Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E04554g7.196ON47947924530.0
Kwal_55.203687.196ON41241219590.0
SAKL0F07502g7.196ON41240717080.0
KLLA0D16214g7.196ON41840816530.0
TDEL0H025107.196ON41839816140.0
Smik_9.1687.196ON43138716030.0
Suva_9.1777.196ON43541715920.0
Skud_9.1477.196ON43139115880.0
YIL022W (TIM44)7.196ON43139315810.0
Kpol_1063.97.196ON41741715660.0
Ecym_43807.196ON41838415640.0
NCAS0A125207.196ON43239415330.0
ADL118C7.196ON41840215230.0
CAGL0J02442g7.196ON41240715200.0
ZYRO0D15840g7.196ON40740715200.0
TPHA0C045307.196ON41638715140.0
NDAI0B017807.196ON43438615060.0
KNAG0H026907.196ON41941614830.0
KAFR0A026407.196ON42141814060.0
TBLA0J015007.196ON42138912481e-169
YLR005W (SSL1)5.226ON461124820.20
Skud_12.715.226ON462124810.21
Suva_10.835.226ON466124800.30
Smik_12.675.226ON458124800.30
KNAG0B051505.226ON469123790.42
Smik_6.578.55ON523101760.95
KAFR0B060308.372ON238136712.6
KNAG0A048408.372ON253133712.8
Kwal_33.152465.226ON469153704.6
KLTH0B02794g5.226ON470152696.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E04554g
         (479 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   949   0.0  
Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   759   0.0  
SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   662   0.0  
KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   641   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   626   0.0  
Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   622   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   617   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   616   0.0  
YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   613   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   607   0.0  
Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   607   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   595   0.0  
ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   591   0.0  
CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   590   0.0  
ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   590   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   587   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   584   0.0  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   575   0.0  
KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   546   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   485   e-169
YLR005W Chr12 (160049..161434) [1386 bp, 461 aa] {ON}  SSL1Compo...    36   0.20 
Skud_12.71 Chr12 (151308..152696) [1389 bp, 462 aa] {ON} YLR005W...    36   0.21 
Suva_10.83 Chr10 (165557..166957) [1401 bp, 466 aa] {ON} YLR005W...    35   0.30 
Smik_12.67 Chr12 (147119..148495) [1377 bp, 458 aa] {ON} YLR005W...    35   0.30 
KNAG0B05150 Chr2 complement(987516..988925) [1410 bp, 469 aa] {O...    35   0.42 
Smik_6.57 Chr6 (111118..112689) [1572 bp, 523 aa] {ON} YFL021W (...    34   0.95 
KAFR0B06030 Chr2 (1247049..1247765) [717 bp, 238 aa] {ON} Anc_8....    32   2.6  
KNAG0A04840 Chr1 complement(694692..695408,695676..695720) [762 ...    32   2.8  
Kwal_33.15246 s33 complement(1030094..1031503) [1410 bp, 469 aa]...    32   4.6  
KLTH0B02794g Chr2 (217284..218696) [1413 bp, 470 aa] {ON} highly...    31   6.8  

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/479 (97%), Positives = 467/479 (97%)

Query: 1   MVFNIAMSISETLLVVSINASDPNVLIGAVILVSLDTVILTVKKFDILISYVLNSINQKG 60
           MVFNIAMSISETLLVVSINASDPNVLIGAVILVSLDTVILTVKKFDILISYVLNSINQKG
Sbjct: 1   MVFNIAMSISETLLVVSINASDPNVLIGAVILVSLDTVILTVKKFDILISYVLNSINQKG 60

Query: 61  VARGKFRMLRPGRPLKSVVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNI 120
           VARGKFRMLRPGRPLKSVVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNI
Sbjct: 61  VARGKFRMLRPGRPLKSVVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNI 120

Query: 121 KALQDASGKIGESEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKST 180
           KALQDASGKIGESEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKST
Sbjct: 121 KALQDASGKIGESEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKST 180

Query: 181 RQAVNKTAAKLDESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGK 240
           RQAVNKTAAKLDESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGK
Sbjct: 181 RQAVNKTAAKLDESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGK 240

Query: 241 RPKAVKSNEEAGTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIV 300
           RPKAVKSNEEAGTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIV
Sbjct: 241 RPKAVKSNEEAGTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIV 300

Query: 301 LMRTIGNKVGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQV 360
           LMRTIGNKVGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQV
Sbjct: 301 LMRTIGNKVGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQV 360

Query: 361 LKQWFSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQ 420
           LKQWFSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAK            GCRAQ
Sbjct: 361 LKQWFSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLPPQDLPVLVVGCRAQ 420

Query: 421 EIHLYRDVKTGEVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           EIHLYRDVKTGEVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT
Sbjct: 421 EIHLYRDVKTGEVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/412 (89%), Positives = 387/412 (93%)

Query: 68  MLRPGRPLKSVVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDAS 127
           M+RP RP+ +VV  R L+QT +ACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDAS
Sbjct: 1   MVRPVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDAS 60

Query: 128 GKIGESEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKT 187
           GK+GES+AYKKAREAYL AQKGSTIVGKT+KKTGDSVE+IAAKAWESEI KSTR+AVNKT
Sbjct: 61  GKLGESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKT 120

Query: 188 AAKLDESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKS 247
           AAKLDESFEPVRHTRVYKDVSEVM+S NSSRYGGFI+KEQRRLKLEQDIASGKRPKAV+S
Sbjct: 121 AAKLDESFEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRS 180

Query: 248 NEEAGTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGN 307
           N+EAGTALVAT IEAKESFGKKVDDFKEKTVVGRKL D K KLWDESENPLIVL+RTIGN
Sbjct: 181 NDEAGTALVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGN 240

Query: 308 KVGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSE 367
           K+GGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKG+E+VLKQWFSE
Sbjct: 241 KIGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSE 300

Query: 368 APYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRD 427
           APYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAK            GCRAQEIHLYRD
Sbjct: 301 APYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRD 360

Query: 428 VKTGEVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           VKTGEVAAGTQSNILMSSYAMVFTRDPE+ID+KETEGWKILEFVRGGSRQFT
Sbjct: 361 VKTGEVAAGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/407 (78%), Positives = 358/407 (87%), Gaps = 1/407 (0%)

Query: 73  RPLKSVVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGE 132
           +P   +  RR ++ T +  QG  RSPLQIFRETFKQEW+KS+ELQDNIK LQDASGK+GE
Sbjct: 7   KPQLVLASRRTISSTVRLPQGQ-RSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGE 65

