVPDVDEH---WESKPPHI-----LSH- 319

Query: 321 STRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFT 380
                               G EG GSL   LKT    N + A     S GN   +++  
Sbjct: 320 ------------------LIGHEGTGSLLAYLKTKGWANELSAGGHTVSKGNAFFSVDID 361

Query: 381 LTNLGWSSAQLIITVLFDLF------IPR-LIHDKTKDIA----KCLSELNCTDLLTFLY 429
           LT+ G +  + ++  +F         +P+  +  + ++IA    K   + + ++ ++ L 
Sbjct: 362 LTDDGLAHYEEVVHNVFQYIKMLQNCLPQNWVFHELQEIAQANFKFEQKGSPSNTVSTLA 421

Query: 430 QGAEKSSMEMCAVLSSRLLSVFE 452
           +  EK  + +  +LS+ LL+ +E
Sbjct: 422 KALEKEYIPVNRILSNGLLTKYE 444

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 76/350 (21%), Positives = 141/350 (40%), Gaps = 20/350 (5%)

Query: 609 PRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLS 668
           P L  +N   ++W K++D    ++ +  I +        A    +M   +  QL+ DSL 
Sbjct: 536 PLLISENETGKVWFKKDDR--FWQPRGYIYLTFKLPHTHASALNSMLSTLYVQLINDSLK 593

Query: 669 TVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAM 728
            + Y +           + +G   L  T+ GF + +  ++  +++  KS      +    
Sbjct: 594 DLQYNANCANLRASFVKTNQG---LDLTLYGFNDKLIILLTRLLEGIKSF----KLEQPQ 646

Query: 729 FRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSG 788
           F+  +       +                 ++ E  W VE++LD +E+I  E    F   
Sbjct: 647 FKIFKDKSVQHLKNLMYEVPYSQISTVYNYLINERSWSVEEKLDVMEKITYEELINFIPT 706

Query: 789 FISKPTYLNVFSQGDLSYTE--EISTFLDSGLTSHLSRRTWHEPAVREPVTHALKPGTNM 846
            I +  Y      G+L Y E  EI++ +     S ++R       +R      L P    
Sbjct: 707 -IFEELYFEALIHGNLKYEEAMEIASLVKILQPSDVTRLQTKNSRMRS----YLIPRGET 761

Query: 847 FIRRSAFVEDPSS--SIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAV 904
           + R    ++D  +  S + ++   D  D ++ + + L   ++       LRTK+Q+GY V
Sbjct: 762 Y-RYETKLKDAKNVNSCIQYVTQLDVYDEKLSAKSGLFAQMIHEPCFDTLRTKEQLGYVV 820

Query: 905 FSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEF 954
           FS       T  + I   S     +LE +ID +      ++L+AMSEE+F
Sbjct: 821 FSSSLNNHGTANMRILIQSEHTTPYLEFRIDTFYQKF-GELLNAMSEEDF 869

>KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON}
           Anc_4.246 YLR389C
          Length = 1011

 Score =  140 bits (352), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 109/397 (27%), Positives = 182/397 (45%), Gaps = 43/397 (10%)

Query: 2   SGMSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXX 61
           + M  + + F + F  P    ++     +L N +  L+I                     
Sbjct: 41  TNMHHSYKDFKLNFIKP-DLDDRSYRFIKLPNNLKALVIQDPTADKAAAALDVNIGAFED 99

Query: 62  PDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASND 121
           P+ + GLAH CEH +L  GS+KFP  + Y   ++++GGS NAYT+  NT +YFE+     
Sbjct: 100 PEHLPGLAHFCEH-LLFMGSEKFPDENEYSSFLSKHGGSSNAYTSSLNTNYYFEV----- 153

Query: 122 SGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPR 181
           + E L++  LD  +  F  P+F+  S +KEI A++SE+  N  +   ++Y   + L+N +
Sbjct: 154 NHEHLYN-ALDRFSGFFTCPLFNKGSTDKEISAVDSENKKNLQNDVWRIYQLDKSLSNLQ 212

Query: 182 HPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAK 241
           HP+ +F TGN  TL + P    +N++  L +++  +Y A  M LC+ G + L+ L+  A 
Sbjct: 213 HPYHKFSTGNLITLGENPKSLNLNIRDELLKFYYHSYSANLMKLCIIGREDLDTLSNWAY 272

Query: 242 KYFGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAF-VPDTSNL 300
           K F D+   R+ +   P      SS + ++    + +  K  K+  +++ +F VPD    
Sbjct: 273 KLFKDV---RNTNRALPEY----SSKILNETHLQKIIQVKPVKELRKLEISFMVPDMDRH 325

Query: 301 VAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLING 360
                SK P L     +SH                     G EG GSL   LK     N 
Sbjct: 326 ---WQSKPPHL-----LSH-------------------LIGHEGSGSLLAYLKAKGWANE 358

Query: 361 VVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLF 397
           + A     S  N   +++  LT  G  S + ++  +F
Sbjct: 359 LSAGGHTVSKDNAFFSIDVELTKDGLESYKEVVHSIF 395

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 90/460 (19%), Positives = 176/460 (38%), Gaps = 48/460 (10%)

Query: 619  ELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLG 678
            +LW K++D    ++ +  I + +      A    +M   +  QL  D L  + Y +    
Sbjct: 558  KLWFKKDDR--FWQPRGYIYVSLKLPHTHASVLNSMLSTIYVQLANDFLKDLQYDASCAN 615

Query: 679  YTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAMFRKARVAVRN 738
                   + +G   L  T+SGF + +  ++   +   K    ++        K    ++N
Sbjct: 616  LNLSFVKTNQG---LDITLSGFNDKLVTLMTRFLQGVKDFKPTEERFKIFKDKTTQHLKN 672

Query: 739  KYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNV 798
               E                ++ E  W VE++L+ +E I  E    F    + +  Y   
Sbjct: 673  LLYEVPYSQISGVYNS----LINERSWSVEEKLNVVEHITFEQLLAFIPT-VFEELYYET 727

Query: 799  FSQGDLSYTE--EISTFLDSGLTSHLSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVED 856
               G+L + E  EI + ++  L ++ +         R       K  T  F +     ++
Sbjct: 728  LVHGNLKFEEAIEIESLINDILITNENHNNLQVKNNRLRSYFIPKGKTYRFEKELKDSKN 787

Query: 857  PSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMG 916
             +S I +  Q  D  + ++ +L+ L   ++       LRTK+Q+GY VFS       T  
Sbjct: 788  VNSCIQHVTQL-DVYNEELSALSGLFAQMIHEPCFDTLRTKEQLGYVVFSSSLNNHGTAN 846

Query: 917  LHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSD 976
            + I   S     +LE +I+++ +     +L  MSEE+F +      +++ ++        
Sbjct: 847  IRILVQSEHTTPYLEWRIEEFYSKFG-AILKDMSEEDFDKHKDALCKSLLQK-------- 897

Query: 977  AAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALT 1036
                              N+ E+ +      R    I +  YNFT   + A   L++AL+
Sbjct: 898  ----------------YKNMGEESS------RYTAAIYLGDYNFTHRQKKA--RLVKALS 933

Query: 1037 LGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIAEKRL 1076
              Q   F+     I     ++L + + S V + ++ E+ L
Sbjct: 934  KEQLIEFYDN--YIVGENAARLVIHLKSAVVSSDLREEEL 971

>YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}
           STE23Metalloprotease involved, with homolog Axl1p, in
           N-terminal processing of pro-a-factor to the mature
           form; expressed in both haploids and diploids; member of
           the insulin-degrading enzyme family
          Length = 1027

 Score =  139 bits (350), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 138/564 (24%), Positives = 241/564 (42%), Gaps = 72/564 (12%)

Query: 3   GMSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXP 62
            M+   + F++ F  P     +      L N +  LLI                     P
Sbjct: 52  NMTSNFKTFNLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDP 110

Query: 63  DEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDS 122
             + GLAH CEH +L  GS+KFP  + Y   ++++GGS NAYT  +NT ++FE+   +  
Sbjct: 111 KNLPGLAHFCEH-LLFMGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEVNHQHLF 169

Query: 123 GELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRH 182
           G       LD  +  F  P+F+  S +KEI A+ SE+  N  +   ++Y   + L N +H
Sbjct: 170 G------ALDRFSGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKH 223

Query: 183 PFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKK 242
           P+ +F TGN  TL   P  + +NV+  L ++ K  Y A  M LC+ G + L+ L+     
Sbjct: 224 PYHKFSTGNIETLGTLPKENGLNVRDELLKFHKNFYSANLMKLCILGREDLDTLSDWTYD 283

