Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E04048g8.773ON45445424340.0
Kwal_55.202668.773ON45744820500.0
SAKL0B05412g8.773ON45145417440.0
YMR238W (DFG5)8.773ON45844316820.0
Suva_13.4228.773ON45845316810.0
Kpol_1030.208.773ON45145416330.0
KLLA0F24926g8.773ON45144416240.0
CAGL0M05049g8.773ON45345116240.0
KAFR0B034908.773ON45144916240.0
NDAI0K008408.773ON45945016220.0
Skud_13.4078.773ON45843616210.0
TBLA0B033208.773ON45045516140.0
NCAS0C008108.773ON45144616110.0
Smik_13.4468.773ON45843616050.0
KNAG0J007008.773ON46342615660.0
TDEL0B033608.773ON43644015440.0
TPHA0J016008.773ON46145815340.0
ZYRO0F12210g8.773ON45344414810.0
Ecym_14748.773ON45445514500.0
AFR530W8.773ON45944713930.0
ACL200WsingletonON46343613490.0
NCAS0A08740singletonON43439913450.0
ACL201WsingletonON44843613280.0
NCAS0A08730singletonON63139012941e-174
KLLA0E07723g2.570ON45044812471e-169
NDAI0C006802.570ON45244512321e-167
ACL202WsingletonON45042812301e-166
SAKL0D13574g2.570ON45144912211e-165
Suva_11.1802.570ON45043712181e-165
KLTH0D08008g2.570ON44843612181e-165
Smik_11.2022.570ON44943712141e-164
YKL046C (DCW1)2.570ON44943712091e-163
TBLA0C03850singletonON56739812191e-163
TPHA0I024702.570ON45245012001e-162
NCAS0A127502.570ON44744112001e-162
Kwal_26.82252.570ON44944311941e-161
Skud_11.1832.570ON44943711911e-161
KAFR0I017402.570ON44845111771e-158
KAFR0A021702.570ON44945311751e-158
NCAS0H029002.570ON45345011731e-158
NDAI0B015102.570ON44743811661e-157
TBLA0H02590singletonON45044211591e-156
TBLA0H02580singletonON44943611301e-151
ABR060W2.570ON45143611221e-150
TDEL0B065802.570ON44743511091e-148
CAGL0L01727g2.570ON44644311081e-148
Kpol_1056.42.570ON45044611021e-147
TBLA0H026002.570ON44943610971e-146
Ecym_45772.570ON45044410861e-145
KNAG0A071802.570ON46340510681e-142
ZYRO0E06380g2.570ON45344910641e-141
Kpol_370.81.485ON541131790.43
TPHA0F033601.485ON583129741.7
Skud_10.2491.157ON88145705.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E04048g
         (454 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   942   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   794   0.0  
SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   676   0.0  
YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   652   0.0  
Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   652   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   633   0.0  
KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   630   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   630   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   630   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   629   0.0  
Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   629   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   626   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   625   0.0  
Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   622   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   607   0.0  
TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   599   0.0  
TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   595   0.0  
ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   575   0.0  
Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   563   0.0  
AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   541   0.0  
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   524   0.0  
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            522   0.0  
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   516   0.0  
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            503   e-174
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   484   e-169
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   479   e-167
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   478   e-166
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   474   e-165
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   473   e-165
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   473   e-165
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   472   e-164
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   470   e-163
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              474   e-163
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   466   e-162
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   466   e-162
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   464   e-161
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   463   e-161
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   457   e-158
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   457   e-158
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    456   e-158
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   453   e-157
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   451   e-156
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   439   e-151
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   436   e-150
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   431   e-148
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   431   e-148
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   429   e-147
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   427   e-146
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   422   e-145
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            416   e-142
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   414   e-141
Kpol_370.8 s370 complement(14523..16148) [1626 bp, 541 aa] {ON} ...    35   0.43 
TPHA0F03360 Chr6 complement(723915..725666) [1752 bp, 583 aa] {O...    33   1.7  
Skud_10.249 Chr10 complement(439686..442331) [2646 bp, 881 aa] {...    32   5.1  

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  942 bits (2434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/454 (100%), Positives = 454/454 (100%)

Query: 1   MLAQSFALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPY 60
           MLAQSFALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPY
Sbjct: 1   MLAQSFALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPY 60

Query: 61  YWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWG 120
           YWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWG
Sbjct: 61  YWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWG 120

Query: 121 LTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYK 180
           LTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYK
Sbjct: 121 LTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYK 180

Query: 181 NTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDN 240
           NTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDN
Sbjct: 181 NTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDN 240

Query: 241 CTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTC 300
           CTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTC
Sbjct: 241 CTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTC 300

Query: 301 QDSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCG 360
           QDSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCG
Sbjct: 301 QDSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCG 360

Query: 361 LNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVL 420
           LNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVL
Sbjct: 361 LNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVL 420

Query: 421 QSDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454
           QSDIKITHKDKVGASIITAVILAVLVGGSIWMIF
Sbjct: 421 QSDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/448 (83%), Positives = 405/448 (90%)

Query: 7   ALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAG 66
           AL A+    +  IDLDTS   SICDATSLIQ G+MDYY G R GGTVGMFQQPYYWWEAG
Sbjct: 10  ALGAVFTSQVSAIDLDTSSKDSICDATSLIQKGVMDYYEGNRFGGTVGMFQQPYYWWEAG 69

Query: 67  EVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSA 126
           EVFGGM+ENWFLCQNDTY   +YDAMI QAGPDYDFMPSNQSMVEGNDDQGVWGLT+MSA
Sbjct: 70  EVFGGMMENWFLCQNDTYEKTLYDAMIAQAGPDYDFMPSNQSMVEGNDDQGVWGLTLMSA 129

Query: 127 AERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNA 186
            ERNFTNPTE GVPGWLAM QGVFNTMW RWDS+HCGGG+RWQIFTWNSGYNYKNTVSNA
Sbjct: 130 VERNFTNPTEKGVPGWLAMVQGVFNTMWSRWDSDHCGGGLRWQIFTWNSGYNYKNTVSNA 189

Query: 187 CMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVK 246
           C+FQLAARLGRYTGN+TYLTKAETVW+WLVD+GFV  NE+GNANVYDGA ID NCTDIV+
Sbjct: 190 CLFQLAARLGRYTGNETYLTKAETVWNWLVDIGFVRFNESGNANVYDGATIDKNCTDIVE 249

Query: 247 NEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTC 306
            EWSYNQGIVLGGAAYMYNAT N TS W+SRL+QIVGGST+ FF++K+MYE+TCQDS  C
Sbjct: 250 IEWSYNQGIVLGGAAYMYNATHNGTSDWESRLNQIVGGSTDIFFRNKIMYEATCQDSGKC 309

Query: 307 NQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLG 366
           NQDQRSFKSIFSRMLSLTR+LAPYTA+ IDPLM+ASAEGAAKSCTGGTDGHTCGLNW+ G
Sbjct: 310 NQDQRSFKSIFSRMLSLTRTLAPYTADKIDPLMKASAEGAAKSCTGGTDGHTCGLNWEKG 369

Query: 367 YHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKI 426
            HDG+YGLGEQACALEGIQS +YS RPAPYT+DNGG+SVGDTEA LN TSTNVL SD+ I
Sbjct: 370 EHDGWYGLGEQACALEGIQSQLYSMRPAPYTADNGGTSVGDTEAGLNKTSTNVLHSDLNI 429

Query: 427 THKDKVGASIITAVILAVLVGGSIWMIF 454
           T KDKVGASIITAV+LAVLVGGSIWMIF
Sbjct: 430 TQKDKVGASIITAVLLAVLVGGSIWMIF 457

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/454 (68%), Positives = 379/454 (83%), Gaps = 3/454 (0%)

Query: 1   MLAQSFALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPY 60
           M++   +L  + L  +  IDLDTS   SIC ATSLIQ G++DYY GT+ GGTVGMFQ PY
Sbjct: 1   MISLLISLIYMSLNIVHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPY 60

Query: 61  YWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWG 120
           YWW+AGE FGGML+N +LC N+TY D+IYDAMI Q G +YD++P+NQSMVEGNDDQGVWG
Sbjct: 61  YWWQAGEAFGGMLDNIYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWG 120

Query: 121 LTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYK 180
           +T+M A ERNFTNPT++GVPGWLAM Q VFNTM+ RWDS+HCGGG+RWQIFTWNSGYNYK
Sbjct: 121 ITIMGAVERNFTNPTKEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYK 180

Query: 181 NTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDN 240
           NT++N C+FQ+AARLGRYTGNDTYL  A  VWDWL DVGFVVL +   ANV+DGANI++N
Sbjct: 181 NTIANGCLFQIAARLGRYTGNDTYLEVASKVWDWLEDVGFVVLQD--KANVFDGANIENN 238

Query: 241 CTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTC 300
           C+ IVK EW+YN G+VLGGAAYMYNAT N + +W++RL Q++ G+ EFFF + +MYE  C
Sbjct: 239 CSSIVKIEWTYNHGVVLGGAAYMYNAT-NGSDIWQTRLTQVLDGAVEFFFNNSIMYERAC 297

Query: 301 QDSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCG 360
           Q S TCN DQRSFKSIFSRML LT  LAP+T +TIDPL++ASAEGAA+SCTGGTDGHTCG
Sbjct: 298 QGSGTCNNDQRSFKSIFSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCG 357

Query: 361 LNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVL 420
           L+W LG+HDGYYGLGEQ  ALE +Q+L+    P P+T+DNGGSSVGD  A LNS+S NVL
Sbjct: 358 LDWTLGHHDGYYGLGEQMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVL 417

Query: 421 QSDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454
           ++++ ITHKD+VGA+IITA++L V++GGS+WM+F
Sbjct: 418 ENNLSITHKDRVGAAIITAIVLGVMIGGSVWMVF 451

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/443 (68%), Positives = 362/443 (81%), Gaps = 4/443 (0%)

Query: 12  LLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGG 71
             +    +DLDT+  +SICDAT+LIQGG++DYY GTR GGTVGMFQ PYYWW AGE FGG
Sbjct: 20  FFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGG 79

Query: 72  MLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNF 131
           MLENWFLC+NDTY +++YDA++ Q G +YD++PSNQ+MVEGNDDQG+WG+TVM A ERNF
Sbjct: 80  MLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNF 139

Query: 132 TNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQL 191
           T+P  DG PGWLAM Q VFNTM+ RWDSEHCGGG+RWQIFTWNSGYNYKNTVSNAC+FQ+
Sbjct: 140 TDP-GDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQI 198

Query: 192 AARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSY 251
           AARLGRYTGN TYL  AE V+DWLVDVG+VVLN+   ANV+DGA ID NCTDI K EW+Y
Sbjct: 199 AARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDT--ANVFDGAEIDTNCTDITKIEWTY 256

Query: 252 NQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQR 311
           N GIVLGG AYMYNAT N T  W++ L +I+ G+  +FFKD +MYES CQD  TCN DQR
Sbjct: 257 NHGIVLGGLAYMYNAT-NGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQR 315

Query: 312 SFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGY 371
           +FKSIFSRML LT  +AP+T +TID L++ SAE AAKSC GGTDGHTCGLNWQ   +DGY
Sbjct: 316 TFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGY 375

Query: 372 YGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDK 431
           YGLGEQ  ALE IQ+L+   RPAPY  DNGG+S GD  A +NS++TNVLQ+++ I   D+
Sbjct: 376 YGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKGDR 435

Query: 432 VGASIITAVILAVLVGGSIWMIF 454
            GA+IITAVIL+VL GG++WM+F
Sbjct: 436 AGAAIITAVILSVLTGGAVWMLF 458

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/453 (67%), Positives = 371/453 (81%), Gaps = 7/453 (1%)

Query: 5   SFALCALLL---QPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYY 61
           +  LC  LL   +    +DLDT+ ++SICDAT+LIQ G++DYY GTR GGTVGMFQ PYY
Sbjct: 10  ALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYY 69

Query: 62  WWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGL 121
           WW AGE FGGM+ENW+LCQNDTY  ++YDA++ Q G DYD++P+NQ+MVEGNDDQG+WG+
Sbjct: 70  WWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGI 129

Query: 122 TVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKN 181
           TVM A ERNFTNP ++G PGWLAM Q VFNTM+ RWDSE+CGGG+RWQIFTWNSGYNYKN
Sbjct: 130 TVMGAVERNFTNP-DNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKN 188

Query: 182 TVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNC 241
           T+SNAC+FQ+AARLGRYTGN TYL  AE V+DWLVDVG+VVLN+   ANVYDGA ID NC
Sbjct: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDT--ANVYDGAEIDTNC 246

Query: 242 TDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQ 301
           TDI K EW+YN GIVLGG AYMYNAT N TS WK+ L Q++ G+  +FFKD +MYES CQ
Sbjct: 247 TDITKIEWTYNHGIVLGGMAYMYNAT-NGTSEWKTSLQQVLNGAASYFFKDGIMYESACQ 305

Query: 302 DSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGL 361
           D  TCN DQR+FKSIFSRML LT  +AP+T++TID L++ SAE AAKSC GGTDGHTCGL
Sbjct: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGL 365

Query: 362 NWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQ 421
           +W+   +DGYYGLGEQ  ALE IQ+L+   RPAPY  DNGG+S GD  A +NS++T+VLQ
Sbjct: 366 DWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQ 425

Query: 422 SDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454
           +++ IT  D+ GA+IITAVIL+VL+GG++WM+F
Sbjct: 426 NNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/454 (67%), Positives = 363/454 (79%), Gaps = 9/454 (1%)

Query: 1   MLAQSFALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPY 60
           +L Q+F      +  +  IDLD +   SIC ATSLIQGG++DYY GTR GGTVGMFQ PY
Sbjct: 7   VLLQAFNF----ITTVTAIDLDVNSKDSICAATSLIQGGMLDYYEGTRYGGTVGMFQPPY 62

Query: 61  YWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWG 120
           YWWEAGE FGGM+ENWFLCQNDTYHDIIYDA++ Q G +YD++P+NQ+ VE    + V+G
Sbjct: 63  YWWEAGEAFGGMIENWFLCQNDTYHDIIYDALLAQTGSNYDYVPANQTFVEVMMIK-VFG 121

Query: 121 LTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYK 180
            TVM AAERNFT P+ DG P WLAMAQ VFNTM+ RWDS +CGGG+RWQI+TWNSGYNYK
Sbjct: 122 GTVMDAAERNFTAPS-DGKPDWLAMAQAVFNTMYARWDSANCGGGLRWQIYTWNSGYNYK 180

Query: 181 NTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDN 240
           NTVSNAC+FQ+AARLGRYTGNDTYL  AE V+DWLVDV FVVLN+   ANV+DGANI  N
Sbjct: 181 NTVSNACLFQIAARLGRYTGNDTYLEVAEKVFDWLVDVNFVVLNDE--ANVFDGANITSN 238

Query: 241 CTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTC 300
           C+ +VK EWSYN GIVLGG AYMYNAT N TS W+S L +++ G+   FFK+ +MYE  C
Sbjct: 239 CSAVVKLEWSYNHGIVLGGLAYMYNAT-NGTSKWESGLTKVLNGAKSIFFKNNIMYEQAC 297