Query: 133 SEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLD 192
           S+AYKKAREAYL AQKGSTIVGKTLKKTG++VE IA KAWESE+GK+TR+A+N TA K+D
Sbjct: 66  SDAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKID 125

Query: 193 ESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAG 252
           ESFEPVR T+VYKDVSEV+D   SSRYGGFI+KEQRRLK EQD+ASGKRPKAVKSN+EAG
Sbjct: 126 ESFEPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAG 185

Query: 253 TALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGL 312
           TALVAT IEAKESF KK++DFKEKT  GRK+ ++K +LWDESENPLIVL+RTIGNKVGG+
Sbjct: 186 TALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGI 245

Query: 313 FAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNV 372
           FAETESARVMGQFKM+D NFN+ESF  HLREYIIPE+LEAYVKG+E VLKQWFSEAPYNV
Sbjct: 246 FAETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNV 305

Query: 373 YAAQQKVFREQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTGE 432
           YAAQQK FR+Q LFADGRILDIRGV+IVSAK            GCRAQEIHLYR  KTGE
Sbjct: 306 YAAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGE 365

Query: 433 VAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           +AAGT+SNIL+SSYAMVFTRDPEN+DDKETEGW+ILEFVRGGSRQFT
Sbjct: 366 IAAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/408 (76%), Positives = 348/408 (85%), Gaps = 3/408 (0%)

Query: 75  LKSVVIRRNLAQTFKA---CQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIG 131
           +   V R +  +TF        NPRSPLQIFRETFKQEW+KS+ELQDNIKALQDASGK+G
Sbjct: 11  MHKAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLG 70

Query: 132 ESEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKL 191
           ESEAYKKAREAY+ AQKGSTIVGKTLKKTG++VE IA+KAW+SEI KSTR+ VNKTA KL
Sbjct: 71  ESEAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKL 130

Query: 192 DESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEA 251
           DESFEPVR T+VYKDVSEV+D  +SSRYGGFI+KEQRRL  E+ IASGKR +AVKSN+ A
Sbjct: 131 DESFEPVRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAA 190

Query: 252 GTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGG 311
           GTALVAT IE+KESFGKK++DFKEKT VGRKL + K KLWDESENPL+V++RT+  K+GG
Sbjct: 191 GTALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGG 250

Query: 312 LFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYN 371
           LFAETESARV GQFKMMD  FN+E F  HLREYIIPE+LEAYVKG+E VLKQWFSEAPYN
Sbjct: 251 LFAETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYN 310

Query: 372 VYAAQQKVFREQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTG 431
           VYAAQQK FREQ LFADG+ILDIRGV+IVSAK            GCRAQEIHLYR  KTG
Sbjct: 311 VYAAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTG 370

Query: 432 EVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           E+AAG +S+ILMSSYAMVFTRDPE +DDKETEGWKILEFVRGGSRQFT
Sbjct: 371 EIAAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/398 (75%), Positives = 341/398 (85%)

Query: 82  RNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKARE 141
           R L  T      NPRSP+QIFR+TFK+EWKKSQELQDNIK LQDASG++GESEAYK+ARE
Sbjct: 21  RALFSTSSGSLQNPRSPVQIFRDTFKKEWKKSQELQDNIKTLQDASGRLGESEAYKRARE 80

Query: 142 AYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHT 201
           AY+ AQKGSTIVGKTLKKTG++VE IA+KAW+SEI ++TR+A +KTA K+DE FEPVR T
Sbjct: 81  AYVRAQKGSTIVGKTLKKTGETVENIASKAWDSEIARNTREAASKTAKKIDEGFEPVRQT 140

Query: 202 RVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIE 261
           ++YKDVSEVMD  NSSRYGGFI+KEQRRLK EQD+ SGKR KAVK NE+AGTALVAT+IE
Sbjct: 141 KIYKDVSEVMDDGNSSRYGGFITKEQRRLKREQDMLSGKRAKAVKGNEDAGTALVATDIE 200

Query: 262 AKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARV 321
           AK+SFGKKV+DFKEKTV+GR L  +K  LWDES NPLIV +R I  K+GG FAETE+ARV
Sbjct: 201 AKQSFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVFLRKITRKIGGFFAETEAARV 260

Query: 322 MGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFR 381
           +GQFKMMD  F +ESF  HLREY+IPE+LEAYVKG+E+VLK+WFSEAPYNVYAAQQK FR
Sbjct: 261 LGQFKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVLKKWFSEAPYNVYAAQQKAFR 320

Query: 382 EQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTGEVAAGTQSNI 441
           EQ LFADG+ILDIRGV+IVSAK            GCRAQEIHLYR  KTGEVAAG +SNI
Sbjct: 321 EQQLFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQEIHLYRKAKTGEVAAGHESNI 380

Query: 442 LMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           +MSSYAMVFTRDPE IDD+ETEGW+ILEFVRGGSRQFT
Sbjct: 381 MMSSYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQFT 418

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/387 (76%), Positives = 342/387 (88%)

Query: 93  GNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQKGSTI 152
           GNPRSPLQIFR+TFK+EW+KSQELQ+NIK LQDASGK+GESEAYKKAREAYL AQ+GSTI
Sbjct: 45  GNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTI 104

Query: 153 VGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKDVSEVMD 212
           VGKTLKKTG+++E IA KAWESE+GK+TR+A + TA KLDESFEPVR T++YK+VSEV+D
Sbjct: 105 VGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVID 164

Query: 213 SSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESFGKKVDD 272
              SSRYGGFI+KEQRRLK E+D+ASGKR +AVKSN+EAGTA+VAT IE+KESFGKKV+D
Sbjct: 165 DGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVED 224

Query: 273 FKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFKMMDGNF 332
           FKEKTVVGR +Q +K KLWDESENPLIV+MR I NKVGG FAETES+RV  QFKMMD  F
Sbjct: 225 FKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTF 284

Query: 333 NSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLFADGRIL 392
           ++ESF  HLREYI+PE+LEAYVKG+ +VLK+WFSEAP+NVYAAQQK+F+EQ ++ADGRIL
Sbjct: 285 SNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRIL 344

Query: 393 DIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAMVFTR 452
           DIRGV++VSAK            GCRAQEI+LYR  KTGE+AAG ++NILMSSYAMVFTR
Sbjct: 345 DIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTR 404