Query: 243 YFGDLPASRDRDPTRPPLKKRP--SSGVASQDLHVRPLDFKNSKQQTQVQDAF-VPDTSN 299
            F D+ A+  R+    PL   P        + + VRP+     K   +++ +F VPD   
Sbjct: 284 LFKDV-ANNGRE---VPLYAEPIMQPEHLQKIIQVRPV-----KDLKKLEISFTVPD--- 331

Query: 300 LVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLIN 359
           +     SK P +     +SH                     G EG GSL   LK     N
Sbjct: 332 MEEHWESKPPRI-----LSH-------------------LIGHEGSGSLLAHLKKLGWAN 367

Query: 360 GVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLF------IP-RLIHDKTKDI 412
            + A     S GN    ++  LT+ G +  + +I ++F         +P + I ++ +DI
Sbjct: 368 ELSAGGHTVSKGNAFFAVDIDLTDNGLTHYRDVIVLIFQYIEMLKNSLPQKWIFNELQDI 427

Query: 413 AKCLSEL----NCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIEC 468
           +    +     + +  ++ L +  EK  + +  +L+  LL+ +E   P  L + +  +  
Sbjct: 428 SNATFKFKQAGSPSSTVSSLAKCLEKDYIPVSRILAMGLLTKYE---PDLLTQYTDALVP 484

Query: 469 NQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSV 528
             +   +   S  T+S   W G A K  ++ ++ +              KS  L+   ++
Sbjct: 485 ENSRVTLISRSLETDSAEKWYGTAYKVVDYPADLIKNM-----------KSPGLNPALTL 533

Query: 529 SKTDAYYEFTYQISKIDMLSVREE 552
            + + +    +++ KID +   +E
Sbjct: 534 PRPNEFVSTNFKVDKIDGIKPLDE 557

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 99/463 (21%), Positives = 172/463 (37%), Gaps = 56/463 (12%)

Query: 619  ELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLG 678
            +LW K++D    ++ +  I +        A    +M   +  QL  D+L  V Y +    
Sbjct: 568  KLWYKKDDR--FWQPRGYIYLSFKLPHTHASIINSMLSTLYTQLANDALKDVQYDAACAD 625

Query: 679  YTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAM--FRKARVAV 736
                 + + +G   L+ T SGF E      ++II  T+ L   ++  P    F   +   
Sbjct: 626  LRISFNKTNQG---LAITASGFNE------KLIILLTRFLQGVNSFEPKKDRFEILKDKT 676

Query: 737  RNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYL 796
                +                 ++ E  W   ++L   E++  E    F    I +  Y 
Sbjct: 677  IRHLKNLLYEVPYSQMSNYYNAIINERSWSTAEKLQVFEKLTFEQLINFIPT-IYEGVYF 735

Query: 797  NVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVED 856
                 G++ + E +   +DS + S +     +       +   L P    F   +A  + 
Sbjct: 736  ETLIHGNIKHEEALE--VDSLIKSLIPNNIHNLQVSNNRLRSYLLPKGKTFRYETALKD- 792

Query: 857  PSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVP---DLRTKKQIGYAVFSGLRLLST 913
             S ++   IQ   + D     L+ L+     +   P    LRTK+Q+GY VFS       
Sbjct: 793  -SQNVNSCIQHVTQLDVYSEDLSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNNHG 851

Query: 914  TMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTS 973
            T  + I   S     +LE +I+ +       VL  M EE+F++           +E + +
Sbjct: 852  TANIRILIQSEHTTPYLEWRINNFYETFGQ-VLRDMPEEDFEKH----------KEALCN 900

Query: 974  TSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRYNFTSDLEPADLGLLR 1033
            +        LL + +      N+ E+ A      R    I +  YNFT   + A   L+ 
Sbjct: 901  S--------LLQKFK------NMAEESA------RYTAAIYLGDYNFTHRQKKA--KLVA 938

Query: 1034 ALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIAEKRL 1076
             +T  Q   F++    I S   SKL + + S V   E+ E  L
Sbjct: 939  NITKQQMIDFYEN--YIMSENASKLILHLKSQVENKELNENEL 979

>Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar to
           Ashbya gossypii AER053C
          Length = 1023

 Score =  139 bits (349), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/226 (33%), Positives = 118/226 (52%), Gaps = 7/226 (3%)

Query: 23  NKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLGLAHLCEHTILSAGSK 82
           ++     +L N + V LI                     P+++ GLAH CEH +L  GS+
Sbjct: 77  DRNYRYIQLPNRLKVFLIQDKSTDKAAAALDVNVGFFQDPEDLPGLAHFCEH-LLFMGSE 135

Query: 83  KFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLFDKVLDTLASSFKNPV 142
           KFP  + Y   ++ +GG+ NAYT+ +NT +YF +   N     L+D  LD  +  F +P+
Sbjct: 136 KFPNENEYSSYLSHHGGASNAYTSTQNTNYYFMVNHGN-----LYD-ALDRFSGFFTSPL 189

Query: 143 FSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTGNFATLCDEPNLH 202
           FS SS NKE+ A++SE+  N  S   ++    R L NP HPF +F TGN+ TL  EP   
Sbjct: 190 FSVSSTNKEVNAVDSENKKNLQSDLWRMQQLDRSLTNPGHPFHKFSTGNYQTLYKEPKSR 249

Query: 203 KVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLP 248
            + ++  L +++   Y A  M L + G + L+ L+  A + F D+P
Sbjct: 250 GIEIREELLKFYDKTYSANLMRLVILGMEDLDTLSAWAYELFKDVP 295

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 69/356 (19%), Positives = 142/356 (39%), Gaps = 21/356 (5%)

Query: 620 LWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGY 679
           LW K++D     +    +S ++         S  M   +  +++ DSL  +LY +E   +
Sbjct: 575 LWYKKDDRFWVPEGHVYVSFKLPHSYSSVVNS--MLSTLYVEMVKDSLKDLLYNAECANF 632

Query: 680 TYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAMFRKARVAVRNK 739
                 + +G   L  +++G+ + +  ++  I++  +   N D          ++  +  
Sbjct: 633 EVSFVKTNQG---LDLSLTGYNDKMTLLLTSILEGIR---NFDPKKERFDVLQKLLCQKL 686

Query: 740 YEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVF 799
           Y                 ++ +   W   ++L   +++  E F+ F    I +  Y    
Sbjct: 687 YNRLYNVPYSQIGVLYNSLINDRS-WTPSEKLKVTKQLTFEHFKAFVPS-IYEQMYFETL 744

Query: 800 SQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVR-EPVTHALKPGTNMFIRRSAFVEDPS 858
             G+    + I   L+S + S +  +  H  A    P ++ L  G       + F E+  
Sbjct: 745 VHGNFPENQAIE--LNSYICSLIPNQIKHSGARNNRPRSYMLPEGKTYRYETTLFDEENV 802

Query: 859 SSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLH 918
           +S    +         M +   L   L++      LRT++Q+GY V+S  +    +  L 
Sbjct: 803 NSCFEMVIQLGMYSEDMNAKGSLLAQLINEPCFNTLRTEEQLGYVVWSSKQNTHASTNLR 862

Query: 919 ITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQER-------YIRKFRAMFE 967
           I   S S   ++ES++D++L     D L +MSE+ F++         ++KF+ M E
Sbjct: 863 ILVQSESDTVYIESRVDKFLNNFA-DTLRSMSEQAFEKHKGALCNTLLQKFKNMRE 917

>Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON}
           (216511..219573) [3063 nt, 1021 aa]
          Length = 1020

 Score =  138 bits (348), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 123/516 (23%), Positives = 221/516 (42%), Gaps = 65/516 (12%)

Query: 1   MSGMSDAVQH----FDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXX 56
           MS  SD  +      D+ F  P    ++      L N    LLI                
Sbjct: 47  MSTTSDVTKKPYKIHDLNFIKP-DLDDRSYRFIELPNKFKALLIHDASTDKSAASLDVNI 105

Query: 57  XXXXXPDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFEL 116
                P  + GLAH CEH +L  GSKKFP  + Y   + ++GGS NAYT  +NT ++FE+
Sbjct: 106 GAFQDPKNLQGLAHFCEH-LLFMGSKKFPNENEYSSYLNKHGGSSNAYTGAQNTNYFFEI 164