Query: 301 QDSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCG 360
           QD  TCN DQRSFKSIFSRML LT  LAPYT++TI PL++ASAEGAAKSC GGTDGHTCG
Sbjct: 298 QDHNTCNTDQRSFKSIFSRMLGLTSVLAPYTSDTITPLIQASAEGAAKSCDGGTDGHTCG 357

Query: 361 LNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVL 420
           LNW LG +DG YGLGEQ CALE + +L+   RPAPYT  NGG+SVGD  A LN+TST+VL
Sbjct: 358 LNWNLGTNDGKYGLGEQMCALEIMSNLLILNRPAPYTMHNGGTSVGDPSAGLNATSTSVL 417

Query: 421 QSDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454
            +++ I  KD+ GA+I+TAVIL VL+GGS+WM+F
Sbjct: 418 SNNLDIKQKDRAGAAIVTAVILFVLLGGSVWMLF 451

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/444 (68%), Positives = 348/444 (78%), Gaps = 3/444 (0%)

Query: 11  LLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFG 70
           L +  +L IDLDTS  SSIC AT+LIQ GI DYY G   GGTVGMF  PYYWWEAG VFG
Sbjct: 11  LTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFG 70

Query: 71  GMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERN 130
           GM+ENW+LCQN +Y D++YDA++ Q G DYD+MPSNQ+MVEGNDDQGVW LTVM+A ERN
Sbjct: 71  GMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERN 130

Query: 131 FTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQ 190
           FTNP EDG PGWLAM Q VFN M+ RWDS+HC GG+RWQIFTWNSGYNYKNT+SN C+FQ
Sbjct: 131 FTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQ 190

Query: 191 LAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWS 250
           LAARLGRYTGN TYL  AE V+DWLVD+ FVV+ E   ANV+DGA IDDNCT IVK EWS
Sbjct: 191 LAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKE--EANVFDGATIDDNCTSIVKYEWS 248

Query: 251 YNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQ 310
           YN G+VLGG AYMYNAT N + VW++R +QI+GG+T FFF+D +MYESTCQ S  CN DQ
Sbjct: 249 YNHGVVLGGCAYMYNAT-NGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQ 307

Query: 311 RSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDG 370
           R FK+IFSRML  T  LAP+T +TI PL++ SA  AAKSC+GGTDGHTCGLNW  G  DG
Sbjct: 308 RVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSAAAAAKSCSGGTDGHTCGLNWFTGDWDG 367

Query: 371 YYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKD 430
            YGLGEQACALE I  L+    PAP T   GGSS GD  A LN ++TNVLQ +I IT  D
Sbjct: 368 QYGLGEQACALEIINQLLVHDLPAPLTESTGGSSSGDASAGLNVSTTNVLQKNINITAGD 427

Query: 431 KVGASIITAVILAVLVGGSIWMIF 454
           K GA IIT ++L VLV G++WM+ 
Sbjct: 428 KAGAGIITTIVLGVLVLGTVWMVL 451

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/451 (64%), Positives = 363/451 (80%), Gaps = 5/451 (1%)

Query: 4   QSFALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWW 63
           Q + L   L      I+L   +  SIC AT+LIQGG++DYY GTR GGTVGMFQ PYYWW
Sbjct: 8   QLWVLIGTLFPDAGAINLQ-DNKDSICAATALIQGGMLDYYEGTRYGGTVGMFQPPYYWW 66

Query: 64  EAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTV 123
           +AG  FGGMLENWFLCQNDTY D++ +A++ Q GP+YD++P+NQ+ VEGNDDQGVWGLT+
Sbjct: 67  QAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYDYIPANQTTVEGNDDQGVWGLTI 126

Query: 124 MSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTV 183
           + A ERNF+ P  DG PGWLAM+QG+FNTM+ RWD + C GG+RWQIFTWNSGYNYKNT+
Sbjct: 127 LDAVERNFSAPI-DGKPGWLAMSQGIFNTMYARWDMQSCNGGLRWQIFTWNSGYNYKNTI 185

Query: 184 SNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTD 243
           SNAC+FQ+AARLGRYTGN TYL  AE V+DWLV VG++VL+E GN  VYDGA ++DNCTD
Sbjct: 186 SNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGYIVLSEKGN--VYDGAKVEDNCTD 243

Query: 244 IVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDS 303
           I   EW+YN G+VLGG AYMYNAT N +SVW+SRL  ++GG+T +FF+D +MYES CQ  
Sbjct: 244 ITAIEWTYNHGVVLGGLAYMYNAT-NGSSVWQSRLTSVLGGATAYFFQDDIMYESACQPY 302

Query: 304 KTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNW 363
           KTCN DQR FKSIFSRML  T  LAP+T++TIDPL++ASA  AA SC GGTDGHTCGL+W
Sbjct: 303 KTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDPLLKASAMAAAGSCDGGTDGHTCGLDW 362

Query: 364 QLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSD 423
           QL  +DGYYGLGEQ  ALE IQ L+  +RPAPY +DNGG+SVGD  A LNST+TNVL+++
Sbjct: 363 QLKTNDGYYGLGEQMSALEVIQQLLIHERPAPYRADNGGTSVGDAAAGLNSTTTNVLKNN 422

Query: 424 IKITHKDKVGASIITAVILAVLVGGSIWMIF 454
           +KIT  D+ GA+I+T ++L +++GG+ WM+F
Sbjct: 423 LKITGGDRAGAAIVTTIVLGIIIGGAAWMMF 453

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/449 (67%), Positives = 355/449 (79%), Gaps = 5/449 (1%)

Query: 8   LCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGE 67
           L  LLL     IDLDTS  +SICDAT+LIQ G++DYY G R GGTVGMFQ PYYWWEAGE
Sbjct: 6   LFPLLLTVAKAIDLDTSSKTSICDATALIQDGMLDYYEGIRYGGTVGMFQSPYYWWEAGE 65

Query: 68  VFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAA 127
            FGGMLENWFLC+NDT+ +IIYDA++ Q G DYDFMP NQ+MVEGNDDQ VWGLT+M A 
Sbjct: 66  AFGGMLENWFLCENDTFKEIIYDAILAQTGSDYDFMPENQTMVEGNDDQCVWGLTIMDAV 125

Query: 128 ERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNAC 187
           ERNFT+PT DG PGWL M Q +FN MW RWDS +CGGG+RWQIFTWNSGY+YK+T+SN C
Sbjct: 126 ERNFTDPT-DGSPGWLYMTQAIFNEMWSRWDSANCGGGLRWQIFTWNSGYDYKSTISNVC 184

Query: 188 MFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKN 247
           +FQLA+RLGRYTGNDTYL  AE+V+DWLVDVGF+ +  NG A VYDGA+I +NCTDI   
Sbjct: 185 LFQLASRLGRYTGNDTYLDVAESVYDWLVDVGFINV-ANGTAYVYDGADISENCTDITTI 243

Query: 248 EWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCN 307
           +WSYN GI+LGGAAY YNAT N +SVW+SR+  IV G+   FF D +MYES CQD  TCN
Sbjct: 244 DWSYNHGILLGGAAYAYNAT-NGSSVWESRVTDIVEGAKSIFFSDGIMYESACQDYDTCN 302

Query: 308 QDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGY 367
            DQRSFKSIFSRML  T  LAP+TA TIDPL+++SA   A SC GGTDGHTCGLNWQ   
Sbjct: 303 NDQRSFKSIFSRMLGFTSVLAPFTASTIDPLIKSSAAACALSCDGGTDGHTCGLNWQDKT 362

Query: 368 HDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNST--STNVLQSDIK 425
            DG YGLGEQ  ALE IQ+L+   RPAPYT+  GGSSVGD  A LN+T  S +VL++++ 
Sbjct: 363 CDGNYGLGEQMSALEVIQNLLIHDRPAPYTASTGGSSVGDASAGLNTTTSSADVLENNLT 422

Query: 426 ITHKDKVGASIITAVILAVLVGGSIWMIF 454
           IT KD+ GA+IITAVIL  + GG+IWM+F
Sbjct: 423 ITSKDRAGAAIITAVILGCMAGGAIWMLF 451

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/450 (66%), Positives = 364/450 (80%), Gaps = 5/450 (1%)

Query: 6   FALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEA 65
           F    L +     IDLD +   SICDATSLIQGG+MDYY GT+ GGTVGMFQ PYYWWEA
Sbjct: 14  FFQLLLTVHNTQAIDLDITSKESICDATSLIQGGMMDYYWGTQYGGTVGMFQPPYYWWEA 73

Query: 66  GEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMS 125
           GE FGGM+ENW+LCQNDTY D++  A++ Q G +YD++P+NQSMVEGNDDQGVWGLT+M 
Sbjct: 74  GEAFGGMIENWYLCQNDTYEDMLKSALLAQTGSNYDYIPANQSMVEGNDDQGVWGLTLMG 133

Query: 126 AAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSN 185
           AAERNFT+P +DG PGWLAM Q VFNTM  RWDS HCGGG+RWQIFTWNSGYNYKNT+SN
Sbjct: 134 AAERNFTDP-DDGTPGWLAMTQAVFNTMNARWDSAHCGGGLRWQIFTWNSGYNYKNTISN 192

Query: 186 ACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIV 245
           AC+FQLAARLGRYTGN TYL  AE V+ WLVDVG+V+L++   ANV+DGA ID NCTD+ 
Sbjct: 193 ACLFQLAARLGRYTGNTTYLEVAEKVFTWLVDVGYVLLDDT--ANVFDGAEIDSNCTDMT 250

Query: 246 KNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFF-KDKVMYESTCQDSK 304
           + EW+YN G+VLGGAAYMYNAT N +S W+SR+ +++ G+T +FF  + +M+E+ CQ+  
Sbjct: 251 QIEWTYNHGVVLGGAAYMYNAT-NGSSDWESRVTKLLKGATTYFFDSNGIMFENACQEYN 309

Query: 305 TCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQ 364
           TCN DQRSFKSIFSRML LT  LAP+T++T+DPL++ SA  AAKSCTGGTDGHTCGLNW 
Sbjct: 310 TCNNDQRSFKSIFSRMLGLTSVLAPFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCGLNWA 369

Query: 365 LGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDI 424
            G HDGYYGLGEQ CALE +Q+L+   RPAP T + GGSS GD  A LNST+TNVL++ +
Sbjct: 370 KGSHDGYYGLGEQMCALEVMQNLLIHDRPAPLTGNTGGSSKGDALAGLNSTTTNVLENKM 429

Query: 425 KITHKDKVGASIITAVILAVLVGGSIWMIF 454
            IT+ D+ GA+I+TA+IL VL GG++WM F
Sbjct: 430 TITNGDRAGAAIVTAIILGVLTGGAVWMFF 459

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/436 (68%), Positives = 361/436 (82%), Gaps = 4/436 (0%)

Query: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78
           +DLDT+  +SICDAT+LIQ G++DYY GTR GG VGMFQ PYYWW AGE FGGMLENWFL
Sbjct: 27  MDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFL 86

Query: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138
           C+N+TY +++YDA++ Q G +YD++P+NQ+MVEGNDDQG+WG+TVM A ERNFT+P E G
Sbjct: 87  CENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPDE-G 145

Query: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198
            PGWLAM Q VFNTM+ RWDSEHCGGG+RWQIFTWNSGYNYKNTVSNAC+FQ+AARLGRY
Sbjct: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRY 205

Query: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLG 258
           TGN TYL  AE V+DWLVDVG+VVLN+   ANV+DGA ID NCTDI K EW+YN GIVLG
Sbjct: 206 TGNSTYLDVAEQVFDWLVDVGYVVLNDT--ANVFDGAEIDTNCTDITKIEWTYNHGIVLG 263

Query: 259 GAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIFS 318
           G AYMYNAT N TS W++RL QI+ G+  +FFKD +MYES CQD  TCN DQR+FKSIFS
Sbjct: 264 GLAYMYNAT-NGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIFS 322

Query: 319 RMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQA 378
           RML LT  +AP+T++TID L++ SAE AAKSC GGTDGHTCGL+W    HDGYYGLGEQ 
Sbjct: 323 RMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQM 382

Query: 379 CALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASIIT 438
            ALE IQ+L+   RPAPY   NGG+S GD  A +NS++TNVLQ+++ IT   + GA+IIT
Sbjct: 383 SALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKGGRAGAAIIT 442

Query: 439 AVILAVLVGGSIWMIF 454
           A+IL+VL+GG++WM+F
Sbjct: 443 AIILSVLIGGAVWMLF 458

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/455 (65%), Positives = 357/455 (78%), Gaps = 6/455 (1%)

Query: 1   MLAQSFALCAL-LLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQP 59
           M+     L AL  +     +DLDTS   SIC ATSLI  G++DYY GT+ GGTVGMFQ P
Sbjct: 1   MILNELILSALSFVSFTFAMDLDTSSKESICGATSLIIKGMLDYYWGTQYGGTVGMFQPP 60

Query: 60  YYWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVW 119
           YYWWEAGE FGGMLENW+LCQNDTY D+++DA+  Q GPDYD++P NQ+MVEGNDDQ +W
Sbjct: 61  YYWWEAGEAFGGMLENWYLCQNDTYADLLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIW 120

Query: 120 GLTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNY 179
           GLTVM A ERNFTNPTE   PGWLAM Q VFNTMW RWD+  CGGG+RWQIFTWNSGY+Y
Sbjct: 121 GLTVMDAVERNFTNPTEG--PGWLAMGQAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDY 178

Query: 180 KNTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDD 239
           KNT+SNAC+FQ+AARLGRYTGN+TYL  A  V+DWL  VG+V  N +  A VYDGA+I +
Sbjct: 179 KNTISNACLFQMAARLGRYTGNNTYLDVANDVFDWLTGVGYV--NMDNAAEVYDGADISE 236

Query: 240 NCTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYEST 299
           NCTDI K +WSYN G +LGGAAYMYNAT N +S+W++R+ Q++ G+  +FF+D +MYES 
Sbjct: 237 NCTDITKYQWSYNNGCMLGGAAYMYNAT-NGSSIWETRVTQLLNGAKAYFFQDDIMYESA 295

Query: 300 CQDSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTC 359
           CQ +KTCN DQRSFKS+FSRML  T  L P T + IDPL+ ASA+GAA++C GGTDGHTC
Sbjct: 296 CQTAKTCNNDQRSFKSLFSRMLGFTSVLVPSTRDIIDPLILASAQGAARTCNGGTDGHTC 355

Query: 360 GLNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNV 419
           GLNWQ   HDGYYGLGEQ  ALE IQ+L+   RPAPYTS +GGSS GD  A LN TS NV
Sbjct: 356 GLNWQASTHDGYYGLGEQMSALEVIQNLLIHDRPAPYTSIDGGSSEGDANAGLNKTSKNV 415

Query: 420 LQSDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454
           L +D+ I   DKVGA+I+TA +LA+LVGG+IWM+F
Sbjct: 416 LSNDLDIKTGDKVGAAILTAGVLAILVGGAIWMLF 450

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/446 (64%), Positives = 357/446 (80%), Gaps = 5/446 (1%)

