Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E01144gna 1ON57257228330.0
Kwal_55.19721na 1ON57756825080.0
SAKL0E14806gna 1ON57856422380.0
KLLA0E12959gna 1ON57957020800.0
KLTH0G10736gsingletonON56854414520.0
KLTH0B08140gna 2ON56855514480.0
Suva_4.38na 3ON57157114260.0
Kwal_23.4458na 2ON56554714120.0
ZYRO0G01474gsingletonON57255714100.0
Smik_4.30na 3ON57157114060.0
KLLA0E14675gsingletonON57356414050.0
Kwal_0.16singletonON56454513990.0
SAKL0G15136g5.112ON56955613980.0
YDL210W (UGA4)na 3ON57157113930.0
SAKL0G14762gsingletonON56555313930.0
NDAI0C031505.112ON57457413740.0
KLLA0E24993gsingletonON56857013710.0
NCAS0D016005.112ON57657413680.0
TDEL0G013705.112ON56953713670.0
Skud_4.46na 3ON57157113630.0
KNAG0K01030singletonON58154213580.0
KNAG0E008205.112ON57155313490.0
SAKL0D01232gna 4ON57457613421e-180
ZYRO0B15048gsingletonON58256113261e-177
ABL116Cna 4ON54454511891e-157
Ecym_4621na 4ON57253511741e-154
SAKL0A04730g6.205ON5415573599e-36
Suva_7.1936.205ON5635353457e-34
Ecym_22126.205ON5454973377e-33
YGL077C (HNM1)6.205ON5635783324e-32
NCAS0D037506.205ON5694823324e-32
Kpol_1033.416.205ON5865073324e-32
Skud_7.2056.205ON5625543306e-32
AFL081W6.205ON5424763298e-32
NDAI0I011406.205ON6005553272e-31
TPHA0E029206.205ON5865373245e-31
KLLA0C15521g6.205ON5475293217e-31
TDEL0G014106.205ON5535283218e-31
ZYRO0G08602g6.205ON5695643182e-30
KLTH0H04444g6.205ON5324973154e-30
TBLA0A019606.205ON5945543131e-29
Smik_7.2066.205ON5634943121e-29
KNAG0D051406.205ON5435263058e-29
CAGL0H03399g6.205ON5564793042e-28
KAFR0K003606.205ON5385262987e-28
Kwal_56.240096.205ON3423282483e-22
TBLA0C057401.173ON6595282135e-17
CAGL0M08272g1.173ON6215432045e-16
Kwal_33.138061.173ON5495072001e-15
KLTH0F04576g1.173ON5495011973e-15
SAKL0C05126g1.173ON5685181921e-14
ZYRO0F00242gsingletonON5354891893e-14
TPHA0E033501.173ON6475221868e-14
KLLA0A06666g1.173ON5605501832e-13
NCAS0B083501.173ON6125191813e-13
Kpol_2002.701.173ON6225481779e-13
Ecym_81051.173ON5835491733e-12
TDEL0G021201.173ON5935281723e-12
KNAG0C009801.173ON7145331601e-10
ZYRO0G18700g1.173ON5915151582e-10
SAKL0H11484gna 5ON5603071511e-09
Kthe_YGOB_SAKL0H11484gna 5ON5563081483e-09
KAFR0G003901.173ON6075261456e-09
NDAI0A008901.173ON6415041457e-09
YNR056C (BIO5)na 5ON5613181441e-08
Suva_14.415na 5ON5323221384e-08
Skud_14.392na 5ON5314081375e-08
Smik_14.390na 5ON5543181376e-08
AEL125C1.173ON5755041376e-08
TDEL0G04830singletonON5433871332e-07
Skud_11.511.173ON6165021313e-07
Kwal_55.19602na 5ON5584001288e-07
Smik_11.551.173ON6194931261e-06
Suva_11.491.173ON6195021252e-06
YKL174C (TPO5)1.173ON6185041224e-06
KLLA0B00385gna 5ON5644141215e-06
KAFR0A062504.195ON575229761.4
Ecym_7299na 6ON54962705.7
NCAS0J011804.195ON585177705.8
NCAS0J02330singletonON773103706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E01144g
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {...  1095   0.0  
Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON...   970   0.0  
SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} simi...   866   0.0  
KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]...   805   0.0  
KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {...   563   0.0  
KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {...   562   0.0  
Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)   553   0.0  
Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W...   548   0.0  
ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {...   547   0.0  
Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)   546   0.0  
KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} simi...   545   0.0  
Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL21...   543   0.0  
SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]...   543   0.0  
YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease...   541   0.0  
SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]...   541   0.0  
NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {O...   533   0.0  
KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]...   532   0.0  
NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112    531   0.0  
TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112    531   0.0  
Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)   529   0.0  
KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8....   527   0.0  
KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112    524   0.0  
SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON...   521   e-180
ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]...   515   e-177
ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,...   462   e-157
Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {O...   456   e-154
SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} simila...   142   9e-36
Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON...   137   7e-34
Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar t...   134   7e-33
YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}  ...   132   4e-32
NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {O...   132   4e-32
Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa] ...   132   4e-32
Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON...   131   6e-32
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...   131   8e-32
NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205    130   2e-31
TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.2...   129   5e-31
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...   128   7e-31
TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.2...   128   8e-31
ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {...   127   2e-30
KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} simila...   125   4e-30
TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {O...   125   1e-29
Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON...   124   1e-29
KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {O...   122   8e-29
CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {...   121   2e-28
KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.20...   119   7e-28
Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {...   100   3e-22
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    87   5e-17
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    83   5e-16
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    82   1e-15
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    80   3e-15
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    79   1e-14
ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar ...    77   3e-14
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    76   8e-14
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    75   2e-13
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    74   3e-13
Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa] ...    73   9e-13
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    71   3e-12
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    71   3e-12
KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {O...    66   1e-10
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    65   2e-10
SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {...    63   1e-09
Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346...    62   3e-09
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    60   6e-09
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    60   7e-09
YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON} ...    60   1e-08
Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {...    58   4e-08
Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {...    57   5e-08
Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {...    57   6e-08
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    57   6e-08
TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {O...    56   2e-07
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    55   3e-07
Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C ...    54   8e-07
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    53   1e-06
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    53   2e-06
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    52   4e-06
KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON...    51   5e-06
KAFR0A06250 Chr1 complement(1262105..1263832) [1728 bp, 575 aa] ...    34   1.4  
Ecym_7299 Chr7 (630846..632495) [1650 bp, 549 aa] {ON} similar t...    32   5.7  
NCAS0J01180 Chr10 (204451..206208) [1758 bp, 585 aa] {ON} Anc_4....    32   5.8  
NCAS0J02330 Chr10 (456915..459236) [2322 bp, 773 aa] {ON}              32   6.3  

>KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W Permease that serves as a gamma- aminobutyrate
           (GABA) transport protein involved in the utilization of
           GABA as a nitrogen source; catalyzes the transport of
           putrescine and delta-aminolevulinic acid (ALA);
           localized to the vacuolar membrane
          Length = 572

 Score = 1095 bits (2833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/572 (94%), Positives = 542/572 (94%)

Query: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYK 60
           MSASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYK
Sbjct: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYK 60

Query: 61  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXX 120
           EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWF              
Sbjct: 61  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLILTIGIALG 120

Query: 121 XXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVL 180
             SSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVL
Sbjct: 121 ELSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVL 180

Query: 181 VSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIG 240
           VSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIG
Sbjct: 181 VSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIG 240

Query: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARD 300
           VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARD
Sbjct: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARD 300

Query: 301 AVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWT 360
           AVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWT
Sbjct: 301 AVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWT 360

Query: 361 LGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXX 420
           LGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVW    
Sbjct: 361 LGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWGSSA 420

Query: 421 XXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPI 480
                     VGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPI
Sbjct: 421 LSLALGCLCLVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPI 480

Query: 481 INWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKS 540
           INWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKS
Sbjct: 481 INWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKS 540

Query: 541 NLTDEEFQEYVGDDVIDAIMSNNEADYKPGDA 572
           NLTDEEFQEYVGDDVIDAIMSNNEADYKPGDA
Sbjct: 541 NLTDEEFQEYVGDDVIDAIMSNNEADYKPGDA 572

>Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON}
           YDL210W (UGA4) - GABA-specific transport protein [contig
           159] FULL
          Length = 577

 Score =  970 bits (2508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/568 (83%), Positives = 508/568 (89%)

Query: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYK 60
           MSASSS   TIKNRKS+V+VEVGQ+REL TITSAHGAPIRFVDARSATSD+QVLAELGYK
Sbjct: 6   MSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYK 65

Query: 61  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXX 120
           EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWF              
Sbjct: 66  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALA 125

Query: 121 XXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVL 180
             SS++PTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSL ASVCSIVYGLAQQILSAVL
Sbjct: 126 ELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVL 185

Query: 181 VSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIG 240
           VSNP FN T+PITYGVFAACI+ M ILTS+P++ TS++QTISI+SN FLI+LFFIA+PIG
Sbjct: 186 VSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIG 245

Query: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARD 300
           VSRSD L R FN G FIFG+ DN S+WNKGWNWCIAG+MPAIWTIGAYDSCLHMAEEARD
Sbjct: 246 VSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARD 305

Query: 301 AVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWT 360
           AVRAVPFGIVGSI+VCWI+GWL+CIV+LACM+P+ID+VL+S+FGQ MTQIIYDALGKRWT
Sbjct: 306 AVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWT 365

Query: 361 LGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXX 420
           LGFLSIFIICQFLMGASTVVANSRQFWAFARDDG PFSNFFKKV   TGVPVRAVW    
Sbjct: 366 LGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWGSSA 425