Query: 453 DPENIDDKETEGWKILEFVRGGSRQFT 479
           DPE IDD ETEGWKILEFVRGGSRQFT
Sbjct: 405 DPEQIDDDETEGWKILEFVRGGSRQFT 431

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/417 (72%), Positives = 354/417 (84%), Gaps = 4/417 (0%)

Query: 67  RMLRPG-RPLKS-VVIRRNLAQT--FKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKA 122
           R L  G RP  + ++I R L  T   +A  GNPRSPLQIFR+TFK+EW KSQELQ+NIK 
Sbjct: 19  RTLAAGCRPQDAGLLIARALFSTSATRAQGGNPRSPLQIFRDTFKKEWDKSQELQENIKT 78

Query: 123 LQDASGKIGESEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQ 182
           LQDASGK+GESEAYKKAREAYL AQ+GSTIVGKTLKKTG++VE IA +AW+SE+GK+TR+
Sbjct: 79  LQDASGKLGESEAYKKAREAYLRAQRGSTIVGKTLKKTGETVEHIATRAWDSELGKNTRK 138

Query: 183 AVNKTAAKLDESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRP 242
           A + TA KLDESFEPVR T++YK+VSEV+D   SSRYGGFI+KEQRRLK E+D+ASGKR 
Sbjct: 139 AASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRH 198

Query: 243 KAVKSNEEAGTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLM 302
           +AVKSN+EAGTA+VAT IE+KESFGKKV+DFKEKT VGR +Q +K +LWDESENPLIV+M
Sbjct: 199 RAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTAVGRSIQSLKNRLWDESENPLIVIM 258

Query: 303 RTIGNKVGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLK 362
           R + NKVGG FAETES+RV  QFKMMD  F++E+F  HLREYI+PE+LEAYVKG+ +VLK
Sbjct: 259 RKVTNKVGGFFAETESSRVYSQFKMMDPTFSNENFTRHLREYIVPEILEAYVKGDVKVLK 318

Query: 363 QWFSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEI 422
           +WFSEAP+NVYAAQQK+F+EQ +FADGRILDIRGV+IVSAK            GCRAQEI
Sbjct: 319 KWFSEAPFNVYAAQQKIFKEQDVFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEI 378

Query: 423 HLYRDVKTGEVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           +LYR  KTGE+AAG ++NILMSSYAMVFTRDPE IDD ETEGWKILEFVRGGSRQFT
Sbjct: 379 NLYRKRKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 435

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/391 (74%), Positives = 342/391 (87%)

Query: 89  KACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQK 148
           +A  GNPRSPLQIFR+TFK+EW+KSQELQ+NIK LQDASGK+GESEAYKKAREAYL AQ+
Sbjct: 41  RAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLRAQR 100

Query: 149 GSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKDVS 208
           GSTIVGKTLKKTG+++E IA KAWESE+GK+TR+A + TA +LDESFEPVR T++YK+VS
Sbjct: 101 GSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKRLDESFEPVRQTKIYKEVS 160

Query: 209 EVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESFGK 268
           EV+D   SSRYGGFI+KEQRRLK E+D+ASGKR +AVKSN+EAGTA+VAT IE+KESFGK
Sbjct: 161 EVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGK 220

Query: 269 KVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFKMM 328
           KV+DF+EKT +GR +Q +K +LWDESENPLIV+MR + NKVGG FAETES+RV  QFK+M
Sbjct: 221 KVEDFREKTAMGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFFAETESSRVHSQFKLM 280

Query: 329 DGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLFAD 388
           D  F++ESF  HLR+YI+PE+LEAYVK + +VLK+WFSEAPYNVYAAQQK+FREQ ++AD
Sbjct: 281 DPTFSNESFTRHLRDYIVPEILEAYVKADVKVLKKWFSEAPYNVYAAQQKIFREQDVYAD 340

Query: 389 GRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAM 448
           GRILDIRGV+IVSAK            GCRAQEI+LYR  KTGE+AAG ++NILMSSYAM
Sbjct: 341 GRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEIAAGNEANILMSSYAM 400

Query: 449 VFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           VFTRDPE IDD ETEGWKILEFVRGGSRQFT
Sbjct: 401 VFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/393 (75%), Positives = 344/393 (87%)

Query: 87  TFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSA 146
           T +A  GNPRSPLQIFR+TFK+EW+KSQELQ+NIK LQDASGK+GESEAYKKAREAYL A
Sbjct: 39  TTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKA 98

Query: 147 QKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKD 206
           Q+GSTIVGKTLKKTG+++E IA KAWESE+GK+TR+A   TA KLDESFEPVR T++YK+
Sbjct: 99  QRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAAAATAKKLDESFEPVRQTKIYKE 158

Query: 207 VSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESF 266
           VSEV+D   SSRYGGFI+KEQRRLK E+D+ASGKR +AVKSNE+AGTA+VAT IE+KESF
Sbjct: 159 VSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESF 218

Query: 267 GKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFK 326
           GKKV+DFKEKTVVGR +Q +K KLWDESENPLIV+MR I NKVGG FAETES+RV  QFK
Sbjct: 219 GKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFK 278

Query: 327 MMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLF 386
           +MD  F++ESF  HLREYI+PE+LEAYVKG+ +VLK+WFSEAP+NVYAAQQK+F+EQ ++
Sbjct: 279 LMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVY 338

Query: 387 ADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTGEVAAGTQSNILMSSY 446
           ADGRILDIRGV+IVSAK            GCRAQEI+LYR  KTGE+AAG ++NILMSSY
Sbjct: 339 ADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSY 398

Query: 447 AMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           AMVFTRDPE IDD ETEGWKILEFVRGGSRQFT
Sbjct: 399 AMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/417 (70%), Positives = 345/417 (82%), Gaps = 15/417 (3%)

Query: 76  KSVVIRRNLAQTFKACQGN-------------PRSPLQIFRETFKQEWKKSQELQDNIKA 122
           +SVV++RN  +    C G+             PR+P+QIFR+TFK+EW+KS++LQDNIKA
Sbjct: 3   RSVVLKRNTPKLL--CSGSIHLFSTSSRVLQGPRTPIQIFRDTFKKEWEKSKDLQDNIKA 60

Query: 123 LQDASGKIGESEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQ 182
           LQDASG++GESEAYKKAREAYL AQKGSTIVGKTL+KTG++VE IA+KAW+SEIGKSTR+
Sbjct: 61  LQDASGRLGESEAYKKAREAYLKAQKGSTIVGKTLQKTGETVEDIASKAWDSEIGKSTRK 120