Query: 11  LLLQPIL--GIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEV 68
           +LL P+L   IDLD +   SIC AT+LIQ G++DYY G R GG VGMFQ PYYWW  G  
Sbjct: 9   VLLLPLLVQSIDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQPPYYWWNGGVA 68

Query: 69  FGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAE 128
           FGGMLEN +LC+N+T+  ++ DA++ Q G +YD++PSNQSMVEGNDDQGVWGLT+M A E
Sbjct: 69  FGGMLENMYLCENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQGVWGLTIMDAVE 128

Query: 129 RNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACM 188
           RNFT P + GVPGWLAMAQ VFNTM+ RWD +HCGGG+RWQIFTWNSGYNYKNT++NAC+
Sbjct: 129 RNFTAPNKSGVPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGYNYKNTIANACL 188

Query: 189 FQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNE 248
           FQ+AARLGRYTGN TYL  AE V+DW+VD+ ++VLN+   ANV+DGA+ID+NCTDI   E
Sbjct: 189 FQMAARLGRYTGNQTYLDVAEKVFDWMVDINYIVLND--KANVFDGADIDENCTDITTLE 246

Query: 249 WSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQ 308
           W+YN G+VLGG AYMYNAT N +S W++R+++I+ G+ E+FF+D VM ES CQ   TCN 
Sbjct: 247 WTYNHGVVLGGCAYMYNAT-NGSSTWETRVNKILAGAQEYFFQDNVMLESACQSYNTCNN 305

Query: 309 DQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYH 368
           DQR FKSIFSRML  T  LAP+TAETIDPL++ASAE AA SCTGG DGHTCGL+W  G +
Sbjct: 306 DQRCFKSIFSRMLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHTCGLDWTKGSN 365

Query: 369 DGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITH 428
           DGYYGLGEQ  ALE + +L+   RPAP T++ GG+S GD  A LNST+TNVL++ +KIT 
Sbjct: 366 DGYYGLGEQMNALEIMSNLLIHDRPAPLTANTGGTSEGDASAGLNSTTTNVLENKLKITQ 425

Query: 429 KDKVGASIITAVILAVLVGGSIWMIF 454
            D+ GA+I+TAVIL + VGG++WM+F
Sbjct: 426 GDRAGAAIVTAVILGIFVGGAVWMLF 451

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/436 (67%), Positives = 361/436 (82%), Gaps = 4/436 (0%)

Query: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78
           ++LD++  +SICDAT+LIQ G++DYY GTR GG VGMFQ PYYWW AGE FGGMLENWFL
Sbjct: 27  MELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFL 86

Query: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138
           C+NDTY +++YDA++ Q G +YD++P+NQ+MVEGNDDQG+WG+TVM A ERNFT+P+ DG
Sbjct: 87  CENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPS-DG 145

Query: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198
            PGWLAM Q VFNTM+ RWDSEHCGGG+RWQIFTWNSGYNYKNT+SNAC+FQ+AARLGRY
Sbjct: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRY 205

Query: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLG 258
           TGN TYL  AE V+DWLVDVG+VVLN+   ANV+DGA ID NCTDI K EW+YN GIVLG
Sbjct: 206 TGNTTYLDVAEQVFDWLVDVGYVVLNDT--ANVFDGAEIDTNCTDITKIEWTYNHGIVLG 263

Query: 259 GAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIFS 318
           G AYMYNAT N TS W++ L +I+ G+  +FFKD +MYES CQD  TCN DQR+FKSIFS
Sbjct: 264 GLAYMYNAT-NGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRTFKSIFS 322

Query: 319 RMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQA 378
           RML LT  +APYT++TID L++ SAE AAKSC GG DGHTCGLNW    +DGYYGLGEQ 
Sbjct: 323 RMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQM 382

Query: 379 CALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASIIT 438
            ALE IQ+L+   RPAPY   NGG+S GD  A +NS++TNVLQ+++ I + D+ GA+IIT
Sbjct: 383 NALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAIIT 442

Query: 439 AVILAVLVGGSIWMIF 454
           A+IL+VL+GG++WM+F
Sbjct: 443 AIILSVLIGGAVWMLF 458

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/426 (66%), Positives = 343/426 (80%), Gaps = 3/426 (0%)

Query: 29  ICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFLCQNDTYHDII 88
           +C AT+L+  G++DYY+GTR GGTVGMFQ PYYWW AGE FGGM+ENWFLCQN TY  ++
Sbjct: 41  VCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFGGMIENWFLCQNSTYETLL 100

Query: 89  YDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDGVPGWLAMAQG 148
            DA I Q G +YD++P NQ+MVEGNDDQG+WGLT+M A ERNFT PT+DGVPGWLAM+Q 
Sbjct: 101 MDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERNFTKPTKDGVPGWLAMSQA 160

Query: 149 VFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRYTGNDTYLTKA 208
           VFNTMW RWD++HCGGG+RWQIFTWNSGYNYKNT+SNAC+F LAARLGRYTGN TYL  A
Sbjct: 161 VFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFNLAARLGRYTGNSTYLDVA 220

Query: 209 ETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLGGAAYMYNATQ 268
           + V+DW+V VG+VVL +   ANV+DGANI+DNCT I   EWSYN G+VLGG A+MYNAT 
Sbjct: 221 DQVFDWMVSVGYVVLGD--TANVFDGANIEDNCTTITTFEWSYNHGVVLGGTAFMYNAT- 277

Query: 269 NDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIFSRMLSLTRSLA 328
           N +SVW+ R+++I+ G+T +FF+D +M+ES CQD+  CN DQR+FK+IFSRMLS T  L 
Sbjct: 278 NGSSVWEDRVNRILKGATTYFFRDSIMFESACQDTGKCNNDQRTFKAIFSRMLSFTAVLV 337

Query: 329 PYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQACALEGIQSLM 388
           P TA TIDPLM++SA+ AA+SC+GGTDGHTCGLNWQ    DG YGLGEQ  ALE +  L+
Sbjct: 338 PSTASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLGEQMSALEVMNYLL 397

Query: 389 YSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASIITAVILAVLVGG 448
              RPAPYT+  GGSSVGD  A LNST+TNV  + + I  KDK GA+I+T VIL  L GG
Sbjct: 398 VHDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSLNIRGKDKAGAAIVTTVILGTLAGG 457

Query: 449 SIWMIF 454
           SIWM+F
Sbjct: 458 SIWMLF 463

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/440 (65%), Positives = 348/440 (79%), Gaps = 6/440 (1%)

Query: 17  LGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENW 76
           +G+DLD S   SIC AT+LIQ G++DYY GTRIGGTVGMFQ PYYWW+AGE FGGM++NW
Sbjct: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60

Query: 77  FLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTE 136
           + C+N T+  +IYD M+ Q GP YD+MP NQ+MVEGNDDQGVWGLT+M A ERNFTNPT 
Sbjct: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPT- 119

Query: 137 DGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLG 196
           +G PGWLAMAQ +FN +  RWD+ +CGGG+RWQIFTWN GYNYKNT+SNAC+FQ+AARLG
Sbjct: 120 NGAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLG 179

Query: 197 RYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIV 256
           RYTGNDTYL  AE V+DWLVDVG+VVL + G  NV+DGA ID+NCT I K EWSYN G+V
Sbjct: 180 RYTGNDTYLEVAENVFDWLVDVGYVVLKDVG--NVFDGAEIDNNCTSINKLEWSYNHGVV 237

Query: 257 LGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQ--DSKTCNQDQRSFK 314
           LGG A+MYNAT N +S W++R+ QI+GG+  +FFKD +MYES CQ   + TCN DQRSFK
Sbjct: 238 LGGLAFMYNAT-NGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFK 296

Query: 315 SIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGL 374
           +IFSRML LT  L P T   +D L++ SA  AA SC+GGTDGHTCGLNW    +DGYYGL
Sbjct: 297 AIFSRMLGLTSVLVPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGL 356

Query: 375 GEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGA 434
           GEQ  ALE +Q L+  ++ AP+T   GGSS GD  A LN++S NVLQ+ + I  KD+ GA
Sbjct: 357 GEQMSALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGA 416

Query: 435 SIITAVILAVLVGGSIWMIF 454
           +IITAVIL VLVGGSIWM+F
Sbjct: 417 AIITAVILMVLVGGSIWMLF 436

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/458 (63%), Positives = 357/458 (77%), Gaps = 20/458 (4%)

Query: 12  LLQPIL---GIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEV 68
           L+  IL    I LD     S+C+AT+LIQ G++DYY GTR GGTVGMFQ PYYWWEAGE 
Sbjct: 9   LISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEA 68

Query: 69  FGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAE 128
           FGGMLENW+LCQNDT+  +I DA+I+QAG +YD++PSNQ++VEGNDDQGVWGLTV+ A E
Sbjct: 69  FGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVE 128

Query: 129 RNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACM 188
           RN   P  DGVPGWLA++Q VFNTM+ RWD+ +CGGG+RWQI+TWNSGYNYKNT+SNAC+
Sbjct: 129 RNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACL 186

Query: 189 FQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNE 248
           FQ+AARLGRYTGN+TYL  AE V+DW+VDV ++VL +   ANVYDGA  + NC+DIV+ E
Sbjct: 187 FQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKD--VANVYDGATTNYNCSDIVQYE 244

Query: 249 WSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQ 308
           WSYN G+VLGG AYMYNAT N TS W++ L Q++ G+T +FFK+ +MYES CQ++KTCN 
Sbjct: 245 WSYNHGVVLGGLAYMYNAT-NGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNT 303

Query: 309 DQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYH 368
           DQRSFKSIFSRML  TR LAPYTA T+D L+E SA+ AA SC GGTDG TCGL+W    +
Sbjct: 304 DQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTN 363

Query: 369 DGYYGLGEQACALEGIQSLMY------------SKRPAPYTSDNGGSSVGDTEAALNSTS 416
           DGYYGLGEQ  ALE I  L+                 +PYTS +GG+S GD  A LN+TS
Sbjct: 364 DGYYGLGEQMSALEIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASAGLNTTS 423

Query: 417 TNVLQSDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454
           TNVLQ+++ I  KDK GA++ TAVILAVLVGGS+WM+F
Sbjct: 424 TNVLQNNLDIESKDKAGAAVATAVILAVLVGGSVWMLF 461

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/444 (63%), Positives = 340/444 (76%), Gaps = 6/444 (1%)

Query: 13  LQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGM 72
           L PI  +DL   D  S+C AT+LIQ G++DYYAG + GG +GMFQ PYYWW+AGE FGGM
Sbjct: 14  LSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGM 73

Query: 73  LENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFT 132
           ++NW  C+N+T+ ++I +AM+ QAGP YD+MP NQ+MVEGNDDQGVWGLTVM A ERNFT
Sbjct: 74  IDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFT 133

Query: 133 NPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLA 192
           +P  DG PGWLAMAQ VFN +  RWD + C GGVRWQIFTWNSGYNYKNT+SN C FQLA
Sbjct: 134 DPG-DGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLA 192

Query: 193 ARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYN 252
           ARLGRYT N TYL  AE V+DWL DVGFVVL + GN  V+DGA  DDNCT + + EW+YN
Sbjct: 193 ARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGN--VFDGAVTDDNCTQVTELEWTYN 250

Query: 253 QGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQ--DSKTCNQDQ 310
            GI+LGG+AYMYNAT N +S W+ R++QI+ G++++FF+D VMYES CQ  DS  CN DQ
Sbjct: 251 HGIILGGSAYMYNAT-NGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQ 309

Query: 311 RSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDG 370
           RSFKSIFSRML LT  L P  ++ +D L+ ASAEGAAKSC+GG DGHTCGLNW  G  D 
Sbjct: 310 RSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDN 369

Query: 371 YYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKD 430
            YGLGEQ  ALE IQ+ +      PY    GGSS GD+ A LN+T+TNVLQ  +KI  KD
Sbjct: 370 QYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKD 429

Query: 431 KVGASIITAVILAVLVGGSIWMIF 454
           + GA+IIT V+L V+VGGS+WM+F
Sbjct: 430 RAGAAIITGVVLMVVVGGSVWMLF 453

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/455 (60%), Positives = 336/455 (73%), Gaps = 4/455 (0%)

Query: 1   MLAQSFALCALLLQPILG-IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQP 59
           ++ Q ++L  L+  P+ G + LD     SIC AT  IQ GIMDYY G+  GG VGMF QP
Sbjct: 3   IIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQP 62

Query: 60  YYWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVW 119
           YYWWEAG VF GMLENW+LC N  Y+  +Y++MI Q G +YD++PSNQSM EGNDDQG+W
Sbjct: 63  YYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIW 122

Query: 120 GLTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNY 179
           GL +M A ERNF +     VPGWL MAQ VFNTM+ RWDS+HCGGG+RWQIFTWN GY+Y
Sbjct: 123 GLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDY 182

Query: 180 KNTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDD 239
           KNT++N C+FQLAARLGRYTGN TYL  A   + WLVDV FVVL +   ANV+DGA+I D
Sbjct: 183 KNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKD--EANVFDGAHIGD 240

Query: 240 NCTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYEST 299
           NC DI   EW+YN G++LGG AYMYNAT  D  VW++RL QI+GG+  FFF++ +MYE  
Sbjct: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGD-PVWETRLRQILGGARAFFFRNNIMYERA 299

Query: 300 CQDSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTC 359
           CQD+K CN DQRSFKSIFSRML++T  LAP+T ETIDPL+EASA  AA SC+GG DG TC
Sbjct: 300 CQDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEASAAAAAASCSGGKDGETC 359

Query: 360 GLNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNV 419
           GL+W  G  DGYYGLGEQA ALE IQ+L+   +  P T + GG+S GD  A L +   NV
Sbjct: 360 GLDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNV 419

Query: 420 LQSDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454
           L S + I  KD++ A++ITAV L +LVG ++WM+ 
Sbjct: 420 LHSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/447 (57%), Positives = 330/447 (73%), Gaps = 6/447 (1%)

Query: 11  LLLQPIL--GIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEV 68
           LL+Q +L   +DLD S    +C  T+ IQ GIMDYY G++ GG VGMFQ PYYWWEAGEV
Sbjct: 16  LLMQGMLSRALDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEV 75

Query: 69  FGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAE 128
           FGGMLENW+LC N  Y  ++ ++MI Q G  +D++P+NQS  EGNDDQGVW L +M A E
Sbjct: 76  FGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVE 135

Query: 129 RNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACM 188
           RNF +P ++G+PGWL M Q VFN M  RWD+E+CGGG+RWQIF WN+GY YKNT++N C+
Sbjct: 136 RNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCL 195

Query: 189 FQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNE 248
           FQLAARLGRYTGN TYL  A  V+ WLVDV ++VL +   A V+DGA+I +NC+DI   E
Sbjct: 196 FQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLED--KARVFDGAHIHENCSDIKGIE 253

Query: 249 WSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQ 308
           WSYN GI+L GAAYMYNAT   +  W+S + +I+ G+ +F+F+DK+MYE  CQD  TC+ 
Sbjct: 254 WSYNHGIILAGAAYMYNAT-GGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDN 312

Query: 309 DQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYH 368
           DQRSFKSIFSRML++T  +AP+T  TID L+ ASA  A+KSC  GT G+TCGLNW  G +
Sbjct: 313 DQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTY 372