Query: 421 XXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPI 480
                     VGE ASGALFSLSVAGMYMALIFPITLRLTYGK+DFRPGPFYLGD WSPI
Sbjct: 426 LSLALGCLCLVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPI 485

Query: 481 INWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKS 540
           INWI+VF QAF+IIMMMFPSD+TV P+TMNYTVVIGPGFWVLSLIYYFVWQRKFY+GPKS
Sbjct: 486 INWIAVFAQAFMIIMMMFPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKS 545

Query: 541 NLTDEEFQEYVGDDVIDAIMSNNEADYK 568
           NLTDEEFQEYVG+DVIDAI+SNN A  K
Sbjct: 546 NLTDEEFQEYVGEDVIDAIISNNVATQK 573

>SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 578

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/564 (74%), Positives = 469/564 (83%), Gaps = 1/564 (0%)

Query: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYK 60
           MS SSS K  I  RKS+VD+ VG + EL +ITSAHGAPIR++DA++ATSDQQVLAE+GYK
Sbjct: 6   MSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYK 65

Query: 61  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXX 120
           EELKREFS++QIFGVAFSIMGLLPSIAST+DGGL AGPVGL WGWF              
Sbjct: 66  EELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALA 125

Query: 121 XXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVL 180
             SS++PTAGAVYVSCYQWAP R RK ISYSVGFLDTLSL ASVCSIVYGLAQQILSAV+
Sbjct: 126 ELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 185

Query: 181 VSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIG 240
           VSNPDF  TDPITYGVFAAC++ MA+LTSL S  TSKLQTISI+SNCFLI+LFFIA+PIG
Sbjct: 186 VSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCFLIILFFIALPIG 245

Query: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARD 300
           VSRSD LN SFN   FIFG+ +N + WN GW+WCI GL PAIWTIGAYDSCLHMAEEARD
Sbjct: 246 VSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARD 305

Query: 301 AVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWT 360
           AVRAVP GIVGSI  CWILGWL+CIV+LACM+PD++++++S +GQ +TQ+ YDALGKRWT
Sbjct: 306 AVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWT 365

Query: 361 LGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXX 420
           L FLS  IICQFLMGASTVVANSRQFWAFARDD  PFSNFFKKV+G   VP+RAVW    
Sbjct: 366 LAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWGSSI 425

Query: 421 XXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPI 480
                      GE A+ ALFSLS+AGMYMALIFPITLRLTYGKKDFRPGPFY+GDFWSPI
Sbjct: 426 LSLALGCLCLAGEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPI 485

Query: 481 INWISVFFQAFVIIMMMFP-SDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPK 539
           INWISV FQ F IIM+MFP     +   TMNYTVVIGPGFWVLSLIYY+ WQ KFY+GPK
Sbjct: 486 INWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPK 545

Query: 540 SNLTDEEFQEYVGDDVIDAIMSNN 563
           SNL+DEEF E VGDDV+DAI+S+N
Sbjct: 546 SNLSDEEFAERVGDDVLDAILSSN 569

>KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 579

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/570 (68%), Positives = 458/570 (80%), Gaps = 4/570 (0%)

Query: 1   MSASSSNKGTIKNRK-SHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGY 59
           MS SS     + NR  S+ ++  G + EL  +TSAHGAPIR++DA SATSD QVLAE+GY
Sbjct: 8   MSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGY 67

Query: 60  KEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXX 119
           KEELKRE+S++QIFGVAFSIMGLLPSIAST+DGGL+AG VGL WGWF             
Sbjct: 68  KEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIAL 127

Query: 120 XXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAV 179
              SS++PTAGAVYV+CYQWAP++ RKCISYSVGFLDTLSL ASVCSIVYGLAQQILSAV
Sbjct: 128 GELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAV 187

Query: 180 LVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPI 239
           +V NPDF  TDPITYGVF ACIV + +LTS+ S+IT++LQT SII+N FLI+LFFI +PI
Sbjct: 188 VVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSIIANVFLIILFFIVLPI 247

Query: 240 GVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEAR 299
           GVSRSD +  SFN   +IFG V N + WN GW+WCI GL PAIWTIGAYDSCLHMAEEA+
Sbjct: 248 GVSRSDKV--SFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAK 305

Query: 300 DAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRW 359
           DA RAVP GIV SI+ CWILGWL+CIVILACMNPD++++++S +GQ +TQ+  DALGKRW
Sbjct: 306 DARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRW 365

Query: 360 TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXX 419
           TL FLS+ IICQFLMGASTV+ANSRQFWAFARDDG PFS FFKKVD  + VP+R++W   
Sbjct: 366 TLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSS 425

Query: 420 XXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSP 479
                       G+TA+ ALFSLS+AGMYMAL+FPI LRLTYG+KDFRPGPFYLG FWS 
Sbjct: 426 FFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWST 485

Query: 480 IINWISVFFQAFVIIMMMFPSD-STVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGP 538
              W++VFFQ F ++M+MFP D S +T  TMNYTVVIGPGFWVLSLIYYFVWQRKFY+GP
Sbjct: 486 ANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGP 545

Query: 539 KSNLTDEEFQEYVGDDVIDAIMSNNEADYK 568
           KSNLTDEEF E VG+D IDA++SN    ++
Sbjct: 546 KSNLTDEEFVEAVGEDAIDAMLSNYSQAHQ 575

>KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/544 (50%), Positives = 378/544 (69%), Gaps = 4/544 (0%)

Query: 24  QMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKEELKREFSSIQIFGVAFSIMGLL 83
           Q   L TITS     + F+DA+ A  D ++LAE+GYK+EL R FS+IQ+FGVAFSIMGLL
Sbjct: 26  QFGSLRTITSKRAGEVNFIDAKGANGDSELLAEIGYKQELNRHFSTIQVFGVAFSIMGLL 85

Query: 84  PSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQR 143
           PSIAS L  G+  G V L WGW                 +SA+PT+G +Y   Y ++P++
Sbjct: 86  PSIASVLAIGMPGGMVSLMWGWLIAGIFILAVGCGMAELASAIPTSGGLYYYTYYYSPEK 145

Query: 144 VRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVS-NPDFNATDPITYGVFAACIV 202
            +  +S+ +G  ++L+L A +CSI YGLAQ+ILS V+V+ + DFN T   TYGVF A I 
Sbjct: 146 YKAFLSFVIGNTNSLALVAGLCSITYGLAQEILSIVVVAKDGDFNITSGKTYGVFVAGIA 205

Query: 203 CMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVD 262
               +TSL +   SKLQT+SI++N  LIVLFFI +PIGV+ +  LN  FN G FIFG+  
Sbjct: 206 ATTAVTSLATVAVSKLQTVSILANVGLIVLFFIVLPIGVANTKGLN--FNDGSFIFGKWQ 263

Query: 263 NRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWL 322
           N ++W  GW + +AGL PAIWTIGA+DSC+HM+EEA++A +AVP GI+ SI VCWILG++
Sbjct: 264 NETSWPDGWQFMMAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPVGIISSIGVCWILGFI 323

Query: 323 VCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVAN 382
           VCIVI ACM P+ID++L+S +G  + QI+++ALGK+WT+ F+++   CQFLMG S + A 
Sbjct: 324 VCIVIAACMGPNIDAILESSYGSPLPQILFNALGKKWTIAFMTLIAACQFLMGCSILTAI 383

Query: 383 SRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSL 442
           SRQ WAFARDDG  FS + K V+     P+RA W              +G TAS ALFSL
Sbjct: 384 SRQIWAFARDDGLMFSRYIKVVNKKLSSPLRATWFGALCALVIGLLCLIGSTASNALFSL 443

Query: 443 SVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDS 502
           ++ G Y+A + P  LR+T GK  FRPG F++G  WSPI+NWI++ FQ F++IM+MFP+DS
Sbjct: 444 AIGGNYVAWMTPNLLRMTVGKDLFRPGAFFMGKLWSPIVNWIAIIFQTFILIMIMFPADS 503

Query: 503 T-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGDDVIDAIMS 561
             +TP TMNYTVVI  G W+ S++Y+ V+++K + GPKSNL+DEE+ + VG DVID I+S
Sbjct: 504 KDITPDTMNYTVVICGGVWIGSIVYFLVYKKKAFHGPKSNLSDEEYADAVGQDVIDQILS 563

Query: 562 NNEA 565
           + ++
Sbjct: 564 HQKS 567

>KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/555 (50%), Positives = 384/555 (69%), Gaps = 7/555 (1%)

Query: 16  SHVDVEVGQMRELG---TITSAHGAPIRFVDARSATSDQQVLAELGYKEELKREFSSIQI 72
           S ++  VG + ++G   TITS     + F+DA+ A  D ++LAE+GYK+EL R FS++Q+
Sbjct: 15  SSLEQAVGDIHQIGSLRTITSKRAGEVNFIDAKRAHGDAELLAEIGYKQELNRHFSTVQV 74

Query: 73  FGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAV 132
           FGVAFSIMGLLPSIAS L  G+  G V L WGWF                +SA+PT+G +
Sbjct: 75  FGVAFSIMGLLPSIASVLAIGMPGGMVSLVWGWFIAGIFILAVGCGMSELASAIPTSGGL 134

Query: 133 YVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVS-NPDFNATDP 191
           Y   Y +APQ+ +   S+ +G+ ++L+L + +CSI YGLA++ILS V+VS + DF  T+ 
Sbjct: 135 YYYTYYYAPQKYKAFFSFVIGYSNSLALVSGLCSITYGLAEEILSIVVVSKDGDFTITNG 194