Query: 117 PASNDSGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRL 176
              +  G       LD  +  F  P+F+ +S +KEI A++SE+  N  +   ++Y   + 
Sbjct: 165 NHEHLHG------ALDRFSGFFTCPLFNPNSTSKEINAVDSENKKNLQNDVWRMYQLDKS 218

Query: 177 LANPRHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNAL 236
           L+N +HP+ +F TGN  TL + P    ++++  L +++  +Y A  M LC+ G + L+ +
Sbjct: 219 LSNEKHPYHKFSTGNLKTLDEMPKKEGLDIRNELLKFYSDSYSANLMKLCVLGREDLDTM 278

Query: 237 AKLAKKYFGDLPASRDRDP--TRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFV 294
           +      F  +P +    P    P L +     +    +HV+P+     K   +++  F+
Sbjct: 279 SDWVYNLFEAVPNNNRPLPEYNEPILLEENLKKI----IHVKPV-----KDLKKLEITFL 329

Query: 295 PDTSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKT 354
               +L      ++ +  L+                          G EG GS+   LKT
Sbjct: 330 AQDMDLFWESKPQHILSHLI--------------------------GHEGSGSILSHLKT 363

Query: 355 NNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRL--------IH 406
            +  N + A     S  N   +++  LT  G+   + I+ ++F  +I  L        I 
Sbjct: 364 LSWANELSAGGHTVSKDNAFFSIDIDLTENGFQHYKEIVHIVFQ-YIEMLKISLPQERIF 422

Query: 407 DKTKDIA----KCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKG 462
            + +DIA    K   ++N +  ++ L +  EK  + +  +LS+ L   F   DP+ +   
Sbjct: 423 LELQDIANASFKFKQKVNPSSTVSNLSKALEKEYIPVENILSTGL---FRKYDPEIMKNY 479

Query: 463 SPLIECNQNPSAIGDYSESTESRTWWIGRAIKFQNF 498
              +  + +   +   +  T+S+  W G   + +++
Sbjct: 480 VNSLSPDNSRITLAGKAVETDSKETWYGTDYRVEDY 515

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 95/464 (20%), Positives = 189/464 (40%), Gaps = 56/464 (12%)

Query: 619  ELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLG 678
            +LW K++D    ++ +  I I +     +A     +   +  QL+ DSL  + Y +    
Sbjct: 569  KLWYKKDDR--FWQPRGFIYITMKLPHTQASVINNLLTSLYVQLVNDSLKDLQYDAACAN 626

Query: 679  YTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAMFRKARVA-VR 737
                 S + +G   L  TISGF + +  +++  I    S+     +   +F++  +  ++
Sbjct: 627  LHLSFSKTNQG---LDITISGFNDKLIVLLQRFIYGV-SVYQPSKLRFKIFKEKTIQNLK 682

Query: 738  NKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLN 797
            N   E                ++ E  W V+ +L  +E+I  E F  F    I +  Y +
Sbjct: 683  NCLYEVPYSQISTLYSS----LINERTWSVKQKLSIIEKITYEQFLAFLPT-IYEECYFD 737

Query: 798  VFSQGDLSYTE--EISTFLDSGLTSHLSRRTWHEPAVREPVTHALKPG-TNMFIRRSAFV 854
                G+    E  EI + + S +T+ +         +R   ++ +  G T  F       
Sbjct: 738  GLVHGNFRNEEAVEIDSLVQSLITTDIVNLHVKNTRLR---SYVIPNGETYRFEIDLEDA 794

Query: 855  EDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTT 914
            E+ +S + + +Q G   + ++ +++ L   +++      LRTK+Q+GY VFS       T
Sbjct: 795  ENVNSCVQHVVQLGGYSE-ELSAMSGLFAQILNEPCFDTLRTKEQLGYVVFSSSLNNHGT 853

Query: 915  MGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTST 974
              + I   S     +LE +ID++      + L  MS++E ++      +++ ++      
Sbjct: 854  ANIRILVQSEHSTPYLEWRIDEFYKSF-GETLRNMSDDELEKHKDALCKSLMQK------ 906

Query: 975  SDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRYNFTSDLEPADLGLLRA 1034
                                N+ E+ +      R    I +  YNFT   + A+  L+  
Sbjct: 907  ------------------YKNMKEENS------RYTAAIYLGDYNFTHRQKKAN--LVAQ 940

Query: 1035 LTLGQFRRFFQEKISICSTTRSKLSVMVASPV--SADEIAEKRL 1076
            ++  Q  +FF++     S   +KL + + S V  S  +I E +L
Sbjct: 941  ISKDQLIKFFED--HFISANAAKLVIHLKSKVKSSDKDINEDKL 982

>Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa]
           {ON} YLR389C (REAL)
          Length = 1025

 Score =  136 bits (343), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 128/504 (25%), Positives = 227/504 (45%), Gaps = 69/504 (13%)

Query: 62  PDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASND 121
           P+++ GLAH CEH +L  GS+KFP  + Y   ++++GGS NAYT  +NT ++FE+     
Sbjct: 110 PEKLPGLAHFCEH-LLFMGSEKFPDENEYSSFLSKHGGSSNAYTASQNTNYFFEV----- 163

Query: 122 SGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPR 181
           + + LFD  LD  +  F  P+F+  S +KEI A+ SE+  N  +   ++Y   + L N +
Sbjct: 164 NHQHLFD-ALDRFSGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTK 222

Query: 182 HPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAK 241
           HP+ +F TGN  TL   P  + +N++  L ++ K  Y A  M LC+ G + L+ L+    
Sbjct: 223 HPYHKFSTGNIETLGTSPKENGLNIRDELLKFHKDFYSANLMKLCILGREDLDTLSDWVY 282

Query: 242 KYFGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAF-VPDTSNL 300
             F ++  +    P       +P      + + VRP+     K   +++ +F VPD   +
Sbjct: 283 DLFKNVSNNGREVPYYAEPIMQPEH--LQKIIQVRPV-----KDLKKLEISFAVPD---M 332

Query: 301 VAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLING 360
                S+ P +     +SH                     G EG GSL   LK     N 
Sbjct: 333 EEHWESRPPRI-----LSH-------------------LIGHEGSGSLLAHLKKLGWANE 368

Query: 361 VVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLF------IP-RLIHDKTKDIA 413
           + A     S GN    ++  LT+ G    + +I ++F         +P + I ++ +DI+
Sbjct: 369 LSAGGHTVSKGNAFFAVDIDLTDNGLIHYRDVIILIFQYIEMLKNSLPQKWIFNELQDIS 428

Query: 414 KCLSELNC----TDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLK-GSPLIEC 468
               +       +  ++ L +  EK  + +  +L+  LL+ +E   P  L +    L+  
Sbjct: 429 NATFKFKQVGRPSSTVSSLAKCLEKDYIPVDRILAMSLLTKYE---PDLLTQYMDALVTE 485

Query: 469 NQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSV 528
           N   + I    E+  S  W+ G A K  ++ S+ +              KS  L+   ++
Sbjct: 486 NSRVTLISRTLETDSSEKWY-GTAYKVLDYPSDLIRDM-----------KSPGLNPALTL 533

Query: 529 SKTDAYYEFTYQISKIDMLSVREE 552
            + + +    +++ KID +   +E
Sbjct: 534 PRPNEFVSTNFKVDKIDGIKPLDE 557

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 94/471 (19%), Positives = 179/471 (38%), Gaps = 52/471 (11%)

Query: 609  PRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLS 668
            P L   +    LW K++D    ++ +  I +        A    +M   +  QL+ D+L 
Sbjct: 558  PILLLSDGGSRLWYKKDDR--FWQPRGYIYLSFKLPHTHASIVNSMLSTLYIQLVNDALK 615

Query: 669  TVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAM 728
             + Y +         S + +G   L  T SGF E +  ++   +    S          +
Sbjct: 616  DLQYDAACADLRISFSKTNQG---LDITASGFNEKLIILLTRFLQGVTSFEPKKDRFEIL 672

Query: 729  FRKARVAVRNKYEEXXXXXXXXXXXXXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSG 788
              K    ++N   E                ++ E  W   ++L   E++  E    F   
Sbjct: 673  KDKTIRHLKNLLYEVPYSQMSNYYNA----LINERSWSTVEKLQVFEKLTFEQLINFIPT 728

Query: 789  FISKPTYLNVFSQGDLSYTE--EISTFLDSGLTSHLSRRTWHEPAVREPVTHALKPGTNM 846
             I +  +      G++ + E  E+ + + S +T++++        +R      L P    
Sbjct: 729  -IYEGVFFETLIHGNIKHEEAVEVDSLIKSLITNNINNLQVANNRLRS----YLLPKGKS 783