Query: 183 AVNKTAAKLDESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRP 242
           A + TA K+DESFEPVR T+VYKDVS+V+D  +SSRYGGFI KEQRRLK E D+ SGKR 
Sbjct: 121 AASATARKIDESFEPVRKTQVYKDVSDVIDDGDSSRYGGFIGKEQRRLKRESDLVSGKRV 180

Query: 243 KAVKSNEEAGTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLM 302
           +AVKSN+EAGT++VAT IEAKES GKK++DFKE T  GR +  VK KLWDE+ENPLIV +
Sbjct: 181 RAVKSNDEAGTSIVATNIEAKESLGKKMEDFKENTTAGRTIHGVKVKLWDENENPLIVFL 240

Query: 303 RTIGNKVGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLK 362
           R +  K+GG FAETES+RV+ QFK+MD  F+++SF  HLREYIIPEVLEAYVKG+E VLK
Sbjct: 241 RKVSGKIGGFFAETESSRVLSQFKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDEAVLK 300

Query: 363 QWFSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEI 422
           +WFSEAPYNVYAAQQK FR+Q LF DGRILDIRGV+IVSAK            GCRAQEI
Sbjct: 301 KWFSEAPYNVYAAQQKEFRKQQLFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEI 360

Query: 423 HLYRDVKTGEVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           HLYR VKTGE+AAG +SNILMSSYAMVFTRDPE IDD ETEGWKILEFVRGGSRQFT
Sbjct: 361 HLYRKVKTGEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 417

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/384 (74%), Positives = 328/384 (85%)

Query: 96  RSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQKGSTIVGK 155
           +SPLQIFRETFK EWKKSQELQDNIKALQDASG++GES+AYKKAREAYL AQ+GST+VGK
Sbjct: 35  KSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREAYLKAQRGSTVVGK 94

Query: 156 TLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKDVSEVMDSSN 215
           TLKKTG+++E +  KAW+S+IGK+TR+ V+KTA KLDESFEPVRHTRVYKD+SE++D   
Sbjct: 95  TLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTRVYKDMSELIDDGE 154

Query: 216 SSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESFGKKVDDFKE 275
           SSRYGGFI+KE RR K E D+ASG+R  AV+SN+EAGTA+VAT  E KESFGKK+ DFKE
Sbjct: 155 SSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEGKESFGKKIQDFKE 214

Query: 276 KTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFKMMDGNFNSE 335
           KT +GRKL + K KLWDE+ENPLI ++RTI NK+GGLFAETESARV  QFK++D  FNSE
Sbjct: 215 KTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVFAQFKLLDPTFNSE 274

Query: 336 SFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLFADGRILDIR 395
            F  HLREYIIPEVLEAYVKG+E VLKQW SEAPYNVYAAQQK FREQ LF DGR+LDIR
Sbjct: 275 EFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFREQELFPDGRVLDIR 334

Query: 396 GVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAMVFTRDPE 455
           GV+IVSAK            GCR QEIHLYR  KTGE+AAG +SNI+MSSYAMV TRDPE
Sbjct: 335 GVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNIMMSSYAMVLTRDPE 394

Query: 456 NIDDKETEGWKILEFVRGGSRQFT 479
           N+ DKETEGWK+LEF+RGGSRQFT
Sbjct: 395 NVTDKETEGWKVLEFIRGGSRQFT 418

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/394 (72%), Positives = 335/394 (85%), Gaps = 1/394 (0%)

Query: 87  TFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSA 146
           T ++  G  R+P+QIFR+TFK+EW KSQELQ+NIKAL DASGK+ ESE +K A++AYL A
Sbjct: 39  TARSNGGGGRTPIQIFRDTFKKEWDKSQELQENIKALHDASGKLSESETFKMAKDAYLKA 98

Query: 147 QKGS-TIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYK 205
            KGS TI+ KT++KTG++VE +A+KAW+SEI KSTR+A  KTA  LD+SFEPVR T+VYK
Sbjct: 99  HKGSSTILSKTMQKTGETVENMASKAWDSEIAKSTREAAKKTADTLDKSFEPVRKTQVYK 158

Query: 206 DVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKES 265
           D+SEV+D  +SSRYGGFI+KE+RRLK E D+ASGKR +A+KSNEEAGTALVAT+IEAK+S
Sbjct: 159 DISEVIDDGDSSRYGGFITKEERRLKRESDLASGKRQRAIKSNEEAGTALVATDIEAKQS 218

Query: 266 FGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQF 325
           FGKKV+DFKEKTVVG+ +  VK KLWDESENPLIV +R I NK+GG F ETESARV  QF
Sbjct: 219 FGKKVEDFKEKTVVGKTMSSVKVKLWDESENPLIVFLRKITNKIGGFFDETESARVYTQF 278

Query: 326 KMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGL 385
           KMMD  F +E F  HLREYI+PE+LEAY+KG+E+VLK+WFSEAP+NVY+AQQKVFREQGL
Sbjct: 279 KMMDATFTNEGFTRHLREYIVPELLEAYIKGDEKVLKKWFSEAPFNVYSAQQKVFREQGL 338

Query: 386 FADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTGEVAAGTQSNILMSS 445
           F+DGRILDIRGV+IVSAK            GCRAQEI+LYR VKTGE+AAG QSNILMSS
Sbjct: 339 FSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKVKTGEIAAGDQSNILMSS 398

Query: 446 YAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           YAMVFTRDPE IDD ETEGWKILEFVRGGSRQFT
Sbjct: 399 YAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 432

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/402 (72%), Positives = 338/402 (84%), Gaps = 1/402 (0%)

Query: 78  VVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYK 137
           V+  R  + T  A  G P+SPLQ+FRETFK+EWKKSQELQDNIKALQDA G++GES+AYK
Sbjct: 18  VLAARGFSATRWAGNG-PKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYK 76

Query: 138 KAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEP 197
           KAREAYL AQKGSTIVGKTLK+TG+++E I  +AWESEIGK+TR+ V+KTA KLDESFEP
Sbjct: 77  KAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEP 136

Query: 198 VRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVA 257
           VR T+VYKD+SE++D   SSRYGGF+ KE+RR K E+D+A+GKR   V+SNEEAG+ALVA
Sbjct: 137 VRQTKVYKDMSEIIDDGESSRYGGFMEKERRREKRERDLATGKRATPVRSNEEAGSALVA 196