Query: 192 ITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSF 251
            TYGVF A I    ++TS+ +   SKLQT+SI++N  LIVLFFI +PIGV+ +  L+  F
Sbjct: 195 KTYGVFVAGIAATTVVTSIATVAVSKLQTVSILANVGLIVLFFIVLPIGVANTKGLD--F 252

Query: 252 NGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVG 311
           N G FIFG+  N +TW  GW + +AGL PAIWTIGA+DSC+HM+EEA++A +AVP GI+ 
Sbjct: 253 NDGSFIFGKWLNETTWPDGWQFMLAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPLGIIS 312

Query: 312 SITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQ 371
           SI+VCWILG+L+CIV+ ACM PDID++L S FG  + QI+Y+ALGK+WT+  +++   CQ
Sbjct: 313 SISVCWILGFLICIVMAACMGPDIDAILGSSFGSPLPQILYNALGKKWTIAIMTLIAACQ 372

Query: 372 FLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXV 431
           FLMG S + A SRQ WAFARDDG  FS + K V+     P+RA W              +
Sbjct: 373 FLMGCSILTAISRQIWAFARDDGLMFSKYIKVVNKKLSSPLRATWFGAVCALVIGLLCLI 432

Query: 432 GETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAF 491
           G TAS ALFSL + G Y+A + P  LR+T GK  FRPG FY+G  WSPI+NW ++ FQ F
Sbjct: 433 GGTASNALFSLGIGGNYLAWMAPNLLRMTTGKDLFRPGAFYMGKTWSPIVNWTAIVFQIF 492

Query: 492 VIIMMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEY 550
           ++IM+MFP++S  +TP  MNYTVVI  G W+ S+IY+FV+++K + GPKSNL+D+E+ + 
Sbjct: 493 ILIMIMFPAESKGITPDAMNYTVVICGGVWIGSMIYFFVYKKKAFNGPKSNLSDDEYVDA 552

Query: 551 VGDDVIDAIMSNNEA 565
           VG DVID I+S+ ++
Sbjct: 553 VGQDVIDQILSHQKS 567

>Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/571 (49%), Positives = 389/571 (68%), Gaps = 10/571 (1%)

Query: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELGT----ITSAHGA-PIRFVDARSATSDQQVLA 55
           MS+ + NK T++ + S    +  Q++ LG+    I S  GA  + +++A  + +D Q+LA
Sbjct: 3   MSSKNENKITVERKVSTDLGQAFQLQGLGSNLRSIRSKTGAGEVNYINASKSVNDHQLLA 62

Query: 56  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXX 115
           E+GYK+ELKR+FS++Q+FG+AFSIMGLLPSIAS + GGL  GP  L WGWF         
Sbjct: 63  EIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGGGLDGGPASLLWGWFVAGFFLLLV 122

Query: 116 XXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQI 175
                  +SA+PTAG +Y   Y +AP+  ++ IS+ +G  ++L+L+A VCSI YGLA++I
Sbjct: 123 GMSMAEHASAIPTAGGLYYWTYYYAPEGYKEIISFIIGCSNSLALTAGVCSINYGLAEEI 182

Query: 176 LSAV-LVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFF 234
            +AV L  + +F+ T  + YG+FA  +V M + T + S   ++LQT+SI SN F+I+L F
Sbjct: 183 AAAVTLTKDGNFDVTRGMLYGIFAGAVVLMGLCTCIASGGIARLQTLSIASNVFIIILLF 242

Query: 235 IAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHM 294
           IA+PIG  R+      FN GDFIFG+ +N S WN GW +C+AG MPA+WTI ++DSC+H 
Sbjct: 243 IALPIGTKRN---MGGFNNGDFIFGKFENFSDWNNGWQFCLAGFMPAVWTINSFDSCVHQ 299

Query: 295 AEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDA 354
           +EEA+DA ++VP GI+ SI VCWILGW + I +LAC+NPD+ SVLDS++G A+ QIIYD+
Sbjct: 300 SEEAKDAKKSVPIGIILSILVCWILGWFIIICLLACINPDLASVLDSKYGFALAQIIYDS 359

Query: 355 LGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRA 414
           LGK+W + F+S+   CQFLMGAS   A SRQ WAF+RD+G P S + KKVD    VP  A
Sbjct: 360 LGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKKVDSKYSVPFYA 419

Query: 415 VWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLG 474
           +               + + A+ ALFSL+VAG  +A   P  LRLT GK  FRPGPFYLG
Sbjct: 420 ILAACVCSLVLGLLCLIDQAATNALFSLAVAGNNLAWSTPTVLRLTSGKDLFRPGPFYLG 479

Query: 475 DFWSPIINWISVFFQAFVIIMMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRK 533
            FWSPI+ W+ V FQ F+I+M+MFP+    +T  TMNYT VIGPG W+L+ IYY V+++K
Sbjct: 480 KFWSPIVAWVGVAFQVFIIVMVMFPAQQKGITKATMNYTCVIGPGIWILAGIYYKVYKKK 539

Query: 534 FYKGPKSNLTDEEFQEYVGDDVIDAIMSNNE 564
           +Y GP +NL+DE++ + VG DVID I+S  E
Sbjct: 540 YYHGPATNLSDEDYVDAVGVDVIDTIISKQE 570

>Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W
           (UGA4) - 1:1 [contig 2] FULL
          Length = 565

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/547 (50%), Positives = 371/547 (67%), Gaps = 4/547 (0%)

Query: 21  EVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKEELKREFSSIQIFGVAFSIM 80
           E+ Q+  L TITS     + F+DA+ A  D+++LAE+GYK+EL R FS++Q+FGVAFSIM
Sbjct: 20  EIRQIGSLRTITSKRAGEVNFIDAKGARDDKELLAEIGYKQELNRHFSTVQVFGVAFSIM 79

Query: 81  GLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWA 140
           GLLPSIAS L  G + G V L WGW                 +SA+PT+G +Y   Y +A
Sbjct: 80  GLLPSIASVLSIGFAGGAVALVWGWLIAGFFIMTIGLSMAELASAIPTSGGLYYYTYYYA 139

Query: 141 PQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVS-NPDFNATDPITYGVFAA 199
           PQR +  +S+ +G  ++L+L+A +CSI YGLA +ILS V+VS + +F  T+  TYGV+  
Sbjct: 140 PQRFKSFLSFVIGNSNSLALTAGLCSITYGLALEILSIVVVSKDGNFEITNGKTYGVYVG 199

Query: 200 CIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFG 259
            I   A++TS+ +   SK+QT+SIISN  LI  F I +PIGVS +  L   FN G FIFG
Sbjct: 200 GIAATAVVTSVATVAVSKMQTLSIISNVALIAFFLIVLPIGVSNTKGLE--FNDGSFIFG 257

Query: 260 QVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWIL 319
           +  N ++W  GW + +AGL PAIWTIGA+DSC+HM+EEA++A +AVP GI+ SI VCW+L
Sbjct: 258 KFMNETSWPDGWQFLMAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPIGIISSIFVCWVL 317

Query: 320 GWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLMGASTV 379
           G+ +CI I ACM PDID++L S FG  + QI+Y+ALGK+WT+ F+S+   CQF MG S +
Sbjct: 318 GFFICIAIAACMGPDIDAILGSSFGSPLAQILYNALGKKWTITFMSLIAFCQFAMGCSIL 377

Query: 380 VANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGAL 439
            A SRQ WAFARDDG  F  +FK V+     P+RA W              +G TA+ AL
Sbjct: 378 TAISRQIWAFARDDGLMFPKYFKVVNKKLSSPIRATWFGAACALVIGLLCLIGGTAANAL 437

Query: 440 FSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFP 499
           FSL + G Y+A + P  LR+T GK  FRPG F++G+FWSPI+NW S+ FQ F+I M+MFP
Sbjct: 438 FSLGIGGNYLAWMTPNLLRMTVGKDLFRPGQFHMGEFWSPIVNWTSIVFQIFIIFMIMFP 497

Query: 500 SDST-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGDDVIDA 558
           ++   +TP TMNYTVVI  G W  S+IYY V++ K + GPKSNLTDEEF E VG DVID 
Sbjct: 498 AEKVGITPDTMNYTVVICGGVWFGSMIYYAVYKYKVFHGPKSNLTDEEFSEVVGQDVIDQ 557

Query: 559 IMSNNEA 565
           I+S+ ++
Sbjct: 558 ILSHQKS 564

>ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 572

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/557 (48%), Positives = 379/557 (68%), Gaps = 12/557 (2%)

Query: 17  HVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKEELKREFSSIQIFGVA 76
            V    G++R + + T A    + +++A ++  D Q+LAE+GYK EL+R+FS++Q+FG+A
Sbjct: 21  QVYTSAGRIRSIRSRTGA--GEVNYINAATSNDDNQLLAEIGYKPELERKFSTLQVFGIA 78

Query: 77  FSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSC 136
           FSIMGLLPSIAS LD GL+ GPV   WGWF                SSA+PTAG +Y   
Sbjct: 79  FSIMGLLPSIASELDDGLAGGPVSTVWGWFIAGIFIFLVGVTMAENSSAIPTAGGLYFWT 138

Query: 137 YQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVS-NPDFNATDPITYG 195
           Y +AP+  +  IS+ +G  ++L+L+A VCSI YG A+++L+AV+VS + +++ T    YG
Sbjct: 139 YHYAPEGYKAAISFVIGIGNSLALAAGVCSIDYGFAEEVLAAVVVSKDGNWDITQGKLYG 198

Query: 196 VFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRS-FNGG 254
           V+A C++   ++T + S   +K+Q+ISI SN F+IVLF IA+PIG      +NR  FN G
Sbjct: 199 VYAGCVILTIMVTCVASGWLAKMQSISIYSNLFIIVLFLIALPIGTK----VNRGGFNDG 254