Query: 369 DGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTS-TNVLQSDIKIT 427
           DG YGLGEQA ALE IQ+++   +  P T+D GG S G+ +A L+  S   +L+    IT
Sbjct: 373 DGVYGLGEQASALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNIT 432

Query: 428 HKDKVGASIITAVILAVLVGGSIWMIF 454
            KD+VGAS+ITA+ L +++G ++WMIF
Sbjct: 433 GKDRVGASLITAISLGLMLGCALWMIF 459

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/436 (57%), Positives = 314/436 (72%), Gaps = 5/436 (1%)

Query: 18  GIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWF 77
            +D+D + S SICDAT LIQ GI+DYY G R GG VG FQ+PYYWW AGE FGGM+ENW+
Sbjct: 30  ALDVDFNSSESICDATKLIQVGILDYYEGLRPGGRVGFFQKPYYWWMAGEAFGGMVENWY 89

Query: 78  LCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTED 137
           LC N  Y D++ DAM+ Q G + D++PS+Q M+EGNDDQG+WGL VM AAERNF +   +
Sbjct: 90  LCNNTEYQDLLTDAMVSQIGENKDYVPSHQKMIEGNDDQGIWGLLVMGAAERNFPDAPPE 149

Query: 138 GVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGR 197
             PGWLA+AQ VFNTMW RWD E+CGGG+RWQIF WN+GY+YKNT+SNAC+FQ+AARL R
Sbjct: 150 RAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNNGYDYKNTISNACLFQIAARLAR 209

Query: 198 YTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVL 257
           +TGN TY   AETV+DWLVD   V L EN +A V DGA+I + C D  K EW+YN G+VL
Sbjct: 210 FTGNSTYQDVAETVFDWLVDSKLVQL-EN-DAKVLDGAHISERCEDHSKLEWTYNHGVVL 267

Query: 258 GGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIF 317
            G AYMYN T N ++VW  RL++++ GS   FF + ++YE  CQD + CN DQRSF+SIF
Sbjct: 268 AGCAYMYNIT-NGSAVWGDRLNKVLNGSL-LFFPNGILYERACQDVQKCNDDQRSFRSIF 325

Query: 318 SRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQ 377
           SRML+LT  LAP+T   I+P +  SAE AAKSC+GG DGHTCG+ W+    DG YGLGEQ
Sbjct: 326 SRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQ 385

Query: 378 ACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQ-SDIKITHKDKVGASI 436
             ALE IQ+ +   +P P T++ G  S GD  A L   S N++  S  +I  KD+VGA  
Sbjct: 386 LSALEIIQNTLIHTKPPPTTANEGAKSKGDPSAGLYDNSPNIITLSTRQIGLKDRVGAGF 445

Query: 437 ITAVILAVLVGGSIWM 452
           +T V+L   + GSIWM
Sbjct: 446 MTVVLLIPFITGSIWM 461

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/399 (61%), Positives = 301/399 (75%), Gaps = 10/399 (2%)

Query: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78
           I L+ + ++SICDATS+I  GI+DYY GTR  GTVGMFQQPYYWW+AG  FGGMLENW+L
Sbjct: 27  IKLNVTSNTSICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGMLENWYL 86

Query: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138
           CQNDT+  ++ DAM+HQAG DYD++P NQ+MVE NDDQGVWGLT+M A ERNFT+P    
Sbjct: 87  CQNDTFESLLTDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTDPQGKD 146

Query: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198
           VPGWLAMAQ +FN M+ RWD+  CGGG+RWQI+ WN GYNYKNT+S AC+FQ+AARLGRY
Sbjct: 147 VPGWLAMAQSIFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAARLGRY 206

Query: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLG 258
           TGN TYL  A+  + W+VD+G++ LN + +  V+DGA+I+ NC+DI K EWSYN GIVLG
Sbjct: 207 TGNSTYLKVADKTFQWMVDIGYIQLNTS-SGRVFDGAHIESNCSDITKLEWSYNHGIVLG 265

Query: 259 GAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQ--DSKTCNQDQRSFKSI 316
           G AYMYNAT+  +  W     +I+ G+T +FF++K M E+ CQ  D   CN DQR+FKSI
Sbjct: 266 GCAYMYNATK--SPEWGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTFKSI 323

Query: 317 FSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGE 376
           FSRML LT  +AP+T+E IDPL+  SAE AA SCTGG D  TCGLNW  G +DGYYGLGE
Sbjct: 324 FSRMLGLTSVMAPFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYGLGE 383

Query: 377 QACALEGIQSLMYSKRPAPYTSDN-----GGSSVGDTEA 410
           Q  ALE IQ+L+  KRP PY +       GG S GD  A
Sbjct: 384 QLSALEVIQNLLIHKRPPPYMAKTDKNKVGGVSKGDPAA 422

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/436 (57%), Positives = 309/436 (70%), Gaps = 5/436 (1%)

Query: 18  GIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWF 77
            +D+D + S SICDAT LIQ GI+DYY G + GG  G   +PYYWW AGE FGGM+ENW+
Sbjct: 15  ALDVDFNSSESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYYWWMAGEAFGGMVENWY 74

Query: 78  LCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTED 137
           LC N  Y D++ DAM+ Q G + D+MPS+Q MVEGNDDQG+WGL VM AAERNF +   +
Sbjct: 75  LCNNTEYQDLLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGLLVMGAAERNFPDAPPE 134

Query: 138 GVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGR 197
             PGWLA+AQ VFNTMW RWD E+CGGG+RWQIF WN GY+YKNT+SNAC+FQ+AARL R
Sbjct: 135 RAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKNTISNACLFQIAARLAR 194

Query: 198 YTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVL 257
           +TGN TY   AETV+DWLVDV  V L EN +A V DGA+I + C D  + EW+YN G+VL
Sbjct: 195 FTGNSTYQDVAETVFDWLVDVKLVEL-EN-DARVLDGAHISERCEDHSQLEWTYNHGVVL 252

Query: 258 GGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIF 317
           GG AYMYN T N ++VW  RL++++ GS   FF++ ++YE  CQD   CN DQRSF+SIF
Sbjct: 253 GGCAYMYNIT-NGSAVWGDRLNKVLNGSL-LFFENGILYERACQDVNKCNDDQRSFRSIF 310

Query: 318 SRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQ 377
           SRML+LT  LAP+T   I+P +  SAE AAKSC+GG DGHTCG+ W+    DG YGLGEQ
Sbjct: 311 SRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQ 370

Query: 378 ACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIK-ITHKDKVGASI 436
             ALE IQ+ +   +P P T++ G  S GD  A L  +S N +    + I  KD+VGA  
Sbjct: 371 LSALEIIQNTLIHTKPPPTTANEGAKSQGDPGAGLQLSSPNSITLPTRQIRLKDRVGAGF 430

Query: 437 ITAVILAVLVGGSIWM 452
            T V L   + GSIWM
Sbjct: 431 ATVVFLLPFITGSIWM 446

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  503 bits (1294), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 227/390 (58%), Positives = 295/390 (75%), Gaps = 4/390 (1%)

Query: 6   FALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEA 65
           F   +L +   L + LD + S SICDATSL+Q GI+DYY GT  GGTVGMFQ PYYWW +
Sbjct: 16  FIYVSLFIGKTLSLTLDQTSSKSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHS 75

Query: 66  GEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMS 125
           G  FG M+ENW+LCQ+DTY  +I DA++ QAG +YDF+P NQ+MVEGNDDQGVWGL +M 
Sbjct: 76  GCAFGSMIENWYLCQDDTYESLITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMD 135

Query: 126 AAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSN 185
           AAER F  P   G P WL MA+ +F +M+ RWD+ +CGGG+RWQI++WN+GY+YKNTVS 
Sbjct: 136 AAEREF--PQVKGQPSWLTMAENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVST 193

Query: 186 ACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIV 245
            C+FQLAARLGRYTGN+TY+  A   +DWL  VGFV+  +N +  V+DGA+I  NCT+I 
Sbjct: 194 TCLFQLAARLGRYTGNETYVKAANQAFDWLQGVGFVMF-KNNDGYVFDGADISTNCTNIK 252

Query: 246 KNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKT 305
           K EWSYN GIVLGGAAYMYN T + +S W++R  Q++  ++ +FF++ +M+E+ CQ S  
Sbjct: 253 KYEWSYNHGIVLGGAAYMYNLT-DGSSTWETRTSQLLNLASSYFFQNGIMFEAECQTSNI 311

Query: 306 CNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQL 365
           CN DQRSF+SIF+RML  T  +AP+TAETIDPL++ +++ AA +C+GG DGHTCGLNW  
Sbjct: 312 CNNDQRSFRSIFARMLGKTSIMAPFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLN 371

Query: 366 GYHDGYYGLGEQACALEGIQSLMYSKRPAP 395
              DG YGLGE+  A+E IQ+L+  +RPAP
Sbjct: 372 SNFDGNYGLGEEMSAMEVIQNLLIHQRPAP 401

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  484 bits (1247), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 234/448 (52%), Positives = 314/448 (70%), Gaps = 6/448 (1%)

Query: 6   FALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEA 65
            +L  L      G+DLD +D +S+ +ATSL+  G+MDYY G + G T+GMF  P YWW+A
Sbjct: 8   LSLVTLFSSVSFGLDLDVNDLNSLKNATSLVAYGLMDYYTGLQYGKTIGMFASPSYWWQA 67

Query: 66  GEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMS 125
           G  +G +L+ WF  +NDTY+DI+  A+++Q G ++D+MP NQ++ EGNDDQ  WG  VM+
Sbjct: 68  GGAWGSILDYWFYMENDTYNDILTQALLYQTGDNHDYMPLNQTVTEGNDDQAFWGFAVMA 127

Query: 126 AAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSN 185
           AAERN+ NP +D  P WL +AQ VFNTM  RWD + CGGG+RWQIFTWNSGY+YKN+VSN
Sbjct: 128 AAERNYPNPPDD-EPQWLYLAQAVFNTMSSRWDMDSCGGGLRWQIFTWNSGYDYKNSVSN 186

Query: 186 ACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIV 245
           A +F L+ARL RYTGN +Y   AE ++DW+ D+  +V  E     VYDGA+I++NCTD V
Sbjct: 187 AALFHLSARLARYTGNSSYTEWAEKIYDWMQDIQLLVDEEPTQYYVYDGASIEENCTDTV 246

Query: 246 KNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKT 305
           K +W+YNQG++L G+AY+YN T+++T  W  R    +  S+  FF + +MYE+ CQ S  
Sbjct: 247 KYQWTYNQGLMLSGSAYLYNFTESET--WHERTKNFL-NSSGIFFNNSIMYEAACQGSGY 303

Query: 306 CNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQL 365
           CN DQRSFK+ FSR L LT  L P T +T+  L++ASA+GAA SC+GGTDGHTCGLNW  
Sbjct: 304 CNNDQRSFKAYFSRFLGLTAQLVPETRDTVLALLQASAQGAADSCSGGTDGHTCGLNWFY 363

Query: 366 GYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIK 425
           G  DG YGLGEQ  ALE +Q+L    RPAPYT+D+GG+S G+  A    + TN+  + + 
Sbjct: 364 GGWDGKYGLGEQMAALEVMQNLRCLDRPAPYTADDGGTSAGNPAAGTEQSPTNL--APLT 421

Query: 426 ITHKDKVGASIITAVILAVLVGGSIWMI 453
           I   D+ GA IITAVI   ++G  +W+I
Sbjct: 422 IGKGDQAGAGIITAVIGITIIGSVVWLI 449

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  479 bits (1232), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 238/445 (53%), Positives = 304/445 (68%), Gaps = 10/445 (2%)

Query: 11  LLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFG 70
           LL      +++D  D  S+ +ATSL+  G+MDYY G + G T+GMF  PYYWWEAG  +G
Sbjct: 17  LLSHSTKALEIDLDDIDSLRNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWG 76

Query: 71  GMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERN 130
            ML+ W+   NDTY+D I  A++HQ G + D++P NQS  EGNDDQ  WG+ VM+AAERN
Sbjct: 77  SMLDYWYYMDNDTYNDEIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWGIAVMTAAERN 136

Query: 131 FTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQ 190
           FTNP ED  P WL +AQ VFNTM +RWD + CGGG+RWQIF WNSGY+YKNTVSN  +F 
Sbjct: 137 FTNPPEDS-PQWLYLAQAVFNTMALRWDGDTCGGGLRWQIFVWNSGYDYKNTVSNGALFH 195

Query: 191 LAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNAN-VYDGANIDDNCTDIVKNEW 249
           +AARL RYTGN +Y+  AE V+DW+ +VG V    NG++  VYDG NI +NC+ I   +W
Sbjct: 196 MAARLARYTGNQSYVDWAEKVYDWMYEVGLV---SNGSSMFVYDGVNIANNCSTITPYQW 252

Query: 250 SYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQD 309
           +YN G+V+ GAAY+YN T+N+  VW +R   +V  ST  FF + +MYE+ CQ   +CN D
Sbjct: 253 TYNHGLVMAGAAYLYNFTENE--VWHNRTKMLVDAST-VFFNNSIMYEAACQGPNSCNTD 309

Query: 310 QRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHD 369
           QRSFK+ FSR L  T  L P T   I PL+ ASA  A KSC+GGTDGHTCGLNW +G  D
Sbjct: 310 QRSFKAYFSRFLGATAQLVPETRSKILPLINASAIAAGKSCSGGTDGHTCGLNWFIGDWD 369

Query: 370 GYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHK 429
           G YGLGEQ CALE + +     +PAPYTS NGGSSVGD  A      TN+  + + IT  
Sbjct: 370 GMYGLGEQMCALEVMVNTRCLHKPAPYTSTNGGSSVGDGAAGTEHHPTNL--APLHITKG 427

Query: 430 DKVGASIITAVILAVLVGGSIWMIF 454
            + GA IITAVI   ++  ++W++F
Sbjct: 428 SRAGAGIITAVIGISILACALWLVF 452

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  478 bits (1230), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 235/428 (54%), Positives = 302/428 (70%), Gaps = 11/428 (2%)

Query: 18  GIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWF 77
            +D++ + S+SIC+AT LIQ GI+DYY G R GG VG FQ+PYYWW AG+VFGGM+ENW+
Sbjct: 14  ALDVNFNSSASICNATKLIQQGILDYYEGLRPGGRVGFFQEPYYWWMAGDVFGGMVENWY 73

Query: 78  LCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTED 137
           LC N  Y D++ +AM+ Q G + D++P +Q MVEGNDDQG+WGL VM AAER+F +   D
Sbjct: 74  LCDNTEYKDLLTEAMVSQIGENKDYVPWHQRMVEGNDDQGIWGLLVMDAAERDFPDAPPD 133

Query: 138 GVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGR 197
             PGWLA+AQ VFNTMW RWD ++C GG+ WQI+ WN GY+YKNT+SN  +FQ+AARL R
Sbjct: 134 QAPGWLALAQAVFNTMWARWDMDNCAGGLLWQIYPWNVGYDYKNTISNGYLFQIAARLAR 193