Query: 258 TEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETE 317
           T+ EA ES GKK+ DFKEKTVVGRKL ++K +LWDE+ENPLI L+RTI NKVGGLFAETE
Sbjct: 197 TDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETE 256

Query: 318 SARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQ 377
           SARV  QFK++D  FN+E F  HLREYIIPEVLEAYVKG+EQVLKQWFSEAPYNVY+AQQ
Sbjct: 257 SARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQ 316

Query: 378 KVFREQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTGEVAAGT 437
           K  R+Q LFADGRILDIRGV+I+SAK            GCRAQEIHL+R   TGE+AAG 
Sbjct: 317 KQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGH 376

Query: 438 QSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           +SNI++SSYAMV TRDPE +DDKETEGWKILEFVRGGSR FT
Sbjct: 377 ESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/407 (70%), Positives = 335/407 (82%), Gaps = 1/407 (0%)

Query: 73  RPLKSVVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGE 132
           R    V++ R    T      NPRSPLQIFRETFK+EW+KSQELQDNIK LQDASG++GE
Sbjct: 5   RSTSGVLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGE 64

Query: 133 SEAYKKAREAYLSAQKGS-TIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKL 191
           SEAYKKAREAYL A KGS TIVGKTL+KTG++VE++A KAW+S+I K+TR   +KTA KL
Sbjct: 65  SEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKL 124

Query: 192 DESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEA 251
           DESFEPVR T++YKDVSEV+D  +SS YGGFI+KEQRRLK E+D+ASGKR +AVKSN+EA
Sbjct: 125 DESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEA 184

Query: 252 GTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGG 311
           G+ALVAT+IEAKES GKK++DFKEKT VGR L+ VK  LWDESENPLIV +R I  K+GG
Sbjct: 185 GSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGG 244

Query: 312 LFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYN 371
            FAETESARV  QFKM+D  F +  F  HLR+YI+PEVLEAYVKG+E+VLK+WFSEAP+N
Sbjct: 245 FFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFN 304

Query: 372 VYAAQQKVFREQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTG 431
           VY AQQK+F++Q LF+DG+ILDIRGV++VSAK            GCRAQEIHLYR  KTG
Sbjct: 305 VYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTG 364

Query: 432 EVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQF 478
           E+AAG +SNILMSSYAMVFTRDPE IDD ETEGWKILEF+RG SR F
Sbjct: 365 EIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/407 (69%), Positives = 349/407 (85%), Gaps = 5/407 (1%)

Query: 76  KSVVIRRNLA---QTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGE 132
           K +V +R++A    + ++ QG  RSPLQIFR+TFK+EW+KSQELQ+NIK LQDASG++G+
Sbjct: 3   KGIVTQRSVALFSTSSRSLQG--RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGD 60

Query: 133 SEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLD 192
           SE  K+AREAYL AQKGSTIVGKTL+KTG++VE IA+KAWESEI KSTR A + TA KLD
Sbjct: 61  SEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIAKSTRSAASATAKKLD 120

Query: 193 ESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAG 252
           +SFEPVR+T++YKDVSEVM+ +++SRYGGF++KEQR++K E++IASGKR +A++SNEEAG
Sbjct: 121 KSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAG 180

Query: 253 TALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGL 312
           TALVAT IEAKES GKKV+DF+EKT +GR +Q +K +LW+E+ENPLIV++R I NKVGG 
Sbjct: 181 TALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGF 240

Query: 313 FAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNV 372
           FAETE+A+V+GQFK++D +F SE F   LR+Y+IPEVLEAY KG+E+ LK+WFSEAP+NV
Sbjct: 241 FAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNV 300

Query: 373 YAAQQKVFREQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTGE 432
           YAAQQK FR+Q LFAD RILDIRGVDIVSAK            GCRAQEI LYR +K+GE
Sbjct: 301 YAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGE 360

Query: 433 VAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           VAAG +SNILMSSYAMVFTRDPEN++D+ETEGW+I+EFVRGGSRQFT
Sbjct: 361 VAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/387 (71%), Positives = 330/387 (85%)

Query: 93  GNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQKGSTI 152
           G  ++P+QIFRETFK+EW+KSQELQDNIK LQDASG++G+SEAYKKA+EAY+ AQ+ STI
Sbjct: 30  GGGKTPIQIFRETFKKEWEKSQELQDNIKTLQDASGRLGQSEAYKKAKEAYVKAQQSSTI 89

Query: 153 VGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKDVSEVMD 212
           V KTLKKTG++VE +A K W+SEIGKSTR+ V++ A K+DESFEPVR T+VYK+VSEV+D
Sbjct: 90  VSKTLKKTGETVEDLAKKTWDSEIGKSTRKVVSQGAKKIDESFEPVRQTQVYKEVSEVID 149

Query: 213 SSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESFGKKVDD 272
              SSRYGGFISKEQRR K E D+ASGKR +A KSNEEAGTA+VAT +E+KESFGKK+DD
Sbjct: 150 DGESSRYGGFISKEQRRKKREADLASGKRVRATKSNEEAGTAIVATNVESKESFGKKIDD 209

Query: 273 FKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFKMMDGNF 332
           FKEKTVVG+ ++  K ++WDE+ENPLIV++RTI NK+ G FAETES+RV  QFK+MD  F
Sbjct: 210 FKEKTVVGKTMKSFKVRVWDENENPLIVVLRTISNKISGFFAETESSRVYSQFKLMDPTF 269

Query: 333 NSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLFADGRIL 392
           ++ +F  HLR+YIIPEVLEAYVKG+E VLK+WFSEAP+NVYAAQQK  R+Q LF DGRIL
Sbjct: 270 SNAAFTKHLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFNVYAAQQKELRKQQLFTDGRIL 329

Query: 393 DIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAMVFTR 452
           DIRGVDIVSAK            GCRAQE+HLYR VKTGE+ AG +SNI+MSSYAMVFTR
Sbjct: 330 DIRGVDIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTGELGAGDESNIMMSSYAMVFTR 389

Query: 453 DPENIDDKETEGWKILEFVRGGSRQFT 479
           DP+NIDD ETEGWKILEFVRGGSRQFT
Sbjct: 390 DPDNIDDDETEGWKILEFVRGGSRQFT 416

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/386 (71%), Positives = 330/386 (85%)