Query: 255 DFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSIT 314
            FIFG+ +N S W+ GW + +AG  P +WTI ++DSC+H AEEA+DA +AVP GI+GSI 
Sbjct: 255 SFIFGKFENLSDWSNGWQFFLAGFTPIVWTISSFDSCVHQAEEAKDASKAVPIGIMGSIF 314

Query: 315 VCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLM 374
           VCWILGW++ IV++AC++ D++ V++S +   M QII+D+LGK WT+ FL++   CQFLM
Sbjct: 315 VCWILGWVINIVLMACIDKDMNRVMNSPYQLGMAQIIFDSLGKNWTIAFLALMAFCQFLM 374

Query: 375 GASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGET 434
           GAS++ A SRQ WAFARDDG P SN  KKVD    VP  A                + + 
Sbjct: 375 GASSMTAASRQIWAFARDDGMPLSNILKKVDSKFHVPFYASICSGLMSLVLGLLILIDDA 434

Query: 435 ASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVII 494
           A+ ALFSL++AG Y+A + P  LRLT+G+  FRPGPFYLG FWSP++NW +V F AF+II
Sbjct: 435 AAEALFSLAIAGNYLAWVTPNFLRLTWGRDVFRPGPFYLGKFWSPVVNWTTVVFMAFIII 494

Query: 495 MMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGD 553
           M+MFP+    +    MNY  VIGPG W+LSLIYY+V+++K Y GPKSNL DEE+ + VG 
Sbjct: 495 MVMFPTQKNGINKENMNYACVIGPGTWLLSLIYYWVYKKKEYHGPKSNLDDEEYADAVGP 554

Query: 554 DVIDAIMSNNEADYKPG 570
           +V+DAI+S    DY  G
Sbjct: 555 EVLDAILST---DYSTG 568

>Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/571 (49%), Positives = 390/571 (68%), Gaps = 10/571 (1%)

Query: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELGT----ITSAHGA-PIRFVDARSATSDQQVLA 55
           MS+ + NK TI+ R S    +  Q++ LG+    I S  GA  + ++DA  + +D Q+LA
Sbjct: 3   MSSKNENKITIEQRVSTDVGQAYQLQGLGSNLRSIRSKTGAGEVNYIDAAKSVNDNQLLA 62

Query: 56  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXX 115
           E+GYK+ELKR+FS+IQ+FG+AFSIMGLLPSIAS + GGL  GP  L WGWF         
Sbjct: 63  EIGYKQELKRQFSTIQVFGIAFSIMGLLPSIASVMGGGLGGGPATLVWGWFIAAFFILLV 122

Query: 116 XXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQI 175
                  +S++PTAG +Y   Y +AP+  ++ IS+ +G  ++L+L+A VCSI YGLA++I
Sbjct: 123 GITMAEHASSIPTAGGLYYWTYYYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLAEEI 182

Query: 176 LSAV-LVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFF 234
            +A+ L  + +F+ T    YG+FA  +V M I T + S   ++LQT+SI +N F+IVL F
Sbjct: 183 AAAITLTKDGNFDVTSGKLYGIFAGAVVVMGICTCIASGAIARLQTLSIFANLFIIVLLF 242

Query: 235 IAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHM 294
           IA+PIG   +      FN GDFIFG+ +N S WNKGW +C+AG MPA+WTIG++DSC+H 
Sbjct: 243 IALPIGTKHNIG---GFNNGDFIFGKYENLSDWNKGWQFCLAGFMPAVWTIGSFDSCVHQ 299

Query: 295 AEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDA 354
           +EEA+DA ++VP GI+ SITVCWILGWL+ I ++AC+NPDIDSVLDS++G A+ QIIYD+
Sbjct: 300 SEEAKDAKKSVPIGIISSITVCWILGWLIIICLMACINPDIDSVLDSKYGFALAQIIYDS 359

Query: 355 LGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRA 414
           LGK+W + F+S+   CQFLMGAS   A SRQ WAF+RD+G P S + K+VD    VP  A
Sbjct: 360 LGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVPFFA 419

Query: 415 VWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLG 474
           +               + + A+ ALFSL+VAG  +A   P  LRLT G+  FRPGPFYLG
Sbjct: 420 ILAACAGSLILGLLCLIDDAATDALFSLAVAGNNLAWSTPTVLRLTSGRDLFRPGPFYLG 479

Query: 475 DFWSPIINWISVFFQAFVIIMMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRK 533
             WSPI+ WI V FQ F+II++MFP+    +T +TMNY  VIGPG W L+ +YY V+++K
Sbjct: 480 KIWSPIVAWIGVAFQVFIIILVMFPAQQHGITKSTMNYACVIGPGIWFLAGVYYKVYKKK 539

Query: 534 FYKGPKSNLTDEEFQEYVGDDVIDAIMSNNE 564
           +Y GP +NL+D+++ E VG DVID I+S  E
Sbjct: 540 YYHGPATNLSDDDYAEAVGIDVIDTIISKQE 570

>KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 573

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/564 (46%), Positives = 378/564 (67%), Gaps = 4/564 (0%)

Query: 3   ASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKEE 62
           +S S+K         V   V  +  L TITS     + +++A++A  D ++LAE+GYK+E
Sbjct: 6   SSLSDKNNFVITSQEVKNRVDVVTSLRTITSRRVGDVNYINAKTAHDDTELLAEIGYKQE 65

Query: 63  LKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXX 122
           L+R FS  Q+FGVAFSIMGLLPSIAS L   L  G V L WGW                 
Sbjct: 66  LQRHFSKTQVFGVAFSIMGLLPSIASILGVALPGGSVSLVWGWAISGAFVLANGLAMSEL 125

Query: 123 SSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLV- 181
           +SA+PT+G +Y   + +AP +V+  +S+ VG  ++L+L + +CSI YGLA +ILS V+V 
Sbjct: 126 ASAIPTSGGLYYYTHYYAPPKVKNFLSFIVGNCNSLALISCLCSINYGLAGEILSIVVVG 185

Query: 182 SNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGV 241
           SN +FN T+  TYGV+AACI+  A++TS+ +   S+LQT SI+SN  LI +FF+ +P+GV
Sbjct: 186 SNGNFNITNANTYGVYAACIIATAVVTSVATTAVSRLQTFSIVSNLLLICIFFVVLPVGV 245

Query: 242 SRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDA 301
           +RS  +   FN   +IFG  +N S WN GW + +AG  P IW IG +DSCLHM+EEA++A
Sbjct: 246 ARSKDME--FNDAAYIFGDFENLSDWNNGWQFMLAGFQPLIWVIGGFDSCLHMSEEAKNA 303

Query: 302 VRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTL 361
             +VPFGI+GSI+VCW LG+ +CIVI AC + D+ ++++++F Q + Q+++DALGK+WT+
Sbjct: 304 TASVPFGIIGSISVCWFLGFFICIVIAACSSQDVAALVNTKFHQPLAQVLFDALGKKWTI 363

Query: 362 GFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXX 421
             +++   CQFLM AS++ A SRQ WAFARDDG PFS++ K V+     P+RA W     
Sbjct: 364 AIMTLIAFCQFLMAASSLTAISRQIWAFARDDGLPFSSWIKVVNVKLSSPLRATWVGAGV 423

Query: 422 XXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPII 481
                    +G  AS ALFSL ++  Y + + P  LR+TYGK  F PG F++G + SP++
Sbjct: 424 ALAIGCLCLIGPVASSALFSLYISANYFSWMLPNLLRMTYGKDVFTPGAFFMGKYLSPVV 483

Query: 482 NWISVFFQAFVIIMMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKS 540
           NWIS+ F+ F+I+++ FP++   +TP TMNY+VV     W L+ IYYF+++ KFYKGPKS
Sbjct: 484 NWISIIFELFMILLVFFPTEQHGITPDTMNYSVVFIGAVWFLATIYYFIYKHKFYKGPKS 543

Query: 541 NLTDEEFQEYVGDDVIDAIMSNNE 564
           NLTDEE++E VG DV+DAI+S ++
Sbjct: 544 NLTDEEYEENVGQDVLDAILSKSQ 567

>Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL210W
           (UGA4) - GABA-specific transport protein [contig 75]
           FULL
          Length = 564

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/545 (47%), Positives = 371/545 (68%), Gaps = 4/545 (0%)

Query: 21  EVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKEELKREFSSIQIFGVAFSIM 80
           E+ + R L TITS     + +++A++A  D ++LAE+GYK+EL R FS++Q+FG+AFSIM
Sbjct: 22  EIHEYRSLRTITSKRAGEVNYINAKTAHDDTELLAEIGYKQELSRHFSTLQVFGIAFSIM 81

Query: 81  GLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWA 140
           GLLPSIAS L      G V   WGW                 +SA+PT+G +Y   Y +A
Sbjct: 82  GLLPSIASVLLMAFPGGMVSFVWGWLISGFFVLLIGCSMSELASAIPTSGGLYYYTYYYA 141

Query: 141 PQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVS-NPDFNATDPITYGVFAA 199
           P+R +  +S+ +G  +TL+L+A +CS+ YG AQ++L+ V++S + +F  T+ + YGV+AA
Sbjct: 142 PKRFKSLLSFLIGNSNTLALTAGLCSVTYGFAQEVLAIVVISKDGNFELTNGMIYGVYAA 201

Query: 200 CIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFG 259
            IV   ++TS+ +   S+LQT+SI+SN  LI  F I +PIGVS++  L+  FN G FIFG
Sbjct: 202 GIVATMMVTSVATVAVSRLQTVSIVSNLALIAFFLIVLPIGVSKTKWLD--FNDGSFIFG 259