Query: 847  FIRRSAFVEDPS-SSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVF 905
            F   +A  +  + +S +  +   D    ++ +L+ L   L+       LRTK+Q+GY VF
Sbjct: 784  FRYETALKDSQNVNSCIQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVVF 843

Query: 906  SGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRAM 965
            S       T  + I   S     +LE +I+ +       +L  M++E+F++         
Sbjct: 844  SSSLNNHGTANIRILIQSEHTTPYLEWRINNFYETFGQ-ILRDMTKEDFEKH-------- 894

Query: 966  FERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRYNFTSDLE 1025
              +E + ++        LL + +      N+ E+ A      R    I +  YNFT   +
Sbjct: 895  --KEALCNS--------LLQKFK------NMAEESA------RYTAAIYLGDYNFTHRQK 932

Query: 1026 PADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIAEKRL 1076
             A+  L+  +T  Q   F+++   I     SKL + + S V   E+ E  L
Sbjct: 933  KAN--LVAKITKQQMIDFYEK--YIIGENTSKLIIHLKSQVENKELDENEL 979

>KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1004

 Score =  136 bits (343), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 120/247 (48%), Gaps = 8/247 (3%)

Query: 12  DVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLGLAHL 71
           D  F  P    ++     +L N +  LLI                     P+ + GLAH 
Sbjct: 49  DSEFLKP-DLDDRKYRYIQLPNNLKALLISDAEADKAAAALDVNIGSFQDPEHLPGLAHF 107

Query: 72  CEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLFDKVL 131
           CEH +L  G++K+P  + Y   ++++GGS NAYT  +NT +YF L   N          L
Sbjct: 108 CEH-LLFMGNEKYPDENDYSSFLSKHGGSSNAYTGSQNTNYYFHLNHEN------LYPAL 160

Query: 132 DTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTGN 191
           D  +  F  P+F+ +S +KEI A++SE+  N  +   ++Y   + L N  HP+ +F TGN
Sbjct: 161 DRFSGFFSCPLFNKASTDKEINAVDSENKKNLQNDIWRMYQLDKSLTNWEHPYHKFSTGN 220

Query: 192 FATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLPASR 251
             TL D P L  ++++  L  + K NY A  M LC+ G + L+ LA    + F D+P   
Sbjct: 221 IKTLGDIPKLKGIDIRNELLDFHKNNYSANLMKLCVLGREDLDTLADWVYELFKDVPNLN 280

Query: 252 DRDPTRP 258
            + P  P
Sbjct: 281 KQVPYYP 287

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 89/209 (42%), Gaps = 23/209 (11%)

Query: 759 VLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPT-YLNVFSQ----GDLS--YTEEIS 811
           ++ E  W  + +LD  +++  E  ++F       PT Y  +F +    G+ S     EI+
Sbjct: 687 LVNERSWTTKAKLDVTKDLTFEHLKSFV------PTIYEQLFHESLVLGNFSVEMAYEIN 740

Query: 812 TFLDSGLTSHLSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVEDPS---SSIVYFIQTG 868
             +D  +   +         +R  +     P  + F R    +ED +   S I Y IQ G
Sbjct: 741 QLVDILVVDRIPNLEVKNNKLRSYIL----PEESAF-RYEYMLEDKANVNSCIQYLIQLG 795

Query: 869 DRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPE 928
              + ++ +   L   L+       LRTK+Q+GY VFS +     T  L +   S     
Sbjct: 796 AYSE-ELAAKASLVSQLIHEPCFDTLRTKEQLGYIVFSAVANTHGTTNLRVLVQSERDSA 854

Query: 929 HLESQIDQYLAYMEHDVLSAMSEEEFQER 957
           ++ES+I ++L     + L  M EE F++ 
Sbjct: 855 YVESRIVKFLNSF-GEALKEMPEEAFEKH 882

>TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4.246
           YLR389C
          Length = 1041

 Score =  129 bits (325), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 121/244 (49%), Gaps = 8/244 (3%)

Query: 4   MSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPD 63
           MS++ +  +  F  P    ++     +L N +  LLI                     P+
Sbjct: 72  MSNSYKTLNSDFLKP-DLDDRSYRYIQLPNSLKALLISDPQTDKAAASIDVNVGAFEDPE 130

Query: 64  EVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSG 123
            + GLAH CEH +L  GS+KFP  + Y   ++++GG  NAYT   NT ++FE+   +  G
Sbjct: 131 NLPGLAHFCEH-LLFMGSEKFPDQNEYSSYLSKHGGHSNAYTAALNTNYFFEVNHEHLHG 189

Query: 124 ELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHP 183
                  LD  +  F  P+ +  S  KEI A++SE+  N  +   + Y   + ++N  HP
Sbjct: 190 ------ALDRFSGFFTGPLMNADSTEKEINAVDSENKKNLQNDDWRRYQMDKTISNYNHP 243

Query: 184 FSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKY 243
           + +F TGN  TL +EP    +N +  L +++ ++Y A  M LC+ G Q L+ L+  A ++
Sbjct: 244 YHKFSTGNIKTLMEEPTKLGLNTRNELLKFYNSSYSANIMKLCILGRQDLDTLSNWATEF 303

Query: 244 FGDL 247
           F D+
Sbjct: 304 FKDV 307

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 136/643 (21%), Positives = 243/643 (37%), Gaps = 100/643 (15%)

Query: 341 GDEGVGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLF 400
           G EG GS+   LK     N + A     S  N    +   LT+ G  + Q I  ++F  +
Sbjct: 368 GHEGSGSILSYLKKLGWANDLSAGAHTVSKDNAFFGINVDLTDKGLENYQEIALLIFQ-Y 426

Query: 401 IPRLIHDKTKDIAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLL 460
           I  L H   ++     SEL      +F ++  +KSS        S+LL   E ++P  +L
Sbjct: 427 IEMLKHSLPQEW--IFSELQDVSKSSFKFK--QKSSPSGTVSELSKLLEK-EYINPDLIL 481

Query: 461 KGSPLIECNQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSD 520
             + L +    P  I  Y +S                     +   N RI          
Sbjct: 482 STTLLRKYE--PEMIKQYVDS---------------------LTVDNSRIT--------- 509

Query: 521 LLSSVTSVSKTDAYYEFTYQI-----SKIDMLSVREELYRIPGFS--FRVPCYDMFLPTV 573
           L+S        + +Y   YQ+     S ID L+        PG +  F++P  + F+ T 
Sbjct: 510 LISKTVETDSKEKWYGTEYQVVDYPKSFIDQLNQ-------PGLNSEFKLPRRNEFVATN 562

Query: 574 GRKLGLIKQALQASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKS 633
                           +  T  L  +         P L   N   ++W K++D    ++ 
Sbjct: 563 FEV-------------KKPTDELVPLDE-------PHLILDNDISKVWYKKDDR--FWQP 600

Query: 634 KSIISIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARL 693
           +  I + +   + ++    ++   +    + D +  + Y +         S + +G   L
Sbjct: 601 RGYIYVSMKLPSCQSGIVNSLLNGLYVDQINDYMKDLQYDASCANLNLSFSSTNQG---L 657

Query: 694 SFTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAMFRKARVAVRNKYEEXXXXXXXXXXX 753
             TISGF + +  ++   I+  K    S+        KA   ++N   E           
Sbjct: 658 DITISGFNDKLLVLLSRFIEGVKLYQPSEERFNIFKNKAIQNLKNSLFEVPYSQMGTLYN 717

Query: 754 XXXXIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTE--EIS 811
                ++ E  WP++++LD LE +  + F +F    I    Y +    G++ Y E  E +
Sbjct: 718 T----IMNESTWPIKEKLDVLEALTFDQFVSFVPS-IYNEFYFDALVHGNIRYEEAMEAN 772

Query: 812 TFLDSGLTSHLSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVEDP---SSSIVYFIQTG 868
             L S  +  +         +R   ++ L  G +   R    +ED    +S I + +Q G
Sbjct: 773 DLLKSLASFKILNLHVRNSRLR---SYILPEGESY--RYEIDMEDKDNLNSCIQHVVQLG 827

Query: 869 DRDDAQMLSLTCLTEFLMSMTLVP---DLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSS 925
              +     L+ L+     M   P    LRTK+Q+GY VFS       T  + I   S  
Sbjct: 828 LYTE----ELSALSGLFAQMIREPCFDTLRTKEQLGYVVFSSNLNNHGTANMRILVQSEH 883