Query: 198 YTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVL 257
           +TGN TY   AETV+DWLVD   V L+    A V DGA++  NCTD  + EW+YN G+VL
Sbjct: 194 FTGNSTYGRVAETVFDWLVDSKLVQLDN--VALVLDGAHVYTNCTDFTRYEWTYNYGVVL 251

Query: 258 GGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIF 317
           GG AYMYN T N + VW +RL++++ G+   FF++ +MYE TCQD   CN DQR FKSIF
Sbjct: 252 GGCAYMYNFT-NGSPVWANRLNRVLNGAL-LFFENGIMYERTCQDVDRCNNDQRFFKSIF 309

Query: 318 SRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQ 377
           +RML+LT  LAP+T   I+P +  SAE AAKSC GG+DGHTCGL W+    DG  GLGEQ
Sbjct: 310 TRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCNGGSDGHTCGLVWRNYTWDGKAGLGEQ 369

Query: 378 ACALEGIQ-SLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASI 436
            CALE IQ +L+++KRP P T+  G  S GD  A LNS+     + D+ I H      S 
Sbjct: 370 LCALEIIQNTLIHTKRP-PLTAKQGAKSKGDPAAGLNSS-----RYDLPIVHPPSGQKSS 423

Query: 437 ITAVILAV 444
           I   + ++
Sbjct: 424 ILTTLRSL 431

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  474 bits (1221), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 232/449 (51%), Positives = 311/449 (69%), Gaps = 9/449 (2%)

Query: 8   LCA--LLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEA 65
           LC   LL  P   +DLD  D +S+ +AT+L+  G+MDYY G + G T+GMF  PYYWWEA
Sbjct: 10  LCGSLLLYSPTGAMDLDVDDLNSLKNATALVAYGLMDYYTGLQYGQTIGMFSNPYYWWEA 69

Query: 66  GEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMS 125
           G  +G ML+ W+  +NDTY+DI+  A+++Q G D+D++P NQS  EGNDDQ  WGL VM+
Sbjct: 70  GGAWGSMLDYWWYMENDTYNDIVKQALLYQTGDDHDYVPLNQSTTEGNDDQAFWGLAVMA 129

Query: 126 AAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSN 185
           AAERNF+NP  D  P WL +AQ VFNTM +RWD++ CGGG+RWQIFTWNSGY+YKN+VSN
Sbjct: 130 AAERNFSNPDPD-QPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFTWNSGYDYKNSVSN 188

Query: 186 ACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIV 245
             +F +AARL RYTGN +Y+  AE V+DW+ DVG +   E   A V+DG +IDDNCT + 
Sbjct: 189 GALFHIAARLARYTGNQSYVDWAEKVFDWMRDVGLIT--EGDWAFVHDGVSIDDNCTSVT 246

Query: 246 KNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKT 305
             +W+YN G+++ G+AY+YN T ++  VW +R  + +  S+ FF    +++E+ CQ S T
Sbjct: 247 PYQWTYNHGLIMAGSAYLYNFTGSE--VWHNRTKEFLHSSSVFFKNGSILWEAACQASNT 304

Query: 306 CNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQL 365
           CN DQRSFK+ FSR L LT  L P +   I   + +SA+GAA+SC+GG DGHTCG+NW  
Sbjct: 305 CNTDQRSFKAYFSRFLGLTAQLVPESRSQIMEWIRSSAKGAAESCSGGRDGHTCGINWFN 364

Query: 366 GYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIK 425
           G  DG+YGLGEQ  ALE IQ++    RPAPYTS  GGSS GD+ A   +  TN+  + + 
Sbjct: 365 GSWDGFYGLGEQMAALEIIQNVRCLDRPAPYTSTTGGSSQGDSAAGTETHPTNL--TPLT 422

Query: 426 ITHKDKVGASIITAVILAVLVGGSIWMIF 454
           IT   + GA IITAVI   +V  ++W++ 
Sbjct: 423 ITAGSRAGAGIITAVIGISIVACAVWLVL 451

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  473 bits (1218), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 237/437 (54%), Positives = 301/437 (68%), Gaps = 10/437 (2%)

Query: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78
           ++LD  +  S+ +ATSLI  G+MDYY G + G TVGMF  PYYWWEAG  +G ML+ WF 
Sbjct: 23  VELDLDNYQSLQNATSLIAYGLMDYYTGDQYGKTVGMFSDPYYWWEAGGAWGCMLDYWFF 82

Query: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138
            +NDTY+D I  AMIHQAG D D++P NQS  EGNDDQ  WG+  M+AAERNFTNP  D 
Sbjct: 83  MENDTYNDEITAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPSD- 141

Query: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198
            P WL +AQ VFNTM +RWD++ CGGG+RWQIF WNSGY+YKNTVSN  +F +AARL RY
Sbjct: 142 EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARY 201

Query: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNAN-VYDGANIDDNCTDIVKNEWSYNQGIVL 257
           TGN+TY+  AE V++W+V V  +    NG    VYDG +IDDNCT +   +W+YNQG++L
Sbjct: 202 TGNETYVDWAEKVYEWMVGVNLI---SNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLL 258

Query: 258 GGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIF 317
            G+AY+YN T +D  +W +R  + +  S + FF D ++YE+ CQ   +CN DQRSFK+ F
Sbjct: 259 AGSAYLYNFTGSD--LWHTRTKEFLNAS-QVFFHDGIVYEAACQGPNSCNTDQRSFKAYF 315

Query: 318 SRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQ 377
           +R L +T  L P T   I   +  SA  AAKSC+GGTDGHTCGLNW  G  DG YGLGEQ
Sbjct: 316 ARFLGVTAQLVPETRSQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQ 375

Query: 378 ACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASII 437
             ALE + +     RP+PYT+DNGGSSVGD  A   +  TN+  S + IT   K GA II
Sbjct: 376 MAALEVMVNTRALDRPSPYTADNGGSSVGDGAAGTQAQPTNL--SPLNITKGSKAGAGII 433

Query: 438 TAVILAVLVGGSIWMIF 454
           TAVI   +V  ++W++F
Sbjct: 434 TAVIGISIVACALWLVF 450

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  473 bits (1218), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 231/436 (52%), Positives = 310/436 (71%), Gaps = 8/436 (1%)

Query: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78
           +D D  +  SI +AT+L+ GG++DYY G + G T+GMF  PYYWWEAG  +G +L+ W+ 
Sbjct: 21  LDFDVDNEGSIKNATALVAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSILDFWWY 80

Query: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138
            QNDTY+ ++ +A+++QAG ++D++P NQS  EGNDDQ  WGL VM+AAERNFTNP E  
Sbjct: 81  TQNDTYNAMLEEALLYQAGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPPET- 139

Query: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198
            P WL +AQ VFNTM +RWD E CGGG+RWQIFTWNSGY+YKNTVSN  +F LAARL RY
Sbjct: 140 EPQWLYLAQAVFNTMALRWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLARY 199

Query: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLG 258
           TGN+TY+  AE V+DW+  +G  +L EN N+ VYDGA +D NC+ I K  W+YNQG+++ 
Sbjct: 200 TGNNTYVDWAEKVFDWMKGIG--LLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGLLMS 257

Query: 259 GAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIFS 318
           G AY+YN T ++T  W +R  + +  S++ FF + ++YE TCQ++ TCN DQRSFK+ FS
Sbjct: 258 GCAYLYNYTGSET--WHTRTFEFL-NSSDIFFNNSILYERTCQEANTCNTDQRSFKAYFS 314

Query: 319 RMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQA 378
           R L LT  L P     I   + ASA+GAA+SC+GGTDGHTCGLNW     DG +GLGEQ 
Sbjct: 315 RFLGLTAQLVPAARNQIMDWIRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGEQM 374

Query: 379 CALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASIIT 438
            ALE +Q+++   RPAPYT+  GGSSVG+  A   +++TN+  S + IT   +  A IIT
Sbjct: 375 AALEIMQNVLCLDRPAPYTAATGGSSVGNGAAGTETSATNL--SPLDITTGSRAAAGIIT 432

Query: 439 AVILAVLVGGSIWMIF 454
           AVI   +V  ++W++ 
Sbjct: 433 AVIGLSIVACTVWLVL 448

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  472 bits (1214), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 235/437 (53%), Positives = 300/437 (68%), Gaps = 10/437 (2%)

Query: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78
           ++LD  +  S+ +ATSL+  G+MDYY G + G T+GMF  PYYWWEAG  +G ML+ WF 
Sbjct: 22  VELDLDNYESLQNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGCMLDYWFF 81

Query: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138
             NDTY+D I  AMIHQAG D D++P NQS  EGNDDQ  WG+  M+AAERNFTNP ED 
Sbjct: 82  MDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPEDD 141

Query: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198
            P WL +AQ VFNTM +RWD++ CGGG+RWQIF WNSGY+YKNTVSN  +F +AARL RY
Sbjct: 142 -PQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARY 200

Query: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNAN-VYDGANIDDNCTDIVKNEWSYNQGIVL 257
           TGN TY+  AE V++W+V V  +    NG    VYDG +IDDNCT +   +W+YNQG++L
Sbjct: 201 TGNQTYVDWAEKVYEWMVGVDLI---SNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLL 257

Query: 258 GGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIF 317
            G+AY+YN T +D  +W +R  + +  S + FF D ++YE+ CQ   +CN DQRSFK+ F
Sbjct: 258 AGSAYLYNFTGSD--LWHTRTKEFLNAS-QVFFHDGIVYEAACQGPNSCNTDQRSFKAYF 314

Query: 318 SRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQ 377
           +R L +T  L P T   I   +  SA  AAKSC+GGTDGHTCGLNW  G  DG YGLGEQ
Sbjct: 315 ARFLGVTAQLVPETRHQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQ 374

Query: 378 ACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASII 437
             ALE + +     RPAPYT++NGGSSVGD  A   +  TN+  + + IT   K GA II
Sbjct: 375 MSALEVLVNTRALDRPAPYTAENGGSSVGDGAAGTQARPTNL--APLNITKGSKAGAGII 432

Query: 438 TAVILAVLVGGSIWMIF 454
           TAVI   +V  ++W++F
Sbjct: 433 TAVIGISIVACALWLVF 449

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  470 bits (1209), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 235/437 (53%), Positives = 300/437 (68%), Gaps = 10/437 (2%)

Query: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78
           ++LD  +  S+ +ATSLI  G+MDYY G + G TVGMF  PYYWWEAG  +G ML+ WF 
Sbjct: 22  VELDLDNYESLQNATSLIAYGLMDYYTGNQYGKTVGMFSDPYYWWEAGGAWGCMLDYWFF 81

Query: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138
             NDTY+D I  AMIHQAG D D++P NQS  EGNDDQ  WG+  M+AAERNFTNP E+ 
Sbjct: 82  MDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPEN- 140

Query: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198
            P WL +AQ VFNTM +RWD++ CGGG+RWQIF WNSGY+YKNTVSN  +F +AARL RY
Sbjct: 141 EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARY 200

Query: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNAN-VYDGANIDDNCTDIVKNEWSYNQGIVL 257
           TGN TY+  AE V++W+V V  +    NG    VYDG +IDDNCT +   +W+YNQG++L
Sbjct: 201 TGNQTYVDWAEKVYEWMVGVNLI---SNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLL 257

Query: 258 GGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIF 317
            G+AY+YN T +D  +W +R  + +  S + FF D ++YE+ CQ   +CN DQRSFK+ F
Sbjct: 258 AGSAYLYNFTGSD--LWHTRTKEFLNAS-QVFFHDGIVYEAACQGPNSCNTDQRSFKAYF 314

Query: 318 SRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQ 377
           +R L +T  L P T   I   +  SA  AAKSC+GGTDGHTCGLNW  G  DG YGLGEQ
Sbjct: 315 ARFLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQ 374

Query: 378 ACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASII 437
             ALE + +     +PAPYT++NGGSSVGD  A   +  TN+  + + IT   K GA II
Sbjct: 375 MSALEVMVNTRALDKPAPYTAENGGSSVGDGAAGTQAQPTNL--APLNITKGSKAGAGII 432

Query: 438 TAVILAVLVGGSIWMIF 454
           TAVI   +V  ++W++F
Sbjct: 433 TAVIGISIVACALWLVF 449

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  474 bits (1219), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 220/398 (55%), Positives = 292/398 (73%), Gaps = 7/398 (1%)

Query: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78
           I++DT    SIC+ATSLIQ G++DYY G R GGTVG+FQ PYYWW++GE FG +L NW+L
Sbjct: 17  IEIDTHSKESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYL 76

Query: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138
           CQNDTY  +IYDA++ QAGP+YDF+P NQ+MVEGNDDQGV+ +T++ A ERNFT P + G
Sbjct: 77  CQNDTYEKLIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPK-G 135

Query: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198
            P WL M Q VFN+M+ RWD+  C GG+RWQI++WN+GY+YKN VS   +F +AARL RY
Sbjct: 136 SPSWLDMNQRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARY 195

Query: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLG 258
           TGN +Y   A+T++DWL  V +V+ ++     V DGA+I+ NCTDI + EW+YN GI++ 
Sbjct: 196 TGNASYFQVADTIFDWLTSVNYVMFDDK-YGYVMDGASIEQNCTDITRIEWTYNFGIIMD 254

Query: 259 GAAYMYNATQNDTSVWKSRLDQIVGGSTEFFF-KDKVMYESTCQDSKTCNQDQRSFKSIF 317
           G AY+YNAT N ++ W+    +++ G+ + FF K+ +MYE+ CQ +  CN DQRSFK++ 
Sbjct: 255 GCAYLYNAT-NGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTNNKCNNDQRSFKALL 313

Query: 318 SRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQ 377
           +R L  T  LAPYT  TI P++ ASA GAAKSC GG DGHTCGL+WQ G +DGYYG+GEQ
Sbjct: 314 ARFLGTTSVLAPYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQ 373

Query: 378 ACALEGIQSLMYSKRPAPYTSDNGG---SSVGDTEAAL 412
             ALE IQ+L+ +  P P  + NGG    +V DT+  L
Sbjct: 374 MSALEIIQNLLINDYPPPLVAPNGGCFNETVNDTQTRL 411

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  466 bits (1200), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 234/450 (52%), Positives = 306/450 (68%), Gaps = 10/450 (2%)

Query: 6   FALCALLLQPIL--GIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWW 63
           F  C L L   L   + LD  +  S+ +AT+L+  G+MDYY G + G T+GMF  PYYWW
Sbjct: 10  FVNCILSLYSSLTSAVYLDLDNYESLQNATALVAYGLMDYYTGLQYGKTIGMFSDPYYWW 69

Query: 64  EAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTV 123
           EAG  +G ML+ WF  +NDTY+DII  A+++Q G   D++P NQS  EGNDDQ  WG+  
Sbjct: 70  EAGGAWGCMLDYWFFMENDTYNDIIKQALLYQVGTANDYVPLNQSTTEGNDDQAFWGIAA 129

Query: 124 MSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTV 183
           M AAERNFTNP ED  P WL +AQ VFNTM +RWD++ CGGG+RWQIF WNSGY+YKN+V
Sbjct: 130 MMAAERNFTNPAEDE-PQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYKNSV 188