Query: 260 QVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWIL 319
              N +TW  GW + + G  PA+WTIGA+DSC+HM+EEA++A +AVP GI+GSI+VCW++
Sbjct: 260 NWTNETTWPDGWQFMMTGFQPAVWTIGAFDSCIHMSEEAKNATKAVPAGILGSISVCWVV 319

Query: 320 GWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLMGASTV 379
           G+ +CI I ACM PDID++LDS +G  + QI+Y+ALGK+WT+ F+++   CQF+MG S +
Sbjct: 320 GFFICIAIAACMGPDIDAILDSAYGSPLAQILYNALGKKWTMAFMTLIAFCQFVMGCSIL 379

Query: 380 VANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGAL 439
            A SRQ WAFARDDG  FS   K V+     P+RA W              +G TAS AL
Sbjct: 380 TAISRQIWAFARDDGLMFSKHIKVVNKKLSSPLRATWFGAAGALVIGLLCLIGGTASNAL 439

Query: 440 FSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFP 499
           FS+ +A  Y++ + P  LR+T GK  F+PG FY+GDFWSPI+NW S+ F+ F+I+MMMFP
Sbjct: 440 FSMYIAANYLSWMMPNLLRMTTGKDVFKPGAFYMGDFWSPIVNWTSIAFELFIIVMMMFP 499

Query: 500 SDST-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGDDVIDA 558
           ++ T +TP TMNYT+VI    W+ SL Y+  ++ K++ GPKSNL+D EF + VG DVID 
Sbjct: 500 TEKTGITPDTMNYTIVICGAVWLGSLAYFLTYKHKYFHGPKSNLSDAEFDKAVGQDVIDQ 559

Query: 559 IMSNN 563
           I+S++
Sbjct: 560 ILSHS 564

>SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 569

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/556 (49%), Positives = 384/556 (69%), Gaps = 6/556 (1%)

Query: 11  IKNRKSHVDVEVGQMRELGTITSAHGA-PIRFVDARSATSDQQVLAELGYKEELKREFSS 69
           I +R      ++  +  + ++ S  GA  + +++A +A  D Q+LAE+GYK+ELKR+FS+
Sbjct: 13  IVSRDKGTTSDLQNLHSVRSVRSRTGAGEVNYINAATANDDNQLLAEIGYKQELKRQFST 72

Query: 70  IQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTA 129
           +Q+FG+AFSIMGLLPSIAS + GGLS GPV L WGWF                +SA+PTA
Sbjct: 73  LQVFGIAFSIMGLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAENASAIPTA 132

Query: 130 GAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVS-NPDFNA 188
           G +Y   + +AP+  +  IS+ +G  ++L+L + VCSI YGLA++IL+AV++S + DF  
Sbjct: 133 GGLYYWTHYYAPEGYKNVISFVIGCSNSLALVSGVCSIDYGLAEEILAAVVISKDGDFEV 192

Query: 189 TDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLN 248
           T   TYGVF A +  M + T L S   S+LQT SI++NCF+I+L FIA+PIG  R+    
Sbjct: 193 TSGKTYGVFVAAVFAMILCTCLASSAISRLQTTSIVANCFIIILLFIALPIGTKRN---M 249

Query: 249 RSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFG 308
             FN   +IFG+ +N S WN GW +C+ G M  +WTIGA+DSC+H +EEA+DA +AVP G
Sbjct: 250 GGFNDASYIFGKFENFSDWNNGWQFCLQGFMTCVWTIGAFDSCVHQSEEAKDAKKAVPIG 309

Query: 309 IVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFI 368
           I+GSITVCWILGWL+ IV++AC++PD++ VLD+ +G  + QI+Y++LGK W + F+S+  
Sbjct: 310 IIGSITVCWILGWLILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMSLIA 369

Query: 369 ICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXX 428
            CQFLMGAS + A SRQ WAFARDDG P S + K V+    VP+ AVW            
Sbjct: 370 ACQFLMGASILTAVSRQIWAFARDDGLPLSKYIKMVNERLSVPIVAVWAGGLASVVLGLL 429

Query: 429 XXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFF 488
             +   A+ ALFSL+VAG Y++   P  LRLT+G+  FRPGPFYLG FWSPI+NW SV F
Sbjct: 430 CLIDSAAASALFSLAVAGNYLSWGTPTLLRLTFGRDIFRPGPFYLGKFWSPIVNWTSVLF 489

Query: 489 QAFVIIMMMFP-SDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEF 547
           QAF+I+++MFP S   +T +TMNY  VIGPG W+L+ +YY V+++K+Y GPKSNLTDEE+
Sbjct: 490 QAFIIVVVMFPASQHGITKSTMNYACVIGPGIWILAWVYYMVYKKKYYHGPKSNLTDEEY 549

Query: 548 QEYVGDDVIDAIMSNN 563
            + VG  VID ++SN+
Sbjct: 550 VDAVGSIVIDEMLSNS 565

>YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease
           that serves as a gamma-aminobutyrate (GABA) transport
           protein involved in the utilization of GABA as a
           nitrogen source; catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA); localized to the
           vacuolar membrane
          Length = 571

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/571 (49%), Positives = 385/571 (67%), Gaps = 10/571 (1%)

Query: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELGT----ITSAHGA-PIRFVDARSATSDQQVLA 55
           MS+ + NK +++ R S    +  Q++ LG+    I S  GA  + ++DA  + +D Q+LA
Sbjct: 3   MSSKNENKISVEQRISTDIGQAYQLQGLGSNLRSIRSKTGAGEVNYIDAAKSVNDNQLLA 62

Query: 56  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXX 115
           E+GYK+ELKR+FS++Q+FG+AFSIMGLLPSIAS + GGL  GP  L WGWF         
Sbjct: 63  EIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGGGLGGGPATLVWGWFVAAFFILLV 122

Query: 116 XXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQI 175
                  +S++PTAG +Y   Y +AP+  ++ IS+ +G  ++L+L+A VCSI YGLA++I
Sbjct: 123 GITMAEHASSIPTAGGLYYWTYYYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLAEEI 182

Query: 176 LSAV-LVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFF 234
            +AV L  + +F  T    YG+FA  +V M I T + S   ++LQT+SI +N F+IVL F
Sbjct: 183 AAAVTLTKDGNFEVTSGKLYGIFAGAVVVMCICTCVASGAIARLQTLSIFANLFIIVLLF 242

Query: 235 IAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHM 294
           IA+PIG          FN GDFIFG+ +N S WN GW +C+AG MPA+WTIG++DSC+H 
Sbjct: 243 IALPIGTKHR---MGGFNDGDFIFGKYENLSDWNNGWQFCLAGFMPAVWTIGSFDSCVHQ 299

Query: 295 AEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDA 354
           +EEA+DA ++VP GI+ SI VCWILGWL+ I ++AC+NPDIDSVLDS++G A+ QIIYD+
Sbjct: 300 SEEAKDAKKSVPIGIISSIAVCWILGWLIIICLMACINPDIDSVLDSKYGFALAQIIYDS 359

Query: 355 LGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRA 414
           LGK+W + F+S+   CQFLMGAS   A SRQ WAF+RD+G P S + K+VD    VP  A
Sbjct: 360 LGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVPFFA 419

Query: 415 VWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLG 474
           +               + + A+ ALFSL+VAG  +A   P   RLT G+  FRPGPFYLG
Sbjct: 420 ILAACVGSLILGLLCLIDDAATDALFSLAVAGNNLAWSTPTVFRLTSGRDLFRPGPFYLG 479

Query: 475 DFWSPIINWISVFFQAFVIIMMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRK 533
             WSPI+ W  V FQ F+II++MFPS    +T +TMNY  VIGPG W+L+ IYY V+++K
Sbjct: 480 KIWSPIVAWTGVAFQLFIIILVMFPSQQHGITKSTMNYACVIGPGIWILAGIYYKVYKKK 539

Query: 534 FYKGPKSNLTDEEFQEYVGDDVIDAIMSNNE 564
           +Y GP +NL+D+++ E VG DVID IMS  E
Sbjct: 540 YYHGPATNLSDDDYTEAVGADVIDTIMSKQE 570

>SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 565

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/553 (51%), Positives = 385/553 (69%), Gaps = 7/553 (1%)

Query: 21  EVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKEELKREFSSIQIFGVAFSIM 80
           E+  +R + + T A    + +++A +A  D Q+LAE+GYK+ELKR+FS++Q+FG+AFSIM
Sbjct: 14  EIAALRSVRSRTGA--GEVNYINAATANDDNQLLAEIGYKQELKRQFSTLQVFGIAFSIM 71

Query: 81  GLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWA 140
           GLLPSIAS + GGLS GPV L WGWF                +SA+PTAG ++   + +A
Sbjct: 72  GLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAESASAIPTAGGLFYWTHYYA 131

Query: 141 PQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVS-NPDFNATDPITYGVFAA 199
           P+  +  IS+ +G  ++L+L + +CSI YGLAQ+IL+AV++S + DF  T   TYGVFAA
Sbjct: 132 PEGYKNVISFIIGCSNSLALVSGLCSIDYGLAQEILAAVVISKDGDFEVTSGKTYGVFAA 191

Query: 200 CIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFG 259
            +V   + T L S   S+LQT SI++NCF+I+L FIA+PIG  R+      FN   +IFG
Sbjct: 192 AVVVTVLCTCLASSAISRLQTASIVANCFIIILLFIALPIGTKRN---MGGFNDASYIFG 248