Query: 926 PPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRAMFER 968
              +LE +ID++      + L+ MSEE+F++     ++++ ++
Sbjct: 884 STSYLEWRIDEFYKKF-GESLNNMSEEDFEKHKDALYKSLTQK 925

>TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.376
           YLR163C
          Length = 469

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 87/226 (38%), Gaps = 17/226 (7%)

Query: 24  KGVELCRLANGILVLLIXXXXXXXXXXXXXXXXXXXXXPDEVLGLAHLCEHTILSAGSKK 83
           +G E+ +L+NG+ V                          +  G AH  EH      SK 
Sbjct: 25  QGTEISKLSNGLTVATEYMPNTSTATVGIYVNAGSRAENVKNNGTAHFLEHLAFKGTSK- 83

Query: 84  FPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGELLFDKVLDTLASSFKNPV 142
             RS    E+  +N GSH NAYT+ ENT +Y +    N          +D L+    N  
Sbjct: 84  --RSQKQIELDIENIGSHLNAYTSRENTVYYAKTLKEN------LPLAVDILSDILTNSK 135

Query: 143 FSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTGNFATLCDEPNLH 202
              ++I +E   I  E         + ++     +A    P  R   G         N+ 
Sbjct: 136 LEKNAIERERDVIVRESEEVDKMYDEVVFDHLHEIAYKDQPLGRTILGPI------KNIK 189

Query: 203 KVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLP 248
            +N ++ L  Y  +NY   RM L   G  +   L KLA+KYFG LP
Sbjct: 190 SIN-RSDLVHYITSNYKGDRMVLAGAGDINHQDLIKLAEKYFGHLP 234

>YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON}
           MAS1Smaller subunit of the mitochondrial processing
           protease (MPP), essential processing enzyme that cleaves
           the N-terminal targeting sequences from mitochondrially
           imported proteins
          Length = 462

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 73/199 (36%), Gaps = 17/199 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH           RS    E+  +N GSH NAYT+ ENT +Y +      S + 
Sbjct: 67  GTAHFLEHLAFKGTQN---RSQQGIELEIENIGSHLNAYTSRENTVYYAK------SLQE 117

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              K +D L+      V  +S+I +E   I  E         + ++     +     P  
Sbjct: 118 DIPKAVDILSDILTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLG 177

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   +  L  Y   NY   RM L   G      L + A+KYFG
Sbjct: 178 RTILGPIKNI-------KSITRTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFG 230

Query: 246 DLPASRDRDPTRPPLKKRP 264
            +P S    P   P    P
Sbjct: 231 HVPKSESPVPLGSPRGPLP 249

>Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF}
           (68467..69831) [1365 nt, 455 aa]
          Length = 454

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 70/185 (37%), Gaps = 17/185 (9%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH       K   RS    E+  +N GSH NAYT+ ENT +Y +    N     
Sbjct: 52  GTAHFLEHLAFKGTEK---RSQKKIELDIENIGSHLNAYTSRENTVYYAKTLKEN----- 103

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              + +D L+          S+I +E   I  E         + ++     +A       
Sbjct: 104 -VPQAIDILSDILTKSTLDKSAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLG 162

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   +  L  Y   NY   RM L   G    N + K A+KYFG
Sbjct: 163 RTILGPIKNI-------KSITRDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYAEKYFG 215

Query: 246 DLPAS 250
            LP+S
Sbjct: 216 HLPSS 220

>Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 464

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 70/185 (37%), Gaps = 17/185 (9%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH       K   RS    E+  +N GSH NAYT+ ENT +Y +    N     
Sbjct: 62  GTAHFLEHLAFKGTEK---RSQKKIELDIENIGSHLNAYTSRENTVYYAKTLKEN----- 113

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              + +D L+          S+I +E   I  E         + ++     +A       
Sbjct: 114 -VPQAIDILSDILTKSTLDKSAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLG 172

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   +  L  Y   NY   RM L   G    N + K A+KYFG
Sbjct: 173 RTILGPIKNI-------KSITRDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYAEKYFG 225

Query: 246 DLPAS 250
            LP+S
Sbjct: 226 HLPSS 230

>AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR163C
           (MAS1)
          Length = 470

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 79/199 (39%), Gaps = 17/199 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH     G+K   R+    E+  +N GSH NAYT+ ENT +Y +      S + 
Sbjct: 70  GTAHFLEHLAFK-GTKN--RTQVGIELEIENLGSHLNAYTSRENTVYYAK------SLQE 120

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              + LD L+      V    ++ +E   I  E         + ++     ++    P  
Sbjct: 121 DIPRALDVLSDILTRSVLDPKAVERERDVIIRESEEVDKMYDEVVFDHLHAISYENQPLG 180

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G         N+  +  +  L +Y  TNY   RMAL   G    + L +  +KYFG
Sbjct: 181 RTILGPIE------NIKSIQQR-DLKEYISTNYKGDRMALVGAGAVDHDELVRYGEKYFG 233

Query: 246 DLPASRDRDPTRPPLKKRP 264
            +P S    P   P    P
Sbjct: 234 HIPKSDHPVPLGSPRGPLP 252

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 73/199 (36%), Gaps = 17/199 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH           RS    E+  +N GSH NAYT+ ENT +Y +      S E 
Sbjct: 67  GTAHFLEHLAFKGTQN---RSQQGIELEIENIGSHLNAYTSRENTVYYAK------SLEE 117

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              K +D L+      V   ++I +E   I  E         + ++     +     P  
Sbjct: 118 DIPKAVDILSDILTKSVLDSNAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLG 177

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   ++ L  Y   NY   RM L   G      L + A+KYFG
Sbjct: 178 RTILGPIKNI-------KSITRSDLKDYITKNYKGDRMVLAGAGAVDHERLVQYAQKYFG 230

Query: 246 DLPASRDRDPTRPPLKKRP 264
            +P S    P   P    P
Sbjct: 231 HVPRSDSPVPLGSPRGPLP 249

>Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C
           (MAS1) - mitochondrial processing protease subunit
           [contig 252] FULL
          Length = 458

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 72/185 (38%), Gaps = 17/185 (9%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH     G+K   R+    E+  +N GSH NAYT+ ENT +Y +    N     
Sbjct: 63  GTAHFLEHLAFK-GTKN--RTQVGIEMEIENIGSHLNAYTSRENTVYYAKTLTQN----- 114

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
                +D L+      V   ++I +E   I  E         + ++     +     P  
Sbjct: 115 -IPNAVDILSDILTKSVLDTNAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLG 173

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   +  L +Y  TNY   RM L   G    + L + A KYFG
Sbjct: 174 RTILGPIKNI-------KTIQQRDLREYISTNYKGDRMVLAGAGDVDHDKLVEYAGKYFG 226

Query: 246 DLPAS 250
            +P S
Sbjct: 227 HIPKS 231

>TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.376
           YLR163C
          Length = 499

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 82/206 (39%), Gaps = 31/206 (15%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH      +    RS    E+V +N GSH NAYT+ ENT +Y +    N     
Sbjct: 101 GTAHFLEHLAFKGTTT---RSQRDIELVIENLGSHLNAYTSRENTVYYAKTLKDN----- 152

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNV--NKASTPKQLYHATRL-----LA 178
                +D L+      + + S+++K   AIE E +V   ++    Q+Y          + 
Sbjct: 153 -IPNAIDILSD-----ILTKSTLDKN--AIERERSVIIRESEEVDQMYDEVVFDHLHEIV 204

Query: 179 NPRHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAK 238
               P  R   G         N++ +  +  L  Y  TNY   RM L   G  +   L K
Sbjct: 205 YKDQPLGRTILGPIK------NINTIQ-RNDLQNYITTNYKGDRMVLAGAGDVNHEELVK 257

Query: 239 LAKKYFGDLPASRDRDPTRPPLKKRP 264
            A+KYFG +  S    P   P    P
Sbjct: 258 YAEKYFGHVKKSDSPLPLGSPRGPLP 283

>KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.376
           YLR163C
          Length = 467

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 74/199 (37%), Gaps = 17/199 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH     G+K   RS    E+  +N GSH NAYT+ ENT +Y +    +     
Sbjct: 70  GTAHFLEHLAFK-GTKN--RSQRGIELEIENIGSHLNAYTSRENTVYYAKSLRED----- 121

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              K +D L+      V    +I +E   I  E         + ++     +A    P  
Sbjct: 122 -IPKAVDILSDILTKSVLDPKAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYRDQPLG 180

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   +  L  Y  TNY   RM L   G    + L   A+KYFG
Sbjct: 181 RTILGPIKNI-------KSIKRTDLQNYIMTNYKGDRMVLASAGSVDHDNLVAYAQKYFG 233