Query: 184 SNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTD 243
           SN  +F +AARL RYTGND+Y   AE V+DW+VDV  +   ++    VYDG + +DNCT 
Sbjct: 189 SNGALFHIAARLARYTGNDSYAEWAEKVYDWMVDVDLIT--QDQYYFVYDGVDSNDNCTT 246

Query: 244 IVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDS 303
           I K +W+YNQG++L G AY+YN T ++  +W +R    +  S+  FF D ++YE+ CQ+ 
Sbjct: 247 ITKYQWTYNQGLILSGCAYLYNYTGSE--LWHTRTKNFLS-SSSVFFNDTILYEAACQNQ 303

Query: 304 KTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNW 363
           +TCN DQRSFK+ FSR L +T  L P T + I   ++ASA GAA+SC+GGTDGHTCG+NW
Sbjct: 304 ETCNTDQRSFKAYFSRFLGVTAQLVPETRDNIMKWIDASAYGAAESCSGGTDGHTCGINW 363

Query: 364 QLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSD 423
             G  DG YGLGEQ  ALE + +     RPAPYTS NGGSS GD  A   +++TN+  S 
Sbjct: 364 FYGGWDGKYGLGEQMAALEILVNTRALDRPAPYTSSNGGSSTGDGAAGTETSATNL--SP 421

Query: 424 IKITHKDKVGASIITAVILAVLVGGSIWMI 453
           + IT   + GA IITAVI   +V  + W++
Sbjct: 422 LNITAGSRAGAGIITAVIGISIVACACWLV 451

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  466 bits (1200), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 232/441 (52%), Positives = 302/441 (68%), Gaps = 10/441 (2%)

Query: 15  PILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLE 74
           PI  +DL+ +   S+ +ATSL+  G+MDYY G + G TVGMF  PYYWWEAG  +G ML+
Sbjct: 16  PIAAVDLNLNSLQSLQNATSLVAYGLMDYYTGDQYGQTVGMFSDPYYWWEAGGAWGTMLD 75

Query: 75  NWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNP 134
            W+  QNDTY+DII  A++HQ G D +++P NQS  EGNDDQ  WG+TVM+AAERNFTNP
Sbjct: 76  YWYFMQNDTYNDIITAALLHQVGTDNNYIPLNQSTTEGNDDQAFWGITVMTAAERNFTNP 135

Query: 135 TEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAAR 194
            ED  P WL +AQ VFNTM +RWD++ CGGG+RWQIF WNSGY+YKN+VSN  +F +AAR
Sbjct: 136 PEDQ-PQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNSVSNGALFHMAAR 194

Query: 195 LGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNAN-VYDGANIDDNCTDIVKNEWSYNQ 253
           L RYTGN +Y+  AE V+DW+ DVG +    NG+   VYDGA+  DNCT +   +W+YNQ
Sbjct: 195 LARYTGNQSYVDWAERVYDWMSDVGLI---SNGSYKFVYDGASTTDNCTVLTTYQWTYNQ 251

Query: 254 GIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSF 313
           G++L GAAY+YN T +DT  W  R +Q++  S+  FF + ++YE+ CQ S TCN DQRSF
Sbjct: 252 GLLLSGAAYLYNYTGSDT--WLLRTNQLLNASS-VFFNNSILYEAACQKSGTCNNDQRSF 308

Query: 314 KSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYG 373
           K+ F R L  T  L   T  TI   + ASA  AA+SC+GGTDGHTCGLNW  G  DG YG
Sbjct: 309 KAYFLRFLGQTAQLVSETQPTIMKWLNASAYAAAQSCSGGTDGHTCGLNWFSGGWDGMYG 368

Query: 374 LGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVG 433
           LGEQ  ALE + +      P PY S +GGSS+G++ A     +TN+  + + IT   K  
Sbjct: 369 LGEQMSALEALVNTRVLHLPGPYNSTDGGSSIGNSAAGTEQEATNL--APLHITDGSKAA 426

Query: 434 ASIITAVILAVLVGGSIWMIF 454
           A+IIT+V+   +V   +W+I 
Sbjct: 427 AAIITSVVGISIVAAGVWLII 447

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  464 bits (1194), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 233/443 (52%), Positives = 308/443 (69%), Gaps = 9/443 (2%)

Query: 13  LQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGM 72
           L+  LGI LD +++ SI +AT+L+ GG++DYY G + G T+GMF  PYYWWEAG  +G +
Sbjct: 15  LRGSLGIYLDVNNTESIKNATALVAGGLLDYYTGLQYGETIGMFSDPYYWWEAGGAWGSI 74

Query: 73  LENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFT 132
           L+ W   QNDTY+ I+  A+++Q+G ++D++P NQS  EGNDDQ  WGL VM+AAERNFT
Sbjct: 75  LDYWHYTQNDTYNKILEQALLYQSGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFT 134

Query: 133 NPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLA 192
           NP  D  P WL +AQ VFNTM +RWD + CGGG+RWQIFTWNSGY+YKNTVSN  +F LA
Sbjct: 135 NPPPDQ-PQWLYLAQAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDYKNTVSNGALFHLA 193

Query: 193 ARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYN 252
           ARL RYTGNDTY+  AE V+DW+   G  +L E     VYDGA +DDNCT I K  W+YN
Sbjct: 194 ARLARYTGNDTYVEWAEKVFDWM--KGIKLLTEENENFVYDGAKVDDNCTVITKLIWTYN 251

Query: 253 QGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQD-SKTCNQDQR 311
           QG+++ G+AY+YN T  +   W +R  + +  S+  FF + V+YE  CQ  + +CN DQR
Sbjct: 252 QGLLMSGSAYLYNYTGAEK--WHTRTFEFL-NSSHIFFNNSVLYERACQGVTVSCNTDQR 308

Query: 312 SFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGY 371
           SFK+ FSR + LT  L P +   I   ++ASA GAA+SC+GG DGHTCGLNW     DG 
Sbjct: 309 SFKAYFSRFMGLTAQLVPESRSKIMAWIQASALGAAQSCSGGRDGHTCGLNWFYDGWDGK 368

Query: 372 YGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDK 431
           +GLGEQ  ALE +Q+L+   RPAPYT++ GGSSVG+  A   +++TN+  S + IT   +
Sbjct: 369 WGLGEQMSALEIMQNLLCLDRPAPYTAETGGSSVGNGAAGTETSATNL--SPLAITAGSR 426

Query: 432 VGASIITAVILAVLVGGSIWMIF 454
             A IITAVI   +V  +IW++ 
Sbjct: 427 AAAGIITAVIGLSIVACTIWLVL 449

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  463 bits (1191), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 230/437 (52%), Positives = 298/437 (68%), Gaps = 10/437 (2%)

Query: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78
           ++LD  +  S+ +ATSLI  G+MDYY G + G T+GMF  PYYWWEAG  +G ML+ WF 
Sbjct: 22  VELDLDNYESLENATSLIAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGCMLDYWFF 81

Query: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138
             NDTY+D I  AM+HQ+G D D++P NQS  EGNDDQ  WG+  M+AAERNFTNP  D 
Sbjct: 82  MDNDTYNDEIIAAMVHQSGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPAD- 140

Query: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198
            P WL +AQ VFNTM +RWD++ CGGG+RWQIF WNSGY+YKNTVSN  +F +AARL RY
Sbjct: 141 EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARY 200

Query: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNAN-VYDGANIDDNCTDIVKNEWSYNQGIVL 257
           TGN TY+  AE V++W+V V  +    NG    VYDG +I DNCT +   +W+YNQG++L
Sbjct: 201 TGNQTYVDWAEKVYEWMVGVNLI---SNGTYKYVYDGVSIGDNCTKVTSYQWTYNQGLLL 257

Query: 258 GGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIF 317
            G+AY+YN T +D  +W +R  + +  S++ FF+D ++YE+ CQ   +CN DQRSFK+ F
Sbjct: 258 AGSAYLYNFTGSD--LWHTRTKEFL-NSSQVFFQDGIVYEAACQGPNSCNTDQRSFKAYF 314

Query: 318 SRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQ 377
           +R L +T  L P T   I   +  SA  AAKSC+GGTDGHTCGLNW  G  DG YGLGEQ
Sbjct: 315 ARFLGVTAQLVPETRNQIMTWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQ 374

Query: 378 ACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASII 437
             ALE + +     +PAPYT+D GGSS GD  A   +  TN+  + + IT   K GA II
Sbjct: 375 MAALEVMVNTRALDKPAPYTADEGGSSAGDGAAGTQAQPTNL--APLNITKGSKAGAGII 432

Query: 438 TAVILAVLVGGSIWMIF 454
           TAVI   +V  ++W++F
Sbjct: 433 TAVIGISIVACALWLVF 449

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  457 bits (1177), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 228/451 (50%), Positives = 303/451 (67%), Gaps = 12/451 (2%)

Query: 8   LCALLLQPILG----IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWW 63
           L  L+L   +G    ++LD     S+ +AT+L+  G+MDYY G + G TVGMF  PYYWW
Sbjct: 6   LILLILSTFIGRVYSLELDLDSFESLQNATALVAYGLMDYYTGNQYGKTVGMFSDPYYWW 65

Query: 64  EAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTV 123
           EAG  +G M++ W+   N+TY+D I  A++HQ G D+D++P NQS  EGNDDQ  WG+ V
Sbjct: 66  EAGGAWGSMIDFWYYMDNNTYNDDIMAALLHQTGDDWDYIPLNQSTTEGNDDQAFWGIAV 125

Query: 124 MSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTV 183
           M+AAERNFTNP +D  P WL +AQ VFNTM +RWD   CGGG+RWQIFTWNSGY+YKNTV
Sbjct: 126 MTAAERNFTNPPDDQ-PQWLYLAQAVFNTMALRWDDATCGGGLRWQIFTWNSGYDYKNTV 184

Query: 184 SNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTD 243
           SN  +F LAARL RYTGN +Y+  AE V++W+ D    +++      VYDGA++ DNCT 
Sbjct: 185 SNGALFHLAARLARYTGNTSYVDWAEKVYNWMEDT--YLISNGTQMFVYDGASVTDNCTT 242

Query: 244 IVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDS 303
           + K +W+YNQG++L G+AY+YN T+++  +W  R    +  S   FF + +MYE+ CQ  
Sbjct: 243 VTKYQWTYNQGLLLSGSAYLYNFTESE--LWHERTKGFLNASV-VFFNNSIMYEAACQGP 299

Query: 304 KTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNW 363
           +TCN DQRSFK+ FSR L  T  L P T +T+   +  SA  AA SC+GGTDGHTCG+NW
Sbjct: 300 QTCNTDQRSFKAYFSRFLGATAQLVPETRDTVMHWVNTSAVAAATSCSGGTDGHTCGINW 359

Query: 364 QLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSD 423
             G  DGYYGLGEQ  ALE + +     +P PYTS+NGGSS+GD  A   +T+TN+  S 
Sbjct: 360 FYGGWDGYYGLGEQMSALEIMVNTRALHKPGPYTSENGGSSMGDGAAGTQATATNL--SP 417

Query: 424 IKITHKDKVGASIITAVILAVLVGGSIWMIF 454
           + +T   K  A IITAVI   +    +W+I+
Sbjct: 418 LNVTPGSKAAAGIITAVIGISIFACVLWLIY 448

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  457 bits (1175), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 237/453 (52%), Positives = 313/453 (69%), Gaps = 11/453 (2%)

Query: 4   QSFAL-CALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYW 62
           ++FAL  + L+     ++LD  D  S+ +AT+L+  G+MDYY GT+ GGTVGMF  PYYW
Sbjct: 6   KTFALILSTLIWRSQSLELDLDDYQSLQNATALVAWGLMDYYEGTKYGGTVGMFSSPYYW 65

Query: 63  WEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLT 122
           WEAG  FG +L+ W+   NDTY+D I  AM++QAG D+D++P NQS  EGNDDQ  WG+ 
Sbjct: 66  WEAGGAFGTLLDFWYFMDNDTYNDEILAAMVYQAGNDWDYIPLNQSTTEGNDDQAFWGIA 125

Query: 123 VMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNT 182
            M+AAERNFTNP  D  P WL +AQ VFNTM +RWD++ CGGG+RWQIFTWNSGY+YKN+
Sbjct: 126 AMTAAERNFTNPASD-EPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFTWNSGYDYKNS 184

Query: 183 VSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNA-NVYDGANIDDNC 241
           VSN  +F LAARL RYTGND+Y+  AE V++W+ D GF+     GN   VYDGA+ +DNC
Sbjct: 185 VSNGALFHLAARLARYTGNDSYVDWAEKVYNWMEDTGFIT---TGNTLYVYDGASTEDNC 241

Query: 242 TDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQ 301
           + + K +W+YNQG++L GAAY+YN ++  +S+W +R    +  S+  F  + +M E+ CQ
Sbjct: 242 SSVTKYQWTYNQGLILSGAAYLYNYSE--SSLWYNRTMTAL-SSSGVFLNNSIMCEAACQ 298

Query: 302 DSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGL 361
            + TC+ DQRSFK+ F+R L +T  L P T   I   M ASA   A+SC+GGTDGHTCGL
Sbjct: 299 PAGTCDTDQRSFKAYFARFLGVTAQLVPSTRTQIMTWMNASAYAVAESCSGGTDGHTCGL 358

Query: 362 NWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQ 421
           NW LG  DGYYGLGEQ  ALE + +     +P PY S NGGSS GD  A   +T+TN+  
Sbjct: 359 NWFLGSWDGYYGLGEQMSALEVLVNTRALDKPGPYNSTNGGSSQGDGAAGTETTATNL-- 416

Query: 422 SDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454
           + + IT   K  A+IITAVI   L+  ++W+IF
Sbjct: 417 APLNITGGSKAAAAIITAVIGISLIACTLWIIF 449

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  456 bits (1173), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 230/450 (51%), Positives = 299/450 (66%), Gaps = 10/450 (2%)

Query: 6   FALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEA 65
            +L ++L   +  + LD +D+ S+ +ATSL+  G+MDYY G + G TVGMF  PYYWW+A
Sbjct: 13  LSLASILPSQVSALTLDLNDTESLQNATSLVAYGLMDYYTGNQYGKTVGMFSDPYYWWQA 72

Query: 66  GEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMS 125
           G  +G ML+ W+   NDTY+D I  A++HQ G D D++P NQS  EGNDDQ  WG+ VM+
Sbjct: 73  GGAWGSMLDYWYYMNNDTYNDDIMAALLHQTGDDNDYVPLNQSTTEGNDDQAFWGIAVMT 132

Query: 126 AAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSN 185
           AAERNFTNP ED  P WL +AQ VFNTM MRWDS+ CGGG+RWQIF WNSGY+YKNTVSN
Sbjct: 133 AAERNFTNPPEDQ-PQWLYLAQAVFNTMAMRWDSDTCGGGLRWQIFIWNSGYDYKNTVSN 191

Query: 186 ACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGN-ANVYDGANIDDNCTDI 244
             +F +A+RL RYTGN +Y+  AE V+DW+ DV  +    NG+   VYDG NI DNCT +
Sbjct: 192 GALFHIASRLARYTGNQSYVDWAEKVYDWMYDVHLI---SNGSYMYVYDGVNIGDNCTTV 248