Query: 260 QVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWIL 319
           + +N S WN GW++C+ G MP IWTIGA+DSC+H +EEA+DA +AVP GI+GSITVCWIL
Sbjct: 249 KFENFSDWNDGWSFCLQGFMPVIWTIGAFDSCVHQSEEAKDAKKAVPIGIIGSITVCWIL 308

Query: 320 GWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLMGASTV 379
           GWL+ IV++AC++PD++ VLD+ +G  + QI+Y++LGK W + F+S+  +CQFLMGAS +
Sbjct: 309 GWLILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMSLIAVCQFLMGASVL 368

Query: 380 VANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGAL 439
            A SRQ WAFARDDG P S + K V     VP+ AVW              +   A+ AL
Sbjct: 369 TALSRQVWAFARDDGLPLSKYIKMVHTNWSVPIVAVWVAGCAGLVLGLLCLIDAAAASAL 428

Query: 440 FSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFP 499
           FSL+VAG Y++   P  LRLT+GK  FRPGPFYLG FWSPIINW SV FQAF+II++MFP
Sbjct: 429 FSLAVAGNYLSWGTPTLLRLTFGKDIFRPGPFYLGKFWSPIINWTSVIFQAFIIILVMFP 488

Query: 500 -SDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGDDVIDA 558
            S   V  +TMNY  VIGPG W+L+ IYY ++++K+Y GPKSNLTDEE+ E VG +VID 
Sbjct: 489 ASQHGVDKSTMNYACVIGPGIWILAWIYYMIYKKKYYHGPKSNLTDEEYVEAVGSNVIDE 548

Query: 559 IMSNNEADYKPGD 571
           I+SN E   K  +
Sbjct: 549 ILSNTERTSKDAN 561

>NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {ON}
           Anc_5.112
          Length = 574

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/574 (47%), Positives = 380/574 (66%), Gaps = 15/574 (2%)

Query: 1   MSASSSNKG-TIKNRKSHVDVEVGQMR------ELGTITSAHGA-PIRFVDARSATSDQQ 52
           M++ SS K   I N +     E G +        L +I S  GA  + +++A  + +D Q
Sbjct: 5   MTSESSKKDIKIINLEPRASTEEGSIELHNMASNLRSIISKTGAGEVNYINASKSVNDNQ 64

Query: 53  VLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXX 112
           +LAE+GYK+ELKR+FS++Q+FG+AFSIMGLLPSIAS +  G+S G V   WGWF      
Sbjct: 65  LLAEIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGTGISGGSVSFVWGWFIASFFI 124

Query: 113 XXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLA 172
                     +SA+PTAG +Y   Y +AP+  ++  S+ +G  ++L+L A +CSI YGLA
Sbjct: 125 LLVGISMAENASAIPTAGGLYYWTYYYAPKGYKEVFSFIIGCSNSLALVAGLCSIDYGLA 184

Query: 173 QQILSAVLVS-NPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIV 231
           ++I++AV+V+ + DFN TD   Y VF A ++ MA+ TS+ S + ++LQ ISI+SN F+IV
Sbjct: 185 EEIMAAVVVTYDGDFNITDGRLYAVFLASVIVMALCTSMASGVIARLQNISIVSNLFIIV 244

Query: 232 LFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSC 291
           L FIA+P+G         +FN   FIFG  +N S WN GW +C+ G MPA+WTIG++DSC
Sbjct: 245 LLFIALPVGTKHK---RGTFNDASFIFGGFENFSDWNGGWQFCLTGFMPAVWTIGSFDSC 301

Query: 292 LHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQII 351
           +H +EEA+DA ++VP GI+GSI+ CWILGWL+ I ++AC++P +++VLD+Q+G  M Q+I
Sbjct: 302 VHQSEEAKDAKKSVPVGIIGSISACWILGWLIIICLMACIDPQLENVLDTQYGFPMAQLI 361

Query: 352 YDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVP 411
           YD+LGK+WT+ FLS+   CQFLMG S   A SRQ WAF+RDDG PFS + K+V     VP
Sbjct: 362 YDSLGKKWTIAFLSLMAFCQFLMGCSICTAISRQIWAFSRDDGLPFSKYIKQVH--NSVP 419

Query: 412 VRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPF 471
             A+               +  TA+ ALFSL+VAG Y+A   P  LRLT G+  FRPGPF
Sbjct: 420 FFAILAACVSSLVLGLLCLIDATAANALFSLAVAGNYLAWCTPTLLRLTSGRDIFRPGPF 479

Query: 472 YLGDFWSPIINWISVFFQAFVIIMMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIYYFVW 530
           YLG   SPI++WI V ++ F+IIM MFPS    +  T MNY  VIGPG W L+ IYY ++
Sbjct: 480 YLGKVLSPIVSWIGVLYEVFIIIMEMFPSQQHGINKTNMNYACVIGPGIWFLAWIYYLLY 539

Query: 531 QRKFYKGPKSNLTDEEFQEYVGDDVIDAIMSNNE 564
           ++K+Y GPK+NL+DEE+ + VG DVID I+   E
Sbjct: 540 KKKYYHGPKTNLSDEEYSDMVGIDVIDGILEQKE 573

>KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/570 (48%), Positives = 383/570 (67%), Gaps = 9/570 (1%)

Query: 1   MSASSSNKGTIKNR----KSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAE 56
           MSAS S+ G+ KN        V  +V  +  L TITS     + +++A++A  D ++LAE
Sbjct: 1   MSASVSS-GSEKNNYIIGAQEVKNKVDVVTSLRTITSRRVGDVNYINAKAAHDDTELLAE 59

Query: 57  LGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXX 116
           +GYK+EL+R FS IQ+FGVAFSIMGLLPSIAS L   L  G V L WGW           
Sbjct: 60  IGYKQELQRHFSKIQVFGVAFSIMGLLPSIASVLSLALPGGSVSLVWGWGIAGAFVLTNG 119

Query: 117 XXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQIL 176
                 +SA+PT+G +Y   Y +AP +V+  +S+ VG  ++L+L A +CSI YGLA +IL
Sbjct: 120 LAMSELASAIPTSGGLYYYTYYYAPPKVKNLLSFVVGNSNSLALIAGLCSINYGLAGEIL 179

Query: 177 SAVLV-SNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFI 235
           S V+V S+ +FN T+  TYGV+AACIV  A++TS+ +   SKLQT SI+SN  LI +FF+
Sbjct: 180 SIVVVGSDGNFNITNASTYGVYAACIVATAVVTSVATVAVSKLQTFSIVSNLLLICIFFV 239

Query: 236 AIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMA 295
           A+P+GV+RS+ +   FN   +IFG   N S WN GW +  AG  P IW IG +DSC+HM+
Sbjct: 240 ALPVGVARSNHME--FNDAKYIFGNFQNLSDWNDGWQFMSAGFQPLIWVIGGFDSCIHMS 297

Query: 296 EEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDAL 355
           EEA++A  +VPFGI+GSI+VCW+LG+ +CIVI AC + D+ ++++++F Q + QI++DAL
Sbjct: 298 EEAKNATASVPFGIIGSISVCWVLGFFICIVIAACSSQDVAAIVETKFHQPLAQILFDAL 357

Query: 356 GKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAV 415
           GKRWT+  + +   CQFLM AS + A SRQ WAFARDDG PFS++ K V+     P+RA 
Sbjct: 358 GKRWTIAIMVLIAFCQFLMAASILTAISRQIWAFARDDGLPFSSWIKVVNIKLSSPLRAT 417

Query: 416 WXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGD 475
           W              +G  AS ALFSL+V+  Y + + P  LR+TYGK  F PG F++G 
Sbjct: 418 WVGAGAALAIGCLCLIGPVASSALFSLAVSANYFSWMVPNLLRMTYGKDVFTPGAFFMGK 477

Query: 476 FWSPIINWISVFFQAFVIIMMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRKF 534
           + SP++NWIS+ F+ F+I+++ FP+D   +TP TMNY+VV     WVL  IYY V++ KF
Sbjct: 478 YLSPVVNWISIVFEIFMILLVFFPADQHGITPDTMNYSVVFIGAVWVLPTIYYLVYKYKF 537

Query: 535 YKGPKSNLTDEEFQEYVGDDVIDAIMSNNE 564
           Y GPKSNLTDEE++E VG DV+DAI+S ++
Sbjct: 538 YSGPKSNLTDEEYEEKVGQDVLDAILSKHQ 567

>NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112
          Length = 576

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/574 (45%), Positives = 376/574 (65%), Gaps = 20/574 (3%)

Query: 3   ASSSNKGTIKNRKS-----HVDVEVGQM-------RELGTITSAHGA-PIRFVDARSATS 49
           + SSN+   K+ KS      V  E G           + +I S  GA  + ++++ ++ +
Sbjct: 2   SGSSNRSDDKDFKSISIEARVSTEAGSAVDIRNVNSHIRSIRSKTGAGEVNYINSATSVT 61

Query: 50  DQQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXX 109
           D Q+LAE+GYK+ELKR+FS+ Q+FG+AFSIMGLLPSIAS +  G+S GP    WGWF   
Sbjct: 62  DNQLLAEIGYKQELKRQFSTFQVFGIAFSIMGLLPSIASVMGTGISGGPTTFVWGWFIAS 121

Query: 110 XXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVY 169
                        +SA+PTAG +Y   Y +AP+  +K IS+ +G  ++L+L+A +CSI Y
Sbjct: 122 IFTIFIGISMAENASAIPTAGGLYYWTYYYAPEGFKKVISFVIGCSNSLALAAGLCSIDY 181