Query: 246 DLPASRDRDPTRPPLKKRP 264
            L  S    P   P    P
Sbjct: 234 HLKRSDVSVPLGSPRGPLP 252

>Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 73/199 (36%), Gaps = 17/199 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH           RS    E+  +N GSH NAYT+ ENT +Y +      S + 
Sbjct: 67  GTAHFLEHLAFKGTQN---RSQQGIELEIENIGSHLNAYTSRENTVYYAK------SLQE 117

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              K ++ L+      V   ++I +E   I  E         + ++     +     P  
Sbjct: 118 DIPKAVEILSDILTKSVLDSNAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLG 177

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   ++ L  Y   NY   RM L   G      L + A+KYFG
Sbjct: 178 RTILGPIKNI-------KSITRSDLKNYITKNYKGDRMVLAGAGAVDHEKLVEHAQKYFG 230

Query: 246 DLPASRDRDPTRPPLKKRP 264
            +P S    P   P    P
Sbjct: 231 HVPKSESPVPLGSPRGPLP 249

>Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 73/199 (36%), Gaps = 17/199 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH           RS    E+  +N GSH NAYT+ ENT +Y +      S + 
Sbjct: 67  GTAHFLEHLAFKGTQN---RSQQGIELEIENIGSHLNAYTSRENTVYYAK------SLQE 117

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              K +  L+      V  +++I +E   I  E         + ++     +     P  
Sbjct: 118 DIPKAVGILSDILTKSVLDNNAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLG 177

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   ++ L  Y   NY   RM L   G      L + A+KYFG
Sbjct: 178 RTILGPIKNI-------KSITRSDLKNYITRNYKGDRMVLAGAGAVDHEELVEYAQKYFG 230

Query: 246 DLPASRDRDPTRPPLKKRP 264
            +P S    P   P    P
Sbjct: 231 HVPKSESPVPLGSPRGPLP 249

>KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 458

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 71/199 (35%), Gaps = 17/199 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH     G+K   R+    E+  +N GSH NAYT+ ENT +Y +    N     
Sbjct: 63  GTAHFLEHLAFK-GTKN--RTQVGIELEIENIGSHLNAYTSRENTVYYAKTLTQN----- 114

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
                +D L+      V    +I +E   I  E         + ++     +     P  
Sbjct: 115 -IPNAVDVLSDILTRSVLDARAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLG 173

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   +  L  Y   NY   RM L   G      L + A KYFG
Sbjct: 174 RTILGPIENI-------KTIQRRDLQDYISKNYKGDRMVLAGAGAVDHEKLVEYADKYFG 226

Query: 246 DLPASRDRDPTRPPLKKRP 264
            +P S    P   P    P
Sbjct: 227 HIPKSESPVPLGSPRGPLP 245

>CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163c MAS1
          Length = 465

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 74/194 (38%), Gaps = 17/194 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH           RS    E+  +N GSH NAYT+ ENT +Y    A +  G++
Sbjct: 69  GTAHFLEHLAFKGTQN---RSQTDIELEIENIGSHLNAYTSRENTVYY----AKSLEGDV 121

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              K ++ L+      V    +I +E   I  E         + ++     +A  + P  
Sbjct: 122 --PKAVNILSDILTRSVLDPKAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYKQQPLG 179

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G         N+  ++ K  L  Y   NY   RM L   G      L   A+KY G
Sbjct: 180 RTILGPIK------NIKSISRK-DLKSYITENYKGDRMVLAAAGAVDHEKLVDYAQKYLG 232

Query: 246 DLPASRDRDPTRPP 259
            +P S    P   P
Sbjct: 233 HIPKSESPMPLGSP 246

>NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376
          Length = 461

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 72/199 (36%), Gaps = 17/199 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH           RS    E+  +N GSH NAYT+ ENT +Y +    +     
Sbjct: 66  GTAHFLEHLAFKGTQN---RSQKGIELEIENIGSHLNAYTSRENTVYYAKSLKED----- 117

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              K +D L+      V    +I +E   I  E         + ++     +     P  
Sbjct: 118 -IPKAVDILSDILTKSVLDPRAIERERDVIIRESEEVDKMHDEVVFDHLHAITYKDQPLG 176

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   +  L +Y   NY   RM L   G  + + L + A+KYFG
Sbjct: 177 RTILGPIKNI-------KSITRNDLREYITKNYKGDRMVLAGAGAVNHDELVEYAQKYFG 229

Query: 246 DLPASRDRDPTRPPLKKRP 264
            L  S    P   P    P
Sbjct: 230 HLGKSVSPVPLGSPRGPLP 248

>KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.376
           YLR163C
          Length = 462

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 70/199 (35%), Gaps = 17/199 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH           RS    E+  +N GSH NAYT+ ENT +Y +    ND    
Sbjct: 66  GTAHFLEHLAFKGTEN---RSQRAIELEIENIGSHLNAYTSRENTVYYAK-SLQND---- 117

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              K ++ L+           +I +E   I  E         + ++     +A    P  
Sbjct: 118 -IPKAVEILSDILTKSTLDPRAIERERDVIIRESEEVDKMYDEVVFDHLHDIAYKDQPLG 176

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   +  L  Y   NY   RM L   G    + L   A+KYFG
Sbjct: 177 RTILGPIKNI-------KSISRTDLKSYINKNYKGDRMVLAGAGAVDHDNLVTYAQKYFG 229

Query: 246 DLPASRDRDPTRPPLKKRP 264
            L  S    P   P    P
Sbjct: 230 HLQKSDSPMPLGTPRSALP 248

>TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {ON}
           Anc_8.376 YLR163C
          Length = 456

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 71/185 (38%), Gaps = 17/185 (9%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH     G+K   +S    EI  +N GSH NAYT+ ENT +Y +    +     
Sbjct: 61  GTAHFLEHLAFK-GTKDRTQSGIELEI--ENIGSHLNAYTSRENTVYYAKSLRDD----- 112

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              + +D L+      V    +I +E   I  E         + ++     +A       
Sbjct: 113 -IPRAVDILSDILTRSVLDPRAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYKDQSLG 171

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   +  L  Y   NY   RM L   G    + L K A+++FG
Sbjct: 172 RTILGPVKNI-------KSITRKDLKDYITKNYKGDRMVLAGAGAVDHDDLVKQAERFFG 224

Query: 246 DLPAS 250
            +P S
Sbjct: 225 HIPKS 229

>KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]
           {ON} highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 469

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 73/199 (36%), Gaps = 17/199 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH           RS    E+  +N GSH NAYT+ ENT +Y +      S + 
Sbjct: 74  GTAHFLEHLAFKGTQN---RSQTGIELEIENIGSHLNAYTSRENTVYYAK------SLKQ 124

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              K +D LA      V    +I +E   I  E         + ++     +     P  
Sbjct: 125 DIPKAVDILADILTRSVLDPKAIERERDVIIRESEEVDKMYDEVVFDHLHTITYKNQPLG 184

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   ++ L ++ + +Y   RM L   G    + L + A KYFG
Sbjct: 185 RTILGPIKNI-------KSIQRSDLQEFIEKHYTGDRMVLVGTGAVDHDKLVEYAGKYFG 237

Query: 246 DLPASRDRDPTRPPLKKRP 264
            +  S    P   P    P
Sbjct: 238 HVRKSEAPIPLGSPRGPLP 256

>Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar to
           Ashbya gossypii AGL138C
          Length = 462

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 70/185 (37%), Gaps = 17/185 (9%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH      +    RS    E+  +N GSH NAYT+ ENT +Y +    +     
Sbjct: 66  GTAHFLEHLAFKGTTN---RSQVGIELEIENIGSHLNAYTSRENTVYYAKSLKED----- 117

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              K +D L+        +  +I +E   I  E         + ++     +        
Sbjct: 118 -IPKAMDILSDILTRSTLNPKAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQALG 176

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G         N+  +  K  L +Y  TNY   RMAL   G    + L +  ++YFG
Sbjct: 177 RTILGPI------ENIKSIQRK-DLAEYISTNYTGDRMALVGAGSVDHDKLVEYGERYFG 229

Query: 246 DLPAS 250
            +  S
Sbjct: 230 HIRKS 234

>NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.376
           YLR163C
          Length = 463

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 72/194 (37%), Gaps = 17/194 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH     G+K   RS    E+  +N GSH NAYT+ ENT +Y +    +     
Sbjct: 68  GTAHFLEHLAFK-GTKN--RSQKGIELEIENIGSHLNAYTSRENTVYYAKSLKED----- 119