Query: 93  GNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQKGSTI 152
           G  R+P+QIFR+TFK+EW+KSQELQDNIKAL DASGK+ ESE +K A++AYL A KGSTI
Sbjct: 48  GGGRTPIQIFRDTFKKEWEKSQELQDNIKALHDASGKLSESETFKMAKDAYLKAHKGSTI 107

Query: 153 VGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKDVSEVMD 212
           V KTLKKTG++VE +A+KAW+SEIGK+TR A  KTA  +D+SFEPVR T++YKDVSEV+D
Sbjct: 108 VSKTLKKTGETVETMASKAWDSEIGKNTRIAAKKTAETIDKSFEPVRKTQIYKDVSEVID 167

Query: 213 SSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESFGKKVDD 272
             +SSRYGGFI+KE+R+LK E+D+ASGKR +AVKSN+EAGTALVAT IEAKESFGKKV+D
Sbjct: 168 DGDSSRYGGFITKEERKLKRERDLASGKRQRAVKSNDEAGTALVATNIEAKESFGKKVED 227

Query: 273 FKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFKMMDGNF 332
           FKEKTVVG+ ++ VK KLWDESENPLIV +R I NK+ G F ETESA+V  QFK+MD  F
Sbjct: 228 FKEKTVVGKTMKTVKMKLWDESENPLIVTLRKISNKISGFFDETESAKVYTQFKLMDTTF 287

Query: 333 NSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLFADGRIL 392
            ++ F  HLR+YI+PE+LEAY+KG+E+VLK+WFSEAP+NVYAAQQKVFREQGLF+DGRIL
Sbjct: 288 TNDGFTRHLRDYIVPEILEAYIKGDEKVLKKWFSEAPFNVYAAQQKVFREQGLFSDGRIL 347

Query: 393 DIRGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAMVFTR 452
           DIRGV+IVSAK            GCRAQEI+LY+  K+GE+AAG +SNI+MSSYAMVFTR
Sbjct: 348 DIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYKKAKSGEIAAGDESNIVMSSYAMVFTR 407

Query: 453 DPENIDDKETEGWKILEFVRGGSRQF 478
           DPE IDD ETEGWKILEFVRGGSR F
Sbjct: 408 DPEQIDDDETEGWKILEFVRGGSRPF 433

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/416 (67%), Positives = 342/416 (82%), Gaps = 2/416 (0%)

Query: 66  FRMLRPGRPLKSVVIRRNLAQTFKACQG--NPRSPLQIFRETFKQEWKKSQELQDNIKAL 123
           ++ +RP      VV R  L        G  +PRSPL IFR+TFK+EW+KSQELQ+NI+ L
Sbjct: 4   YKTVRPASAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTL 63

Query: 124 QDASGKIGESEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQA 183
           QDASGKIGE+EAY+KAREA+L AQKGSTIVGKTLKKTG++VE IA+KAW+SEI K++R+A
Sbjct: 64  QDASGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKA 123

Query: 184 VNKTAAKLDESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPK 243
             KTA KLDE FEPVR T++YKDVSEV+D  +S+ YGGF ++E+R+ + E+ +ASG+R +
Sbjct: 124 AVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTREERQRRREKALASGERVR 183

Query: 244 AVKSNEEAGTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMR 303
           AVKSN+EAGTALVAT +E+KES GKK++DFKEKT VGR L  +K +LWDESENPLIV MR
Sbjct: 184 AVKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMR 243

Query: 304 TIGNKVGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQ 363
            +  KVG  FAETES RV  QFK+MD NFNS +F  HLREY++PE+LEAYV+G+E+VLK+
Sbjct: 244 KVSGKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKK 303

Query: 364 WFSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQEIH 423
           WFSEAPYNVYAAQQK+F+E+ LFADGRILDIRGV+IVSAK            GCRAQEI+
Sbjct: 304 WFSEAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKLLQPQDLPVLVVGCRAQEIN 363

Query: 424 LYRDVKTGEVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           LY+ VKTGE+AAG++SNILMSSYAMVFTRDPE + D+ETEGWKILEFVRGGSRQFT
Sbjct: 364 LYKKVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 327/418 (78%), Gaps = 9/418 (2%)

Query: 64  GKFRMLRPGRPLKSVVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKAL 123
           GK   L+    L S+   RNL Q         R+PLQIFRETFK+EW+KS ELQ +IK L
Sbjct: 11  GKPYYLKSAIQLVSLHTSRNLGQ-------QQRTPLQIFRETFKKEWEKSAELQGSIKEL 63

Query: 124 QDASGKIGESEAYKKAREAYLSAQKGS-TIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQ 182
           QDASGKI ESEAYKKAR+AYL A +GS TI+ KTLKKTGD++E IA KAWESEI K+TRQ
Sbjct: 64  QDASGKISESEAYKKARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQ 123

Query: 183 AVNKTAAKLDESFEPVRHTRVYKDVSEVM-DSSNSSRYGGFISKEQRRLKLEQDIASGKR 241
             ++TA KLDESFEPVR+T++YKDVSEV+ D  +S RYGGFI K++RRLK E  + SGKR
Sbjct: 124 MASETAKKLDESFEPVRNTKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKR 183

Query: 242 PKAVKSNEEAGTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVL 301
            +AVKSN+EAGTALVAT +++ ES G+K ++FKE+T+VG+ L + K   WDESENPLIVL
Sbjct: 184 VRAVKSNDEAGTALVATNVQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVL 243

Query: 302 MRTIGNKVGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVL 361
           +R I  K+ G F ETES+RV  QFK++D  FN+ESF  HLREYI+PE+LEAY+KG+E+VL
Sbjct: 244 LRKITLKITGFFGETESSRVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVL 303

Query: 362 KQWFSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKXXXXXXXXXXXXGCRAQE 421
           K WFSEAP+NVY+AQQKVFR+Q LF DG ILDIR V+IVSAK             CRAQE
Sbjct: 304 KNWFSEAPFNVYSAQQKVFRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQE 363

Query: 422 IHLYRDVKTGEVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479
           I++YR +KTGEVAAG  S+ILMS+YAMVFTRDPE ID+ ETEGW+ILEFVRG SRQFT
Sbjct: 364 INIYRKIKTGEVAAGNASDILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  485 bits (1248), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 231/389 (59%), Positives = 303/389 (77%), Gaps = 9/389 (2%)