Query: 245 VKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSK 304
              +W+YNQG++L G AY+YN T  +  +W +R   ++  +   FF + ++YE+ CQ   
Sbjct: 249 TPYQWTYNQGLLLSGCAYLYNFTGEE--LWHNRTKNLLTAA-GVFFNNSILYEAACQGHN 305

Query: 305 TCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQ 364
           TCN DQRSFK+ FSR L  T  L P T   I   +  SA  AA+SC+GGTDGHTCG+NW 
Sbjct: 306 TCNTDQRSFKAYFSRFLGTTAQLVPETRNQIMHWINTSAVAAAQSCSGGTDGHTCGINWF 365

Query: 365 LGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDI 424
               DG YGLGEQ  ALE + +     + APYTS NGGSSVGD  A      TN+  + +
Sbjct: 366 ADGWDGMYGLGEQMAALEIMVNTKALSKAAPYTSSNGGSSVGDGAAGTEPHPTNL--APL 423

Query: 425 KITHKDKVGASIITAVILAVLVGGSIWMIF 454
            IT   + GA IITAVI   +V  ++W++F
Sbjct: 424 HITKGSRAGAGIITAVIGISIVTCALWLVF 453

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  453 bits (1166), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 228/438 (52%), Positives = 293/438 (66%), Gaps = 10/438 (2%)

Query: 18  GIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWF 77
            + LD ++  S+ + T+L+  G+MDYY G + G TVGMF  PYYWWEAG  +G ML+ WF
Sbjct: 19  ALSLDLNNYQSLENDTALVAYGLMDYYNGDQYGQTVGMFSNPYYWWEAGGAWGTMLDYWF 78

Query: 78  LCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTED 137
             +NDTY+D+I  A++HQ G + D++P NQS  EGNDDQ  WG+  M+AAERNFTNP E 
Sbjct: 79  FMENDTYNDLIMSALLHQTGENNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPES 138

Query: 138 GVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGR 197
             P WL +AQ VFNTM +RWD+++CGGG+RWQIF WNSGY+YKN+VSN  +F LAARL R
Sbjct: 139 S-PQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYDYKNSVSNGALFHLAARLAR 197

Query: 198 YTGNDTYLTKAETVWDWLVDVGFVVLNENGNAN-VYDGANIDDNCTDIVKNEWSYNQGIV 256
           YTGN +Y+  AE  +DW+ DVG +    NG    VYDG +I+ NCT I   +WSYNQG++
Sbjct: 198 YTGNQSYVDWAEKTYDWMSDVGLI---SNGTQKYVYDGTSIETNCTTITSYQWSYNQGLM 254

Query: 257 LGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSI 316
           L GAAY+YN T   +++W +R   ++  +T  FF + +MYE  CQ + TCN DQRSFKS 
Sbjct: 255 LAGAAYLYNFT--GSTIWLNRTMDLL-DATSVFFNNSIMYEVACQPTGTCNNDQRSFKSY 311

Query: 317 FSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGE 376
            +R L LT  L   T   I   +  SA   A SC+GGTDGHTCGLNW     DGYYGLGE
Sbjct: 312 LARFLGLTAQLVTITQSRIMNWLNTSAIAVAHSCSGGTDGHTCGLNWFDNGWDGYYGLGE 371

Query: 377 QACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASI 436
           Q  AL+ + +     RPAPY S NGGSS+GD  A   +T TN+  + + IT   KVGA+ 
Sbjct: 372 QMSALDVLVNTRVLDRPAPYNSTNGGSSIGDGAAGTEATPTNL--APLHITKGSKVGAAF 429

Query: 437 ITAVILAVLVGGSIWMIF 454
           ITA I   +V  SIW+I 
Sbjct: 430 ITAAIGLSIVFTSIWIIL 447

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  451 bits (1159), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 225/442 (50%), Positives = 295/442 (66%), Gaps = 8/442 (1%)

Query: 12  LLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGG 71
           L    L IDLD  D SS+ +ATSLI  G+MDYY G   G  +GMF +PYYWWEAG  +G 
Sbjct: 16  LFTNALKIDLD--DFSSLQNATSLIAYGMMDYYNGHDYGQVIGMFAKPYYWWEAGGAWGC 73

Query: 72  MLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNF 131
           +L+ W+  QNDTY+D+I +A+++Q G   D++P NQS  EGNDDQ  WG+  ++AAERNF
Sbjct: 74  LLDYWYYMQNDTYNDLITEALLYQTGDRNDYVPLNQSTTEGNDDQAFWGIAAITAAERNF 133

Query: 132 TNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQL 191
           TNP  D  P WL +AQ VFNTM +RWD   C GG+RWQIF WNSGY+YKN+VSN  +F +
Sbjct: 134 TNPPPDK-PQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSVSNGALFHI 192

Query: 192 AARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSY 251
           AARL RYTGN +Y+  A+ ++DW+   G +         VYDGANI+ NCTDI + +W+Y
Sbjct: 193 AARLARYTGNQSYVEWADKIYDWMFGTGIISDEYETYKFVYDGANIETNCTDITRYQWTY 252

Query: 252 NQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQR 311
           NQG+VL G AY+YN TQ++   W  R +Q + GS   FF+D V+YE+ CQ +K CN DQR
Sbjct: 253 NQGLVLAGCAYLYNHTQDEK--WLIRTEQFLNGSV-VFFRDNVIYEAACQPNKNCNNDQR 309

Query: 312 SFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGY 371
           SFK+ F+R L +T  L P T +TI   +  SA  AA++C+GGTDGHTCG++W     DGY
Sbjct: 310 SFKAYFARFLGVTAQLIPSTRDTIMRWINTSAYAAAQACSGGTDGHTCGMDWVWKGWDGY 369

Query: 372 YGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDK 431
           YGLGEQ  ALE + +      P PYTS NGGSS G   A      TN+  S + IT   K
Sbjct: 370 YGLGEQMAALEFMVNTRALDMPPPYTSFNGGSSTGSGAAGTERDPTNL--SPLHITAGSK 427

Query: 432 VGASIITAVILAVLVGGSIWMI 453
            GASIIT ++   ++ G++W++
Sbjct: 428 AGASIITCIVSISILTGAMWLV 449

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  439 bits (1130), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 223/436 (51%), Positives = 294/436 (67%), Gaps = 9/436 (2%)

Query: 18  GIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWF 77
            + L+ + +SS+ +A SL+  G+MDYY G + G T+GMF  PYYWWEAG  +G M++ W+
Sbjct: 20  AVHLNLNVTSSLQNAASLVAVGLMDYYNGDQYGQTIGMFSNPYYWWEAGGAWGCMIDYWY 79

Query: 78  LCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTED 137
             QNDTY+DII  A+++Q G   D++P NQS  EGNDDQ  WG+TVMSAAERNFTNP  D
Sbjct: 80  FMQNDTYNDIISQALLYQTGDRNDYIPLNQSTTEGNDDQAFWGITVMSAAERNFTNPPPD 139

Query: 138 GVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGR 197
             P WL +AQ VFNTM +RWD   C GG+RWQIF WNSGY+YKN+VSN  +F +AARL R
Sbjct: 140 K-PQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSVSNGALFHMAARLAR 198

Query: 198 YTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVL 257
           YTGN +Y+  A  V+DW+   G +  N+     VYDGA+I+ NCTDI + +W+YNQG++L
Sbjct: 199 YTGNQSYVDWAVKVYDWMEKTGLIS-NDTYFKFVYDGASIETNCTDITQFQWTYNQGLIL 257

Query: 258 GGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIF 317
            G AY+YN T++  S W +R +Q V GS   FF + ++YE+ CQ SK C+ DQRSF++ F
Sbjct: 258 SGCAYLYNHTED--SKWLTRTEQFVNGSA-VFFNNSIVYEAACQGSKRCDNDQRSFRAYF 314

Query: 318 SRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNW-QLGYHDGYYGLGE 376
           +R L +T  L P T + I   +  SA  AA++C+GGTDGHTCGLNW  +G+ DGYYGLGE
Sbjct: 315 ARFLGVTAQLVPTTKDIIMDWINTSAYAAAQACSGGTDGHTCGLNWFNIGW-DGYYGLGE 373

Query: 377 QACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASI 436
           Q  ALE + +      PAPYTS NGGSS G+  A      TN+    + IT   K GA I
Sbjct: 374 QMGALEFLVNTRALDMPAPYTSSNGGSSTGNGAAGTEKPPTNL--GPLHITDGSKAGAGI 431

Query: 437 ITAVILAVLVGGSIWM 452
           IT VI   ++  + W+
Sbjct: 432 ITCVIGLSILLCTTWL 447

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  436 bits (1122), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 218/436 (50%), Positives = 290/436 (66%), Gaps = 6/436 (1%)

Query: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78
           ++LD  D  SI +ATSL+  G+MDYY G   G TVG F  PYYWWEAG  +G +L+ W+ 
Sbjct: 22  LNLDVDDLQSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYY 81

Query: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138
            +N TY+D++ D+++HQAG D  + P N++  EGNDDQ  WG+ VM AAER   NP  D 
Sbjct: 82  MENSTYNDLLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPPAD- 140

Query: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198
            P  LA+AQ VFNTM +RWD E C GG+RWQIF WN GY+YKN+VSN  +F +AARL RY
Sbjct: 141 QPQRLALAQAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRY 200

Query: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLG 258
           TGN TYL  AE V+DW+  VG + + +     VYDG +I+DNCT++ K +W+YN G+++ 
Sbjct: 201 TGNATYLEWAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMA 260

Query: 259 GAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIFS 318
           G A++YN TQ++  +W  R  + +  S   F  +  +YE+ CQ    CN DQRSFK+ FS
Sbjct: 261 GCAFIYNHTQDE--LWHQRTLRFL-DSARIFLSNDTLYEAGCQGGDNCNIDQRSFKAYFS 317

Query: 319 RMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQA 378
           R L LT  L P + ETI   + ASA+GAA SC+GG DGHTCGLNW +   DG +GLGEQ 
Sbjct: 318 RFLGLTAQLVPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQM 377

Query: 379 CALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASIIT 438
            ALE IQ+L   +RPAPYT+ NGG+S GD  A   + + N+   DIK    D+ GA IIT
Sbjct: 378 AALEIIQNLRCLERPAPYTAMNGGTSPGDPAAGTKTKAENLPPLDIKA--GDRAGAGIIT 435

Query: 439 AVILAVLVGGSIWMIF 454
           A+I +  +  ++W+I 
Sbjct: 436 ALIGSSFLACTLWLII 451

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  431 bits (1109), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 217/435 (49%), Positives = 285/435 (65%), Gaps = 10/435 (2%)

Query: 21  LDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFLCQ 80
           +D +++ SI +A+SL+  G+MDYY G + G T+GMF  PYYWWEAG  +G ML+ W+  Q
Sbjct: 22  IDLNNTESIHNASSLVAVGLMDYYTGLQYGETIGMFSDPYYWWEAGGAWGCMLDYWWYMQ 81

Query: 81  NDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDGVP 140
           NDTY+DII  A+++Q G   D++P NQS  EGNDDQ  WG+  M+AAERNFTNP  D  P
Sbjct: 82  NDTYNDIIMQALLYQVGTHNDYVPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPSD-QP 140

Query: 141 GWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRYTG 200
            WL +AQ VFNTM +RWD+  C GG+RWQIF WN+GY+YKNTVSN  +F LAARL RYTG
Sbjct: 141 QWLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGYDYKNTVSNGALFNLAARLARYTG 200

Query: 201 NDTYLTKAETVWDWLVDVGFVVLNENGNAN-VYDGANIDDNCTDIVKNEWSYNQGIVLGG 259
           N +Y+  A+ V+DW+  VG +    NGN+  VYDG NI  NC +I   +WSYN G++L G
Sbjct: 201 NQSYVDWADKVYDWMYGVGLI---SNGNSRFVYDGVNIAHNCANITGYQWSYNHGLMLSG 257

Query: 260 AAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIFSR 319
            AY+YN T+++   W +R  + +  S   F+ + V+YE  CQ    CN DQRSFK+ F+R
Sbjct: 258 CAYLYNMTKDEK--WGNRTFEYL-NSASIFYNNSVLYEVACQTVNKCNTDQRSFKAYFTR 314

Query: 320 MLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQAC 379
            L +T  L P   +     + ASA GAA+SC+GG DGHTCG+NW     DG YGLGEQ  
Sbjct: 315 FLGVTAELIPQARDQAMKWINASALGAAQSCSGGYDGHTCGINWFYDGWDGMYGLGEQMS 374

Query: 380 ALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASIITA 439
           ALE + +     RP PY S NGGSS GD  A    + TN+  S + IT   + GA IIT 
Sbjct: 375 ALEALVNTQALNRPPPYNSTNGGSSTGDGAAGTEESPTNL--SPLDITAGSRAGAGIITC 432

Query: 440 VILAVLVGGSIWMIF 454
           VI   ++  ++W+I 
Sbjct: 433 VIGISILSCALWLIL 447

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  431 bits (1108), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 222/443 (50%), Positives = 294/443 (66%), Gaps = 10/443 (2%)

Query: 13  LQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGM 72
           L  + G++LD  D +S+ +AT+L+  G+MDYY G + G TVGMF  PYYWW+AG  +G M
Sbjct: 13  LVSVFGLELDLDDYASLQNATALVAYGLMDYYTGDQYGKTVGMFSDPYYWWQAGGAWGCM 72

Query: 73  LENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFT 132
           L+ W+  QNDTY+D I  A++HQ G + D++P NQS  EGNDDQ  WG+ VM AAER F 
Sbjct: 73  LDYWYFMQNDTYNDKIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWGIAVMQAAERKFP 132

Query: 133 NPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLA 192
           NP +D  P WL + Q VFNTM +RWDSE CGGG+RWQIF WNSGY+YKNTVSN  +F +A
Sbjct: 133 NPPDDK-PQWLYLTQAVFNTMALRWDSETCGGGLRWQIFVWNSGYDYKNTVSNGALFHIA 191

Query: 193 ARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNAN-VYDGANIDDNCTDIVKNEWSY 251
           ARL RYTGN +Y+  AE V+DW+ DV  +   +NG    VYDG +I+DNCT + K +W+Y
Sbjct: 192 ARLARYTGNQSYVDWAERVYDWMEDVHLI---DNGTYRYVYDGVSINDNCTTVTKYQWTY 248

Query: 252 NQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQR 311
           NQG++L G+AY++N T +D  +W  R    +  S   FF + ++YE+ CQ   TCN DQR
Sbjct: 249 NQGLMLSGSAYLFNMTGSD--LWHERTHAFLNAS-RVFFNNSILYEAACQGPNTCNTDQR 305

Query: 312 SFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGY 371
           SFK+ F+R L  T  L P T + I   +  SA  AAKSC+GGTDGHTCGLNW     DG 
Sbjct: 306 SFKAYFARFLGSTAELVPETRQQIMTWLNTSALAAAKSCSGGTDGHTCGLNWFRDDWDGM 365

Query: 372 YGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDK 431
           YGLGEQ  ALE + +    KR  PY + NGG+S GD  A      TN+  + + IT   +
Sbjct: 366 YGLGEQMAALEVMVNTQALKRAPPYNATNGGNSTGDGAAGTKPHPTNL--APLHITGGSR 423