Query: 170 GLAQQILSAVLVS-NPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCF 228
           GLA++I++AV+++ + DF+ T    YG+FAA +V M I T + S   +++Q+ SI SN F
Sbjct: 182 GLAEEIMAAVVLTFDGDFDVTSGKLYGIFAAAVVVMGICTCISSGAIARMQSFSIASNLF 241

Query: 229 LIVLFFIAIPIGVSRSDTLNR-SFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGA 287
           +IVL FIA+PIG  R    NR  FN   FIFG+ +N S WN GW +C+AG MPA+WTIG+
Sbjct: 242 IIVLLFIALPIGTKR----NRGEFNDAKFIFGKFENFSDWNSGWQFCMAGFMPAVWTIGS 297

Query: 288 YDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAM 347
           +DSC+H +EEA+DA ++VP GI+ SI  CWILGWL+ IV++AC++P++++V+D+++G  M
Sbjct: 298 FDSCVHQSEEAKDAKKSVPIGIIASIAACWILGWLIIIVLMACIDPNLENVVDTKYGFPM 357

Query: 348 TQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGL 407
            Q+IYD+LGKRW + F+S+   CQFLMG S   A SRQ WAF+RDDG P S + K VD  
Sbjct: 358 AQLIYDSLGKRWAITFMSLMAFCQFLMGCSICTAISRQIWAFSRDDGLPLSKYIKIVDKR 417

Query: 408 TGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFR 467
             VP  A+               +  TA+ ALFSL+VAG Y+A   P  LR T G+  FR
Sbjct: 418 YSVPFNAIIAACVTCLVLGLLCLIDSTAANALFSLAVAGNYLAWSIPTLLRFTTGRDLFR 477

Query: 468 PGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIY 526
           PGPFYLG   S I+ W  + ++ F+IIM+MFP+    +  T MNY  VIGPG W LS IY
Sbjct: 478 PGPFYLGKPLSAIVGWTGICYEFFIIIMVMFPTQKNGINKTNMNYACVIGPGIWFLSWIY 537

Query: 527 YFVWQRKFYKGPKSNLTDEEFQEYVGDDVIDAIM 560
           Y  +++K+++GPK+NL++++++E V  D ID IM
Sbjct: 538 YIAYKKKYFRGPKTNLSEDDYEEMVAIDNIDEIM 571

>TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112
          Length = 569

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/537 (50%), Positives = 373/537 (69%), Gaps = 9/537 (1%)

Query: 31  ITSAHGA-PIRFVDARSATSDQQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIAST 89
           + S  GA  + ++++ ++ +D Q+LAE+GYK+ELKR+FS++Q+FGVAFSIMGLLPSIAS 
Sbjct: 36  VRSKTGAGEVNYINSATSVNDGQLLAEIGYKQELKRQFSTLQVFGVAFSIMGLLPSIASV 95

Query: 90  LDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCIS 149
           + GGL+ GPV L WGWF                +SA+PTAG +Y   Y +AP+  ++ +S
Sbjct: 96  MGGGLTGGPVTLVWGWFIAAFFILLVGITMAENASAIPTAGGLYYWTYYYAPKGYKEIVS 155

Query: 150 YSVGFLDTLSLSASVCSIVYGLAQQILSAVLVS-NPDFNATDPITYGVFAACIVCMAILT 208
           + +G  ++L+LSA VCSI YG A ++L+AV++S + DF  T   TYG+FAA +V   ++T
Sbjct: 156 FVIGCSNSLALSAGVCSISYGFALEVLAAVVISRDGDFEVTTGKTYGIFAAVVVAQGVVT 215

Query: 209 SLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRS-FNGGDFIFGQVDNRSTW 267
            L S + ++LQT+SI+SN F+++L FIA+PIG      +NR  FN G+FIFG   N S W
Sbjct: 216 CLSSGLVARLQTLSIVSNVFIMILLFIALPIGAK----VNRGGFNNGEFIFGTYQNFSDW 271

Query: 268 NKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVI 327
           N GW +C+AG MPA+WTIG++DSC+H +EEA+DA ++VP GI+GSI  CWILGWL+ I +
Sbjct: 272 NSGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIIGSIAACWILGWLIIICL 331

Query: 328 LACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFW 387
           +ACM+ DI  VLD+ +   + QI+YD LGK W + F+++   CQFLMGAS V A SRQ W
Sbjct: 332 MACMDSDISKVLDTDYEIILAQIVYDCLGKNWAIAFMALIAFCQFLMGASIVTAASRQIW 391

Query: 388 AFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGM 447
           AFARDDG P S + KKVD    VP  A+               +   A+ ALFSL+VAG 
Sbjct: 392 AFARDDGLPLSKYIKKVDKKYSVPFVAI-IAACVASLLLGLLCLDAAAAAALFSLAVAGN 450

Query: 448 YMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPS-DSTVTP 506
            +A   P  LRLT+G+  FRPGPFYLG  WSPII WI V +QAF+II++MFPS    +TP
Sbjct: 451 NLAWSTPTFLRLTWGRDLFRPGPFYLGKLWSPIIAWIGVVYQAFIIILVMFPSARHGLTP 510

Query: 507 TTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGDDVIDAIMSNN 563
            TMNY  VIGPG W+LS IYY V+++K++ GPKSNL+DE++ E VG+D+I+ I+S  
Sbjct: 511 QTMNYACVIGPGLWILSWIYYMVYRKKYFHGPKSNLSDEDYNEAVGEDLIEEILSRK 567

>Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/571 (49%), Positives = 390/571 (68%), Gaps = 10/571 (1%)

Query: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELGT----ITSAHGA-PIRFVDARSATSDQQVLA 55
           MS+ + NK +++ R S    E  Q+  LG+    I S  GA  + +++A  + +D Q+LA
Sbjct: 3   MSSKNDNKISVEQRVSTDFGEAYQLEGLGSNLRSIRSKTGAGEVNYINAAKSVNDNQLLA 62

Query: 56  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXX 115
           E+GYK+ELKR+FS++Q+FG+AFSIMGLLPSIAS + GGL  GP  L WGWF         
Sbjct: 63  EIGYKQELKRQFSTVQVFGIAFSIMGLLPSIASVMGGGLGGGPATLLWGWFVAAFFILLV 122

Query: 116 XXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQI 175
                  +SA+PTAG +Y   Y +AP+  ++ IS+ +G  ++L+L+A VCSI YGLA++I
Sbjct: 123 GITMAEHASAIPTAGGLYYWTYHYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLAEEI 182

Query: 176 LSAV-LVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFF 234
            +AV L  + +F+AT    YG+FA  +V M I T + S   ++LQT+SI++N F+IVL F
Sbjct: 183 AAAVTLTRDGNFDATSGKLYGIFAGAVVLMGICTCIASGAIARLQTVSIVANLFIIVLLF 242

Query: 235 IAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHM 294
           IA+PIG   +      FN G+FIFG+ +N S WN GW +C+AG MPA+WTIG++DSC+H 
Sbjct: 243 IALPIGTKHN---MGGFNNGEFIFGKFENMSDWNNGWQFCLAGFMPAVWTIGSFDSCVHQ 299

Query: 295 AEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDA 354
           +EEA+DA ++VP GI+ SI VCW+LG L+ I +LAC+NPDIDSVL+S++G A+ QIIYD+
Sbjct: 300 SEEAKDAKKSVPIGIISSIAVCWVLGLLIIICLLACINPDIDSVLNSKYGFALAQIIYDS 359

Query: 355 LGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRA 414
           LGK+W + F+S+   CQFLMGAS   A SRQ WAF+RD+G P S + K+VD    VP  A
Sbjct: 360 LGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVPFYA 419

Query: 415 VWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLG 474
           +               + E A+ ALFSL+VAG  +A   P  LRLT G+  FRPGPFYLG
Sbjct: 420 ILAACVGSLILGLLCLIDEAATSALFSLAVAGNNLAWSTPTVLRLTSGRDLFRPGPFYLG 479

Query: 475 DFWSPIINWISVFFQAFVIIMMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRK 533
            FWSPII WI V FQ F+II++MFPS    +T +TMNY  VIGPG W L+ +YY V+++K
Sbjct: 480 KFWSPIIAWIGVAFQVFIIILVMFPSQQHGITKSTMNYACVIGPGIWFLAGVYYKVYKKK 539

Query: 534 FYKGPKSNLTDEEFQEYVGDDVIDAIMSNNE 564
           +Y GP +NL+D+++ + VG DVIDAI+S  E
Sbjct: 540 YYHGPATNLSDDDYADAVGVDVIDAIISKQE 570

>KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8.468
           YDL210W
          Length = 581

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/542 (48%), Positives = 365/542 (67%), Gaps = 13/542 (2%)

Query: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELG-------TITSAHGA-PIRFVDARSATSDQQ 52
           MS +SS K T    +  + V+ G   E+        ++ S  GA  + F+DA +  SD Q
Sbjct: 1   MSLTSSKKETQVVTEQRLSVDFGSAEEIERPFSNIRSVRSQTGAGEVNFIDAGATVSDHQ 60

Query: 53  VLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXX 112
           +LAE+GYK+EL R+FS+IQ+FG+AFSIMGLLPSIAS + GGL+ GP  L WGWF      
Sbjct: 61  LLAEIGYKQELNRQFSTIQVFGIAFSIMGLLPSIASVMGGGLAGGPTTLVWGWFIAGCFI 120

Query: 113 XXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLA 172
                     +SA+PTAG +Y   Y +AP+  ++ IS+ +G  ++L+L+A VCSI YG A
Sbjct: 121 LTVGIAMAENASAIPTAGGLYYWTYYYAPKGYKEVISFVIGCSNSLALAAGVCSIDYGFA 180