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              K +D L+      V    +I +E   I  E         + ++     +     P  
Sbjct: 120 -IPKAVDILSDILTRSVLDPEAIERERDVIIRESEEVDKMYDEVVFDHLHEVTYKDQPLG 178

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G         N+  +  +  L +Y   NY   RM L   G      L + A++ FG
Sbjct: 179 RTILGPIK------NIQSI-TRDDLSKYITDNYKGDRMVLAGAGAVDHEKLVEYAQRCFG 231

Query: 246 DLPASRDRDPTRPP 259
            L  S    P   P
Sbjct: 232 HLGKSTSPVPLGSP 245

>SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 461

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 73/199 (36%), Gaps = 17/199 (8%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH     G++   R+    E+  +N GSH NAYT+ ENT +Y +      S E 
Sbjct: 66  GTAHFLEHLAFK-GTQN--RTQTGIELEIENIGSHLNAYTSRENTVYYAK------SLEN 116

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              + +D L+      V    +I +E   I  E         + ++     +     P  
Sbjct: 117 DIPQAVDILSDILTRSVLDPRAIERERDVIIRESEEVDKMYDEVVFDHLHAIVYQDQPLG 176

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   +  L  Y   NY   RM L   G    + L   A+ YFG
Sbjct: 177 RTILGPIKNI-------KTIQRDDLQAYISKNYSGDRMVLVGAGAVDHHKLVDYAQTYFG 229

Query: 246 DLPASRDRDPTRPPLKKRP 264
            +  S+   P   P    P
Sbjct: 230 HIRKSQQPVPLGSPRGPLP 248

>ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {ON}
           highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 465

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 70/185 (37%), Gaps = 17/185 (9%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSH-NAYTTGENTTFYFELPASNDSGEL 125
           G AH  EH     G+K   RS    E+  +N GSH NAYT+ ENT ++ +      S E 
Sbjct: 70  GTAHFLEHLAFK-GTKN--RSQTGIELEIENIGSHLNAYTSRENTVYFAK------SLEE 120

Query: 126 LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185
              + ++ L+      V    +I +E   I  E         + ++     +A       
Sbjct: 121 DVPRAVEILSDILTRSVLDPKAIERERDVIIRESEEVDKMYDEVVFDHLHDVAYKNQALG 180

Query: 186 RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245
           R   G    +       K   +  L  Y   NY   RM L   G      L + A+K FG
Sbjct: 181 RTILGPIKNI-------KTITREDLKNYIDKNYKGDRMVLAGAGAIDHEKLIEYAQKSFG 233

Query: 246 DLPAS 250
            +P +
Sbjct: 234 HIPKA 238

>NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]
           {ON} Anc_3.93
          Length = 1032

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 81/209 (38%), Gaps = 29/209 (13%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELL 126
           G+ H  EH I   GSK+ P       +      S NA+T  + T +         +G   
Sbjct: 57  GVPHTLEHLIF-MGSKQHPYKGLLDTVGNLCMSSTNAWTATDQTVYTL-----TSAGWKG 110

Query: 127 FDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKA-------STPKQLYHATRL--- 176
           F K+L    +    P  +D +   E+Y ++ E   +K        +   Q +  T L   
Sbjct: 111 FSKILPAYLNHILFPTLTDDACTTEVYHVDPEDLSDKGVVFSEMEAIESQSWFVTMLEKQ 170

Query: 177 -LANPRHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNA 235
            L  PR    R  TG         NL  +     + ++ K NY +  + L + G    + 
Sbjct: 171 RLMFPRGSGYRSETGGLTN-----NLRDL-TNEEIKEFHKANYSSDNLCLIICGNVPESE 224

Query: 236 LAKLAKKYFGDLPASRDRDPTRPPLKKRP 264
           L ++ + +   LP   D+D TR   KKRP
Sbjct: 225 LLEIVQNWDNSLP---DKDLTR---KKRP 247

>CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098c
          Length = 1021

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 76/207 (36%), Gaps = 31/207 (14%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELL 126
           G+ H  EH I   GSKK+P       +      S NA+T  + T +         +G   
Sbjct: 57  GVPHTLEHLIF-MGSKKYPYKGLLDTLGNLCMSSTNAWTATDQTVYTL-----TSAGWQG 110

Query: 127 FDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKA-------STPKQLYHATRL--- 176
           F K+L        NP  +D +   E+Y I+ +   +K            Q +  T L   
Sbjct: 111 FKKLLPVYLDHLLNPTLTDEACVTEVYHIDPQDFSDKGVVYSEMEGIESQSWFLTSLEKQ 170

Query: 177 -LANPRHPFSRFCTG----NFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQ 231
            L  P     R  TG    N  TL ++           + ++ K  Y    + L + G  
Sbjct: 171 RLMFPEGSGYRSETGGLTKNLRTLTND----------EIKEFHKKMYSPQNLCLIVSGNV 220

Query: 232 SLNALAKLAKKYFGDLPASRDRDPTRP 258
             + L ++A ++   LP   D   +RP
Sbjct: 221 PEDELLEIASRWDETLPTYSDASISRP 247

>Ecym_3585 Chr3 (1108374..1111472) [3099 bp, 1032 aa] {ON} similar
           to Ashbya gossypii AFR334W
          Length = 1032

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 86/217 (39%), Gaps = 32/217 (14%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGG----SHNAYTTGENTTFYFELPASNDS 122
           G  H  EH I   GSKK+P    +  ++  +GG    + NA+T  + T +     +   +
Sbjct: 57  GAPHTLEHLIF-MGSKKYP----WKGLLDISGGITMSNTNAWTATDQTVY-----SLTSA 106

Query: 123 GELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQL-------YHATR 175
           G + F K+L        NP  +D +   E+Y I+ +  V+K     ++       Y  T 
Sbjct: 107 GWVGFKKLLLVYLDHIVNPRLTDEACTTEVYYIDPKDLVDKGVVYSEMEGIESAAYSITN 166

Query: 176 L----LANPRHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQ 231
           L    L  P     R  TG         NL K++    + ++    Y    + L + G  
Sbjct: 167 LEVQRLMFPEGNAYRSETGGLTK-----NLRKLS-NEEIRKFHAEKYSPDNLCLIICGNV 220

Query: 232 SLNALAKLAKKYFGDLPASRDRDPTRPPLKKRPSSGV 268
             + L  + +++  +LP        RP L   PSS +
Sbjct: 221 PEDELLDVIQEFDAELPEFNKPKRKRPFLDS-PSSQI 256

>TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3.93
           YOL098C
          Length = 1035

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 83/214 (38%), Gaps = 31/214 (14%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGG----SHNAYTTGENTTFYFELPASNDS 122
           G  H  EH I   GS++ P    Y  ++   G     S NA+T  + T +         +
Sbjct: 57  GAPHTLEHLIF-MGSQQHP----YKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TSA 106

Query: 123 GELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKA-------STPKQLYHATR 175
           G   F ++L        NP  +D++   E+Y ++ +   +K        +   Q +  T 
Sbjct: 107 GWQGFKQLLPAYLDHILNPTLTDAACLTEVYHVDPDDLSDKGVVFSEMDAIESQSWFVTM 166

Query: 176 L----LANPRHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQ 231
           L    L  P     R  TG        PNL +++    + ++ K  Y    + L + G  
Sbjct: 167 LEKQRLMFPEGSGYRSETGGLT-----PNLRQIS-NDEIRKFHKDAYSPDNLCLIVSGNV 220

Query: 232 SLNALAKLAKKYFGDLPASRDRDPTRPPLKKRPS 265
             + L K+ +++   LP    +D  RP L  + S
Sbjct: 221 PEDELLKIVQEWDDTLPTFEFQDRKRPFLDNQAS 254

>Kwal_26.9378 s26 complement(1189437..1189715) [279 bp, 92 aa] {OFF}
           [contig 72] FULL
          Length = 92

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 133 TLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187
           + A SF   +FS S++ K I  + S H +   +T  Q +H T L++  R   S F
Sbjct: 26  SFAWSFHGAIFSCSTVRKPIIHLRSYHRIRCITTILQTHHLTSLISCYRAVLSLF 80

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
            YER004W
          Length = 237

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 6/50 (12%)

Query: 1055 RSKLSVMVASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQ 1104
            RS+L  +V  PV  DE+       Q+  +L LK LK  SSE   IVES++
Sbjct: 178  RSRLQALVGHPVFGDEVG------QVGVHLALKALKDKSSEKVQIVESNE 221