Query: 432 VGASIITAVILAVLVGGSIWMIF 454
            GA IITA+I   ++  ++W+++
Sbjct: 424 AGAGIITAIIGISIIACALWLVY 446

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  429 bits (1102), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 224/446 (50%), Positives = 292/446 (65%), Gaps = 7/446 (1%)

Query: 8   LCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGE 67
           LC +  +    ++LD ++  S+ +ATSL+  G+MDYY G + G T+GMF  PYYWWEAG 
Sbjct: 11  LCTVWFRAGHAVELDLNNLDSLRNATSLVAYGLMDYYNGLQYGQTIGMFSNPYYWWEAGG 70

Query: 68  VFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAA 127
            +G M++ W+  QNDTY+DII  A+ +Q G + D++P NQS  EGNDDQ  WG+ VMSAA
Sbjct: 71  AWGTMIDYWYYMQNDTYNDIIMQALQYQTGVNNDYVPLNQSTTEGNDDQAFWGIAVMSAA 130

Query: 128 ERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNAC 187
           ERNFTNP  D  P WL +AQ VFNTM +RWD + C GG+RWQIF WNSGY+YKN+VSN  
Sbjct: 131 ERNFTNPPAD-RPQWLYLAQAVFNTMALRWDDQTCNGGLRWQIFVWNSGYDYKNSVSNGA 189

Query: 188 MFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKN 247
           +F + ARL R+TGND+Y+  AE V+DW+  V  +  +  G A VYDG NI DNCT +   
Sbjct: 190 LFHIGARLARFTGNDSYVEWAEKVYDWMESVNLIEDDGKG-AFVYDGVNIGDNCTKVTNL 248

Query: 248 EWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCN 307
           +W+YN G++L G AY+YN T +  + W +R ++ +      FF   VM+E+ CQ   TC 
Sbjct: 249 QWTYNHGLILSGCAYLYNYTGD--AKWYNRTERFL-EYAYVFFNRTVMFEAACQGVHTCT 305

Query: 308 QDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGY 367
            DQR+FK+ FSR L +T  L P T  TI   M ASA GAA+SC+GG DGHTCG+NW  G 
Sbjct: 306 TDQRTFKAYFSRFLGMTAQLVPDTQHTIMTYMNASAYGAAQSCSGGYDGHTCGINWFYGG 365

Query: 368 HDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKIT 427
            DGYYGLGEQ CALE + +      P PY S NGGSS GD  A      TN+  S + IT
Sbjct: 366 WDGYYGLGEQMCALEVMINTRALHVPGPYNSTNGGSSTGDGAAGTEQHPTNL--SPLNIT 423

Query: 428 HKDKVGASIITAVILAVLVGGSIWMI 453
              + GA IITA+I   ++   +W+I
Sbjct: 424 SGSRAGAGIITAIIGISIIACGLWLI 449

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  427 bits (1097), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 220/436 (50%), Positives = 294/436 (67%), Gaps = 7/436 (1%)

Query: 18  GIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWF 77
            + L+ +DSSS+ +A +L+  G+MDYY G + G T+GMF  PYYWWEAG  +G ML+ W+
Sbjct: 20  AVSLNLNDSSSLDNAAALVAYGLMDYYNGNQYGQTIGMFSDPYYWWEAGGAWGCMLDYWY 79

Query: 78  LCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTED 137
             QNDTY+D+IY+A+ +Q G D D++P NQS  EGNDDQ  WG+  ++AAERNFTNP  D
Sbjct: 80  YMQNDTYNDVIYEALQYQTGDDNDYIPLNQSTTEGNDDQAFWGIAAITAAERNFTNPPPD 139

Query: 138 GVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGR 197
             P WL +AQ VFNTM +RWDS+ C GG+RWQIF WNSGY+YKN+VSN  +F +AARL R
Sbjct: 140 K-PQWLYLAQAVFNTMALRWDSDTCNGGLRWQIFVWNSGYSYKNSVSNGALFHIAARLAR 198

Query: 198 YTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVL 257
           YTGN +Y+  +E V+DW++  G +  N      V+DG NI+ NCTDI   +W+YNQG++L
Sbjct: 199 YTGNQSYVDWSEKVYDWMLGTGLIS-NGTTYKFVHDGVNIETNCTDITPYQWTYNQGLLL 257

Query: 258 GGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIF 317
            G AY+YN TQ++   W  R +Q + GS   FF + V+YE+ CQ +K CN DQRSFK+ F
Sbjct: 258 AGCAYLYNFTQDEK--WLIRTNQFLNGS-GVFFNNSVIYEAACQPNKNCNNDQRSFKAYF 314

Query: 318 SRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQ 377
           +R L +T  L P T +TI   ++ SA  AA++C+GGTDGHTCG++W     DGYYGLGEQ
Sbjct: 315 ARFLGVTAQLLPSTRDTIMQWIDTSAYAAAQACSGGTDGHTCGMDWNWNGWDGYYGLGEQ 374

Query: 378 ACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASII 437
             ALE + +      P PYTS NGGSS G   A      TN+    + IT   K GA II
Sbjct: 375 MAALEFMVNTRALDLPPPYTSSNGGSSTGSGAAGTEQKPTNL--GPLNITAGSKAGAGII 432

Query: 438 TAVILAVLVGGSIWMI 453
           T V+   ++  S+W++
Sbjct: 433 TCVVGISILACSMWLV 448

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  422 bits (1086), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 217/444 (48%), Positives = 291/444 (65%), Gaps = 9/444 (2%)

Query: 11  LLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFG 70
           LL   +  ++LD  D SS+  ATSLI  G++DYY G   G T+GMF  PYYWWEAG  +G
Sbjct: 14  LLGTDVSALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFSSPYYWWEAGAAWG 73

Query: 71  GMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERN 130
            +++ WF  +NDTY+DII  A+++Q G   D++P NQS  EGNDDQ  WG+ VMSAAE+ 
Sbjct: 74  ALIDYWFYMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQAFWGIAVMSAAEKG 133

Query: 131 FTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQ 190
           F NP  D  P WLA+AQ VFNTM  RWDS  C GG+RWQIFTWN+GY+YKN+VSN  +F 
Sbjct: 134 FPNPDPD-QPQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYDYKNSVSNGALFH 192

Query: 191 LAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGN-ANVYDGANIDDNCTDIVKNEW 249
           LAARL RYTGN +Y   AE V+DW+  V  +  N+ G+   VYDGA I DNC+     +W
Sbjct: 193 LAARLARYTGNQSYADWAEKVYDWMASVQLI--NQTGDWTFVYDGAFIHDNCSRPSVLQW 250

Query: 250 SYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQD 309
           SYN G++LGG AY+ + T +D  VW +R  +++  S   FF + V+ E  CQ++ TCN D
Sbjct: 251 SYNHGLILGGCAYLTDFTGSD--VWHNRTLRLL-RSASIFFPNGVVTEVACQEAGTCNTD 307

Query: 310 QRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHD 369
           QRSFK+ F R L LT  L P + E     +  SA+GAA SC+GG DGHTCG+N+  G +D
Sbjct: 308 QRSFKAYFMRFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHTCGMNYSRGSYD 367

Query: 370 GYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHK 429
             YGLGEQ  ALE IQ+L   ++ +P T+  GG+S+G+  A  N     +  S + I++ 
Sbjct: 368 ESYGLGEQLAALETIQNLRCLEKGSPLTASEGGTSIGNPGAGGNRNLGTL--SPLDISNA 425

Query: 430 DKVGASIITAVILAVLVGGSIWMI 453
           D+ GA IITA++   L+   +W++
Sbjct: 426 DRAGAGIITALVGFSLISCIVWLV 449

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  416 bits (1068), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 212/405 (52%), Positives = 274/405 (67%), Gaps = 9/405 (2%)

Query: 6   FALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEA 65
            AL A++   +  +D+D  +  SI +ATSLI  G+MDYY G + G TVGMF  PYYWWEA
Sbjct: 17  LALSAVV-SKVAALDIDLDNLDSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYWWEA 75

Query: 66  GEVFGGMLE-NWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVM 124
           G  +G ML+ +WF+  NDTY   I  AM+HQ G   +++P NQS  EGNDDQ  WG+  M
Sbjct: 76  GGAWGSMLDYSWFM-DNDTYDSQIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGIAAM 134

Query: 125 SAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVS 184
           +AAERNFTNP ED  P WL +AQ VFNTM +RWD+E CGGG+RWQIF WNSGY+YKNTVS
Sbjct: 135 TAAERNFTNPPEDK-PQWLYLAQAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNTVS 193

Query: 185 NACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDI 244
           N  +F +A+RL RYTGN +Y+  AE V+DW+ DV   V++ +    VYDG + +DNC+ +
Sbjct: 194 NGALFHMASRLARYTGNQSYVDWAEKVYDWMWDVH--VISNSTYMFVYDGVDANDNCSTV 251

Query: 245 VKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDK-VMYESTCQDS 303
            + +W+YN G++L G+AY+YN T ++  VW +R  ++V  +  FF     +MYE+ CQ +
Sbjct: 252 TQYQWTYNHGLLLAGSAYLYNFTGDE--VWHNRTKKLVTAAQVFFNSTTGIMYEAACQAA 309

Query: 304 KTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNW 363
            TCN DQRSFK+ FSR L LT  L P T   I   +  SA  A KSC+GG DGHTCGLNW
Sbjct: 310 LTCNNDQRSFKAYFSRFLGLTAQLVPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNW 369

Query: 364 QLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDT 408
                DG YGLGEQ  ALE I +     +PAPYT+ NGGSS G++
Sbjct: 370 FKDGWDGMYGLGEQMSALECILNTRALMKPAPYTATNGGSSKGES 414

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  414 bits (1064), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 202/449 (44%), Positives = 289/449 (64%), Gaps = 6/449 (1%)

Query: 6   FALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEA 65
           F   A        +D+D +D  ++ +A++L+  G+MDYY G + G T+GMF  PYYWWEA
Sbjct: 9   FGFLASWFPSASALDIDLNDFKTLQNASALVAKGLMDYYTGDQYGQTIGMFSWPYYWWEA 68

Query: 66  GEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMS 125
           G  +  +++ WF  +NDTY+D + +A+++Q+G ++D++P NQS VEGNDDQ  WG+ V++
Sbjct: 69  GGAWNTLIDYWFYMKNDTYNDKVTEALLYQSGDNHDYVPLNQSTVEGNDDQAFWGIAVLN 128

Query: 126 AAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSN 185
           AAER F NP +D  P WL + Q VFNTM +RWD+  CGGG+RWQIFTWN+GY+YKNTVSN
Sbjct: 129 AAERKFPNPPDDQ-PQWLYLGQAVFNTMALRWDTATCGGGLRWQIFTWNTGYDYKNTVSN 187

Query: 186 ACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCT-DI 244
             +F +AARL  +TGN +Y+  AE V+DW+ DV  +    + N  VYDG ++ +NC+  +
Sbjct: 188 GALFHIAARLAYFTGNSSYVDWAERVYDWMHDVKLIEPENDDNKYVYDGVDVSNNCSGPV 247

Query: 245 VKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSK 304
            +  W+YN G+VL G AY+Y  T +   +W +R    +  + + F+ D ++YE +CQ SK
Sbjct: 248 TRIVWTYNHGLVLSGCAYLYKETGD--KIWYNRSKAFLETAAKLFYNDSILYEYSCQQSK 305

Query: 305 TCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQ 364
           TCN DQRSFKS +S  L+ T  L P   E I  ++ A+A  AA++C GG DGHTCG+NW 
Sbjct: 306 TCNVDQRSFKSYYSTFLAATAQLIPDFREQIMKVVNATAYAAAQACVGGYDGHTCGINWN 365

Query: 365 LGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDI 424
               DG YGLGEQ  ALE +       +PAPY S NGG+S GD  A   +  TN+    +
Sbjct: 366 QKGWDGQYGLGEQMAALEALVVTQAMNKPAPYNSTNGGNSTGDGAAGTQTAPTNL--KPL 423

Query: 425 KITHKDKVGASIITAVILAVLVGGSIWMI 453
            IT   + GA IIT V+   ++   +W++
Sbjct: 424 HITAGSRAGAGIITCVVGFSIIASFLWLV 452

>Kpol_370.8 s370 complement(14523..16148) [1626 bp, 541 aa] {ON}
           complement(14523..16148) [1626 nt, 542 aa]
          Length = 541

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 55/131 (41%), Gaps = 25/131 (19%)

Query: 306 CNQDQRSFKSIFSRMLSLTRSLAPYTAET------IDPLM---EASAEGAAKSCTGGTDG 356
           C+Q     K +F    +L   L+ + A+T      +DPL+    A    AAK CT  +  
Sbjct: 138 CSQPPVLIKEVFE---ALKPGLSSFDADTEGAAMSLDPLLGKALAVIPDAAKKCTPVSVK 194

Query: 357 HTCGLNWQLGYHDGYYGLGEQACA--LEGIQSLMYSKRPAPYTSDNGGSSV-GDTEAALN 413
            T GL            LGE+     L+ I+  +  K P P   +NG S + GD E    
Sbjct: 195 ATAGLRL----------LGEEKSQNILDAIRLRLTEKYPFPIVQNNGISIMGGDEEGVFA 244

Query: 414 STSTNVLQSDI 424
             +TN L  +I
Sbjct: 245 WITTNYLLGNI 255

>TPHA0F03360 Chr6 complement(723915..725666) [1752 bp, 583 aa] {ON}
           Anc_1.485 YEL042W
          Length = 583

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 59/129 (45%), Gaps = 23/129 (17%)

Query: 332 AETIDPLMEASAE---GAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQACA--LEGIQS 386
           A +++PL++ + E    A ++CT  T   T GL             G++     L  +++
Sbjct: 200 ANSLEPLLKRALEVIPEAQRACTPITVKATAGLRLT----------GDEVATEILAAVRN 249

Query: 387 LMYSKRPAPYTSDNGGSSVGDTEAALNS-TSTNVLQSDIKITHKDKVGASIITAVILAVL 445
           L+ +K P P    NG   +  T+  +N+  STN L  +I  +   KVG S +       L
Sbjct: 250 LLETKYPFPIIETNGIEIMSGTDEGINAWISTNYLLGNIGTSK--KVGTSAVFD-----L 302

Query: 446 VGGSIWMIF 454
            GGS  ++F
Sbjct: 303 GGGSTQIVF 311

>Skud_10.249 Chr10 complement(439686..442331) [2646 bp, 881 aa] {ON}
           YJR030C (REAL)
          Length = 881

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 307 NQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAE-GAAKSC 350
           N+++ SF+++  R+L +  S + Y   ++DP+++   E G   SC
Sbjct: 49  NKEEASFQTVLKRLLVICESHSKYHGSSLDPMVKVGGEMGKISSC 93

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,426,880
Number of extensions: 2303243
Number of successful extensions: 5856
Number of sequences better than 10.0: 59
Number of HSP's gapped: 5792
Number of HSP's successfully gapped: 59
Length of query: 454
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 341
Effective length of database: 40,524,141
Effective search space: 13818732081
Effective search space used: 13818732081
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)