Query: 96  RSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQKGSTIVGK 155
           ++P+QIFRETFKQEW+KS  LQD IK L DAS +I +S+A+KKA++AY +    +TI+ K
Sbjct: 37  KTPIQIFRETFKQEWEKSATLQDQIKTLTDASDRINQSDAFKKAKDAYKNVSNQTTILSK 96

Query: 156 TLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKDVSEVMDS-S 214
           T+ KTG  +   A KAW+S++ + T+ A    A KLD+SFEPVR+T++YKDVSEV+D   
Sbjct: 97  TISKTGTKLNDAALKAWDSDLAQKTKLA----AKKLDDSFEPVRNTKIYKDVSEVIDDKD 152

Query: 215 NSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESFGKKVDDFK 274
           NS +YGGFISKE+RR K   D+ +GKR K +KSN+EAGTAL+AT++++KES  +K++DFK
Sbjct: 153 NSYKYGGFISKEERRSKRISDLQTGKRMKPIKSNDEAGTALIATDLKSKESINEKLNDFK 212

Query: 275 EKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFKMMDGNFNS 334
           EKTVVG+ +  +K K+WDE++NPLIV MR +       FAETES+RV+ QFK++D NFN+
Sbjct: 213 EKTVVGQTMTSIKTKVWDENDNPLIVGMRKVTGVFNRFFAETESSRVLTQFKLIDPNFNN 272

Query: 335 ESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLFADGRILDI 394
           ESFL  LREYIIPEVLEAY+KG+E++LK WFSEAPYNVY+AQQK  R+Q +F+DGR+LDI
Sbjct: 273 ESFLRSLREYIIPEVLEAYIKGDEKILKNWFSEAPYNVYSAQQKELRKQKIFSDGRVLDI 332

Query: 395 RGVDIVSAKXXXXXXXXXXXXGCRAQEIHLYR----DVKTGEVAAGTQSNILMSSYAMVF 450
           RGVDIV+AK             CRAQEI++Y+    + +T ++ AG  SNILMS+YAMVF
Sbjct: 333 RGVDIVTAKMLPPQDIPVIVVSCRAQEINIYKKFNVEKQTNDIVAGHDSNILMSTYAMVF 392

Query: 451 TRDPENIDDKETEGWKILEFVRGGSRQFT 479
           TRDPE +D+ ETEGWKILEFVRGGSR+FT
Sbjct: 393 TRDPEQLDNDETEGWKILEFVRGGSRKFT 421

>YLR005W Chr12 (160049..161434) [1386 bp, 461 aa] {ON}
           SSL1Component of the core form of RNA polymerase
           transcription factor TFIIH, which has both protein
           kinase and DNA-dependent ATPase/helicase activities and
           is essential for transcription and nucleotide excision
           repair; interacts with Tfb4p
          Length = 461

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 14/124 (11%)

Query: 78  VVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYK 137
           +++R  LAQ      GNP+  +   +   KQE K +  LQ+   AL+ A G +    A+ 
Sbjct: 172 IIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQN---ALEMARGLLLPVPAH- 227

Query: 138 KAREAYLSAQKGSTIVGKTLKKTGDSV--EKIAAKAWESEIGKSTRQAVNKTAAKL---- 191
             RE  +     ST     + +T DS+  EKI  K     +G S + A+ K   K     
Sbjct: 228 CTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKV----LGLSAQVAICKELCKATNYG 283

Query: 192 DESF 195
           DESF
Sbjct: 284 DESF 287

>Skud_12.71 Chr12 (151308..152696) [1389 bp, 462 aa] {ON} YLR005W
           (REAL)
          Length = 462

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 14/124 (11%)

Query: 78  VVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYK 137
           +++R  LAQ      GNP+  +   +   KQE K +  LQ+   AL+ A G +    A+ 
Sbjct: 173 IIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQN---ALEMARGLLLPVPAH- 228

Query: 138 KAREAYLSAQKGSTIVGKTLKKTGDSV--EKIAAKAWESEIGKSTRQAVNKTAAKL---- 191
             RE  +     ST     + +T DS+  EKI  K     +G S + A+ K   K     
Sbjct: 229 CTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKV----LGLSAQVAICKELCKATNYG 284

Query: 192 DESF 195
           DESF
Sbjct: 285 DESF 288

>Suva_10.83 Chr10 (165557..166957) [1401 bp, 466 aa] {ON} YLR005W
           (REAL)
          Length = 466

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 14/124 (11%)

Query: 78  VVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYK 137
           +++R  LAQ      GNP+  +   +   KQE K +  LQ+   AL+ A G +    A+ 
Sbjct: 177 IIMRNGLAQLVSQVSGNPQDHIDALKAIRKQEPKGNPSLQN---ALEMARGLLLPVPAH- 232

Query: 138 KAREAYLSAQKGSTIVGKTLKKTGDSV--EKIAAKAWESEIGKSTRQAVNKTAAKL---- 191
             RE  +     ST     + +T DS+  EKI  K     +G S + A+ K   K     
Sbjct: 233 CTREVLIVFGSLSTTDPGDIHQTIDSLVDEKIRVKV----LGLSAQVAICKELCKATNYG 288

Query: 192 DESF 195
           DESF
Sbjct: 289 DESF 292

>Smik_12.67 Chr12 (147119..148495) [1377 bp, 458 aa] {ON} YLR005W
           (REAL)
          Length = 458

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 14/124 (11%)

Query: 78  VVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYK 137
           +++R  LAQ      GNP+  +   +   KQE K +  LQ+   AL+ A G +    A+ 
Sbjct: 169 IIMRNGLAQLVSQVSGNPQDHVDALKSIRKQEPKGNPSLQN---ALEMARGLLLPVPAH- 224

Query: 138 KAREAYLSAQKGSTIVGKTLKKTGDSV--EKIAAKAWESEIGKSTRQAVNKTAAKL---- 191
             RE  +     ST     + +T DS+  EKI  K     +G S + A+ K   K     
Sbjct: 225 CTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKV----LGLSAQVAICKELCKATNYG 280

Query: 192 DESF 195
           DESF
Sbjct: 281 DESF 284

>KNAG0B05150 Chr2 complement(987516..988925) [1410 bp, 469 aa] {ON}
           Anc_5.226 YLR005W
          Length = 469

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 52/123 (42%), Gaps = 12/123 (9%)

Query: 78  VVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYK 137
           V++R  LA    +  GNP+  L   +   KQE K +  LQ+   AL+ A G +    ++ 
Sbjct: 181 VIMRNGLAHLVSSVSGNPQDHLDALKHMRKQEPKGNPSLQN---ALELARGLLLPVPSHS 237