>SAKL0C09504g Chr3 complement(865789..868998) [3210 bp, 1069 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1069

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 6/92 (6%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELL 126
           G+ H  EH I   GS+KFP              S NA+T  + T +         +G L 
Sbjct: 86  GVPHTLEHLIF-MGSRKFPFKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TSAGWLG 139

Query: 127 FDKVLDTLASSFKNPVFSDSSINKEIYAIESE 158
           F K+L        NP  +D +   E+Y ++ E
Sbjct: 140 FKKLLPVYLDHVLNPTLTDEACCTEVYHVDPE 171

>NDAI0H02390 Chr8 complement(580589..582031) [1443 bp, 480 aa] {ON}
           Anc_2.439 YMR110C
          Length = 480

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 654 MCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIID 713
           + L  +A  +G   S VL PSE+  +T  +      HA       GFP+G+  +V+  ID
Sbjct: 139 LSLVPVAHAIGAGNSVVLKPSEQTPHTSMLIAKILNHA-------GFPKGLVQIVQGSID 191

Query: 714 QTKSLINS 721
           +T  LI S
Sbjct: 192 ETSKLIKS 199

>NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {ON}
           Anc_5.541 YDR430C
          Length = 988

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 8/107 (7%)

Query: 62  PDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFY-FELPASN 120
           P    G+ H+ EHT L  GSKK+P    + +++ ++  +     TG + TF+ F    + 
Sbjct: 76  PPNSTGVPHVLEHTTL-CGSKKYPVRDPFFKMLNKSLANFMNAMTGHDYTFFPFATTNAK 134

Query: 121 DSGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTP 167
           D     F+ + D    +  NP+       +E + +E +  V   +TP
Sbjct: 135 D-----FNNLRDVYLDATLNPLLKQEDFYQEGWRLEHD-TVTDVTTP 175

>KNAG0L01930 Chr12 (346371..348311) [1941 bp, 646 aa] {ON} Anc_5.670
           YKR078W
          Length = 646

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 32/72 (44%)

Query: 790 ISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPVTHALKPGTNMFIR 849
           +S P +  +  QG  S  E  +TF D G + H +    HE    E V  A++      + 
Sbjct: 12  LSAPVWDELADQGQTSVPELTATFNDLGASEHTAAEEDHESEGPEAVDQAVEHTQKGLLE 71

Query: 850 RSAFVEDPSSSI 861
           R A  EDP S +
Sbjct: 72  RLAPEEDPLSDL 83

>NCAS0E03360 Chr5 (668230..670635) [2406 bp, 801 aa] {ON} Anc_7.258
            YIL068C
          Length = 801

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 8/126 (6%)

Query: 1050 ICSTTRSKLSVMVA-SPVSADEIAEK--RLFLQIESYLKLKGLKIPSSELRAIVESSQGK 1106
            + +T R     M A + VS D++     +LF +I S +  K  ++  S +  IVE  +  
Sbjct: 146  LLTTARDFQDQMTAMAQVSTDDVQRTVIKLFNKIPSLIS-KFDRLVESLIYDIVEIVRSG 204

Query: 1107 PSTLMRGLFKFF-LARGETLRLC---NVILKELSKAVVLSLKPRPTNNNSAGVLQNVRKE 1162
              +L   LFK   L   E L++    N+I K+  +A   S+K  P N NSA +L+N ++ 
Sbjct: 205  QISLSIRLFKVIDLEEQEDLKITAIRNIIEKKEVQAEKSSIKKLPNNKNSARLLENEQRS 264

Query: 1163 VSTAVP 1168
            V    P
Sbjct: 265  VEYPTP 270

>NCAS0F01510 Chr6 complement(301616..303184) [1569 bp, 522 aa] {ON}
           Anc_2.439 YMR110C
          Length = 522

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 654 MCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIID 713
           + L  +A  +G   S +L PSE+  +T  +       A       GFP+G+  +V+  ID
Sbjct: 139 LALVPVAHAIGAGNSVILKPSERTAHTALVMQRIIEEA-------GFPDGLVQVVQGAID 191

Query: 714 QTKSLINS 721
           +T+ LI S
Sbjct: 192 ETQRLITS 199

>TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa]
           {ON} Anc_5.541 YDR430C
          Length = 991

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 49/105 (46%), Gaps = 7/105 (6%)

Query: 62  PDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFY-FELPASN 120
           P +  G+AH+ EHT L  GSKK+P    + +++ ++  +     TG + T Y F    S 
Sbjct: 77  PPDSTGVAHILEHTTL-CGSKKYPVRDPFFKMLNRSLSNFMNAMTGHDYTMYPFATTNSK 135

Query: 121 DSGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKAS 165
           D     F  + D    +  +P+       +E + +E++   +K S
Sbjct: 136 D-----FKNLQDVYLDATFSPLLKQEDFFQEGWRLENKDATDKDS 175

>KAFR0C01430 Chr3 (292206..295313) [3108 bp, 1035 aa] {ON} Anc_3.93
           YOL098C
          Length = 1035

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 14/102 (13%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGG----SHNAYTTGENTTFYFELPASNDS 122
           G  H  EH I   GS+K     HY  ++   G     S NA+T  + T +         +
Sbjct: 57  GTPHTLEHLIF-MGSQK----HHYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TTA 106

Query: 123 GELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKA 164
           G   F K+L        NP  +D++   E+Y I+ E   +K 
Sbjct: 107 GWKGFQKLLPAYLDHILNPTLTDAACMTEVYHIDPEDLTDKG 148

>NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON}
           Anc_3.93 YOL098C
          Length = 1034

 Score = 32.7 bits (73), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 78/215 (36%), Gaps = 24/215 (11%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELL 126
           G+ H  EH I   GSK+ P       +      S NA+T  + T +         +G   
Sbjct: 57  GVPHTLEHLIF-MGSKEHPYKGLLDTVGNLCMSSTNAWTATDQTVYTL-----TSAGWKG 110

Query: 127 FDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKA-------STPKQLYHATRL--- 176
           F K+L +  +    P  +D +   E+Y ++ E   +K        +   Q +  T L   
Sbjct: 111 FSKLLPSYLNHILFPTLTDEACTTEVYHVDPEDFSDKGVVFSEMEAIESQSWFVTMLEKQ 170

Query: 177 -LANPRHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNA 235
            L  P     R  TG         NL  +     + ++ K  Y +  + L + G    + 
Sbjct: 171 RLMFPEGSGYRSETGGLTN-----NLRTL-TNDEIKKFHKEMYSSDNLCLIICGNVPQSE 224

Query: 236 LAKLAKKYFGDLPASRDRDPTRPPLKKRPSSGVAS 270
           L  + + +   LP  +D    + P    P S + S
Sbjct: 225 LLDIMENWDSTLP-EKDNSTKKRPFLDTPESQIPS 258

>TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3.93
           YOL098C
          Length = 1038

 Score = 32.7 bits (73), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 6/98 (6%)

Query: 67  GLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELL 126
           G+ H  EH I   GS K+P       +      S NA+T  + T +         +G   
Sbjct: 57  GVPHTLEHLIF-MGSPKYPYKGLLDTVGNLCMSSTNAWTATDQTVYTL-----TSAGWTG 110

Query: 127 FDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKA 164
           F K+L        NP  +D +   E+Y I+ +   +K 
Sbjct: 111 FKKLLPMYLEHIINPTLTDDAYVTEVYHIDPDTLTDKG 148

>Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430C
           (CYM1) - Hypothetical ORF [contig 193] FULL
          Length = 987

 Score = 32.7 bits (73), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 62  PDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFY 113
           P +  G+ H+ EHT L  GS+K+P    + +++ ++  +     TG + TFY
Sbjct: 76  PPDATGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY 126

>NDAI0E04020 Chr5 complement(890287..898647) [8361 bp, 2786 aa] {ON}
            Anc_7.418 YBL088C
          Length = 2786

 Score = 32.3 bits (72), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 447  LLSVFETLDPKCLLKGSPLIECNQNPSAIGDYSESTESRTW 487
            L +++E +D   LL G P+ +C    SA  DY  STE RTW
Sbjct: 1764 LRNIYEKIDDLNLLSGLPVPDC---LSASIDYINSTEPRTW 1801

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 114,936,115
Number of extensions: 4767314
Number of successful extensions: 14099
Number of sequences better than 10.0: 91
Number of HSP's gapped: 14213
Number of HSP's successfully gapped: 122
Length of query: 1185
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1064
Effective length of database: 39,606,813
Effective search space: 42141649032
Effective search space used: 42141649032
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)