Query: 138 KAREAYLSAQKGSTIVGKTLKKTGDSV-EKIAAKAWESEIGKSTRQAVNKTAAKL----D 192
                 +     ST  G   +     V EKI  K     IG S + AV K   KL    D
Sbjct: 238 TREVLIIFGSLSSTDPGDIHQTIASLVDEKIRVKV----IGLSAQVAVCKELCKLTNFGD 293

Query: 193 ESF 195
           +SF
Sbjct: 294 DSF 296

>Smik_6.57 Chr6 (111118..112689) [1572 bp, 523 aa] {ON} YFL021W
           (REAL)
          Length = 523

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 46/101 (45%), Gaps = 2/101 (1%)

Query: 98  PLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSA--QKGSTIVGK 155
           PL +  +  K+  + S ++ +NI     +S  IG +   KK   A ++A  +K S  +  
Sbjct: 352 PLSLKTDIIKKRQRSSTKINNNITPPPSSSSNIGAAATKKKNYTASVAASKRKNSLNIVA 411

Query: 156 TLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFE 196
            LK     + K+A+ +    +  + R  ++ +A    E+F 
Sbjct: 412 PLKSQDIPIPKVASPSIPQHLRSNNRHHLSSSAPIGAETFS 452

>KAFR0B06030 Chr2 (1247049..1247765) [717 bp, 238 aa] {ON} Anc_8.372
           YDR174W
          Length = 238

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 59/136 (43%), Gaps = 20/136 (14%)

Query: 34  SLDTVILTVKKFDILISYVLNSINQKG--VARGKFRMLR--------PGRPLK-----SV 78
           SL T+     +F  + S +LN ++ +   +A  K  + R        P +PL      S 
Sbjct: 51  SLQTLTSATNQFHSISSDLLNPVDDEKEIIAPSKTPLKRKVERDPNAPKKPLTVFFAYSA 110

Query: 79  VIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKK 138
            +R+ L    +     P S  +I +E  K+ WK   EL DN K     +  + E   Y+K
Sbjct: 111 YVRQELRDARQKAGLPPLSSTEITQEISKK-WK---ELSDNEKEKWKQAYNV-ELTHYQK 165

Query: 139 AREAYLSAQKGSTIVG 154
           A++ YL A+K  T   
Sbjct: 166 AKQDYLEAKKNGTFTA 181

>KNAG0A04840 Chr1 complement(694692..695408,695676..695720) [762 bp,
           253 aa] {ON} Anc_8.372 YDR174W
          Length = 253

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 19/133 (14%)

Query: 34  SLDTVILTVKKFDILISYVLNSIN-QKGVARGKFRMLR--------PGRPLK-----SVV 79
           SL  +     +F  + S +LN ++ +K   R K  M R        P +PL      S  
Sbjct: 58  SLQMLTAATDQFGGITSDLLNPLDDEKDAGRAKTPMKRKVERDPNAPKKPLTVFFAYSAY 117

Query: 80  IRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKA 139
           +R+ L    +     P S  +I +E  K+ WK   EL D  K     +  + E E Y+KA
Sbjct: 118 VRQELRDARQKAGLAPLSSTEITQEISKK-WK---ELSDAEKEKWKQAYHV-ELEHYQKA 172

Query: 140 REAYLSAQKGSTI 152
           ++ YL  +K  T+
Sbjct: 173 KQEYLENKKNGTL 185

>Kwal_33.15246 s33 complement(1030094..1031503) [1410 bp, 469 aa]
           {ON} YLR005W (SSL1) - Component of RNA polymerase
           transcription factor TFIIH [contig 94] FULL
          Length = 469

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 65/153 (42%), Gaps = 17/153 (11%)

Query: 40  LTVKKFDILISYVLNSINQKGVARGKFRMLRPGRPLKSVVIRRNLAQTFKACQGNPRSPL 99
           L   ++ + I Y +N +++       F    P   +  V +R +LAQ      GNP+  +
Sbjct: 150 LRPNRYAMTIQYAINFVHE-------FFDQNPISQIGIVCMRNDLAQLVSQVSGNPQDHI 202

Query: 100 QIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQKGSTIVGKTLKK 159
              +   KQE K +  LQ+   AL+ A G +    A+   RE  +     S+     + +
Sbjct: 203 DALKAIRKQEPKGNSSLQN---ALEMARGLLLHVPAH-CTREVLIVFGALSSTDPGDIHQ 258

Query: 160 TGDSV--EKIAAKAWESEIGKSTRQAVNKTAAK 190
           T  S+  E+I  +     IG S + AV K   K
Sbjct: 259 TMSSLVQERIRVRV----IGLSAQVAVCKELCK 287

>KLTH0B02794g Chr2 (217284..218696) [1413 bp, 470 aa] {ON} highly
           similar to uniprot|Q04673 YLR005W Saccharomyces
           cerevisiae SSL1 Component of RNA polymerase
           transcription factor TFIIH
          Length = 470

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 61/152 (40%), Gaps = 15/152 (9%)

Query: 40  LTVKKFDILISYVLNSINQKGVARGKFRMLRPGRPLKSVVIRRNLAQTFKACQGNPRSPL 99
           L   ++ + I Y +N +++       F    P   +  V +R +LAQ      GNP+  +
Sbjct: 150 LRPNRYAMTIQYAINFVHE-------FFDQNPISQIGIVCMRNDLAQLVSQVSGNPQDHI 202

Query: 100 QIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQKGSTIVGKTLKK 159
              +   KQE K +  LQ+   AL+ A G +    A+       +     ST  G   + 
Sbjct: 203 DALKAIRKQEPKGNSSLQN---ALEMARGLLLHVPAHCTREVLIIFGALSSTDPGDIHQT 259

Query: 160 TGDSV-EKIAAKAWESEIGKSTRQAVNKTAAK 190
               V E+I  +     IG S + A+ K   K
Sbjct: 260 IASLVQERIRVRV----IGLSAQVAICKELCK 287

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,631,581
Number of extensions: 1817639
Number of successful extensions: 7102
Number of sequences better than 10.0: 96
Number of HSP's gapped: 7397
Number of HSP's successfully gapped: 97
Length of query: 479
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 366
Effective length of database: 40,524,141
Effective search space: 14831835606
Effective search space used: 14831835606
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)