Query: 173 QQILSAVLVS-NPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIV 231
           +++L+AV+++ + +F  T   TYGVFAA +V M I T + S+  ++LQTISI+SN F+IV
Sbjct: 181 EEVLAAVVIAKDGNFEITPGKTYGVFAAAVVAMGICTCMASKAIARLQTISIVSNLFIIV 240

Query: 232 LFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSC 291
           L FIA+PIG   +      FN G FIFG+  N S WN GW + +AG MP +WTIGA+DSC
Sbjct: 241 LLFIALPIGTKIN---MGGFNDGSFIFGKFKNLSDWNNGWQFFLAGFMPVVWTIGAFDSC 297

Query: 292 LHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQII 351
           +H +EEA+DA ++VP GI+GSI+VCW+LGWL+ I ++ACM+PDI+ ++D+++G AM QII
Sbjct: 298 VHQSEEAKDAKKSVPIGIIGSISVCWVLGWLILICLMACMSPDIEGIVDNKYGFAMAQII 357

Query: 352 YDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVP 411
           YD+LGK+W + F+S+   CQFLMG+S V A SRQ WAFARDDG P S++ K VD    VP
Sbjct: 358 YDSLGKKWAVAFMSLIAFCQFLMGSSVVTAISRQIWAFARDDGLPLSDYIKMVDKKYKVP 417

Query: 412 VRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPF 471
             A+               +   A+ ALFSL+VAG  +A   P  LRLT G+  FRPGPF
Sbjct: 418 FNAIIFACCGSLILGLLCLIDAAATSALFSLAVAGNNLAWSTPTLLRLTSGRDLFRPGPF 477

Query: 472 YLGDFWSPIINWISVFFQAFVIIMMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIYYFVW 530
           YLG  WS +  WIS+ F+AF+II++MFPS+   +T +TMNYT VIGPG W LS +YY V+
Sbjct: 478 YLGPVWSKVNGWISIIFEAFIIIVVMFPSEKHGITKSTMNYTCVIGPGIWFLSWVYYSVY 537

Query: 531 QR 532
           ++
Sbjct: 538 KK 539

>KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112
          Length = 571

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/553 (47%), Positives = 365/553 (66%), Gaps = 6/553 (1%)

Query: 15  KSHVDVEVGQMRELGTITSAHGA-PIRFVDARSATSDQQVLAELGYKEELKREFSSIQIF 73
           + H D        + T+ S  GA  + ++++  + SD Q+LAE+GYK ELKR+FS++Q+F
Sbjct: 21  EGHSDDLYNLASRVRTVRSHTGAGEVNYINSVQSVSDNQLLAEIGYKPELKRQFSTLQVF 80

Query: 74  GVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVY 133
           G+AFSIMGLLPSIAS + GGL+ GPV L WGWF                +SA+PTAG +Y
Sbjct: 81  GIAFSIMGLLPSIASVMAGGLAGGPVSLVWGWFSSCIGILIVGITMAENASAIPTAGGMY 140

Query: 134 VSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVS-NPDFNATDPI 192
              Y +AP++ +  +S+ VG  ++L+L AS CSI YG A+++++AV ++ +     T   
Sbjct: 141 YWTYYYAPKKYKAVLSFVVGCSNSLALVASCCSINYGFAEEVMAAVFLTYDGAVTVTSGK 200

Query: 193 TYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFN 252
            YG+FA   V MA+ T + S   ++LQT+SI+SN F+I+LF IA+PIG   +      FN
Sbjct: 201 LYGIFAGATVVMAMCTCVASGAIARLQTVSIVSNIFIIILFVIAVPIGTKANIG---HFN 257

Query: 253 GGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGS 312
            G +IFG  +N S WN G+ + +AG MPA WTI ++DSC+H +EEA+DA ++VP GI+GS
Sbjct: 258 DGKYIFGHFENLSDWNNGFLFFLAGFMPAAWTISSFDSCVHQSEEAKDAKKSVPIGIIGS 317

Query: 313 ITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQF 372
           IT CWILG+L+ I + ACM+ D+D +++S  G AM QII+D+LGKRW + F+++   CQF
Sbjct: 318 ITACWILGFLIIICLCACMDTDLDRLVNSDTGFAMAQIIFDSLGKRWAIAFMALIAFCQF 377

Query: 373 LMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVG 432
           LMGAS V A SRQ WAFARDDG PFSN  K VD    VP  +V               + 
Sbjct: 378 LMGASIVTAISRQIWAFARDDGLPFSNLIKYVDKRYQVPFNSVIAAAITSLLLGLLCLIN 437

Query: 433 ETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFV 492
             A+ ALFSLSVAG Y+A + P  LRLT G+  FRPGPFYLG FWSPI+ W SV F+ ++
Sbjct: 438 SQATAALFSLSVAGGYIAYLIPTVLRLTVGRDVFRPGPFYLGKFWSPIVAWSSVVFEIWI 497

Query: 493 IIMMMFPSDS-TVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYV 551
           I++ MFP+    +  +TMNY+ VIGPG  +L+ IYY VW+ + Y GPKSNL+DE+++E +
Sbjct: 498 ILLEMFPAQQHHIDKSTMNYSCVIGPGTCLLAWIYYRVWKHREYIGPKSNLSDEDYKEAL 557

Query: 552 GDDVIDAIMSNNE 564
           G  V+D I+   E
Sbjct: 558 GPAVLDDIIMGME 570

>SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 574

 Score =  521 bits (1342), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 276/576 (47%), Positives = 381/576 (66%), Gaps = 14/576 (2%)

Query: 1   MSASSS--NKGTIKN--RKSH------VDVEVGQMRELGTITSAHGAPIRFVDARSATSD 50
           MS SSS   K  IK   R+ H       + EV Q+  L TITS     + +++A++A  D
Sbjct: 1   MSDSSSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDD 60

Query: 51  QQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXX 110
            ++LAE+GYK+EL R FS+IQ+FG+AFSIMGLLPSIAS L    + G + L WGW     
Sbjct: 61  TELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGA 120

Query: 111 XXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYG 170
                       +SA+PT+G +Y   Y +AP + +K +S+ +G  ++L+L A +CSI YG
Sbjct: 121 FILSVGAGMAELASAIPTSGGLYYYTYYYAPPKFKKVLSFLIGNSNSLALIACLCSIDYG 180

Query: 171 LAQQILSAVLVS-NPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFL 229
           LAQ+ILS V++S + DF  T+  TYGV+A CI+   +LTS+ +   SKLQT SI+SN  L
Sbjct: 181 LAQEILSIVVISKDGDFEITNAKTYGVYAGCIIATTLLTSVATVAVSKLQTFSIVSNVLL 240

Query: 230 IVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYD 289
           I+ F I +PIGVS+SD +  +FNGG FIFG  +N   W  GW + +AG  P +W IGA+D
Sbjct: 241 IIFFLIVLPIGVSQSDDV--TFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFD 298

Query: 290 SCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQ 349
           SC+HM+EEA++A +AVP GI+ SI+VCWI+G+ + I I+ACM  +I ++LD+ +GQ + Q
Sbjct: 299 SCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQ 358

Query: 350 IIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTG 409
           I+Y+ALGK+W + F+++   CQF+MGAST+ A SRQ WAFARDDG PFS + KKV+    
Sbjct: 359 ILYNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLS 418

Query: 410 VPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPG 469
            P+RA W              +G TAS ALFS+ +A  Y A + P  LR+T GK+ F PG
Sbjct: 419 SPLRATWFGGAGALCIGLLCLIGSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPG 478

Query: 470 PFYLGDFWSPIINWISVFFQAFVIIMMMFP-SDSTVTPTTMNYTVVIGPGFWVLSLIYYF 528
            FY+G+FWSP+INW S+ F+ F+IIMMMFP S   +T  TMNYT V     W  S+ YY+
Sbjct: 479 AFYMGNFWSPVINWTSIIFEIFIIIMMMFPSSQHNITADTMNYTCVFVGFVWFGSIAYYY 538

Query: 529 VWQRKFYKGPKSNLTDEEFQEYVGDDVIDAIMSNNE 564
            ++ + + GPKSNLTD+EF + VG DVID I+SN +
Sbjct: 539 FYKHRTFHGPKSNLTDDEFVDAVGQDVIDEILSNQK 574

>ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 582

 Score =  515 bits (1326), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 266/561 (47%), Positives = 371/561 (66%), Gaps = 21/561 (3%)

Query: 5   SSNKGTI---KNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKE 61
             N+GT+   +  KSH+           ++ S     + ++++ ++ +D+ +LAE+GYK+
Sbjct: 26  EKNEGTLLEFRGLKSHIR----------SVRSPVAGEVNYINSATSNTDKGLLAEIGYKQ 75

Query: 62  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXX 121
           EL+R+FS+IQ+FGVAFSIMGLLPSI + L  GL+ GPV   WGW                
Sbjct: 76  ELERKFSTIQVFGVAFSIMGLLPSIGTLLSDGLAGGPVSTIWGWLIAGFFILVLGLAMAE 135

Query: 122 XSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAV-L 180
            +SA+PTAG +Y   Y +AP+  +  +S+ +G  ++L+L+A+ CSI YG A+++L+AV L
Sbjct: 136 NASAIPTAGGLYYWTYYYAPKGYKAVMSFIIGCSNSLALTAACCSITYGFAEEVLAAVVL 195

Query: 181 VSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIG 240
             + +F+ T+   YG+FA   + M + TS+ S   +KLQT+SII N F+IVLFFIA+PIG
Sbjct: 196 TKDGNFDVTNGKLYGIFAGAAIMMGVCTSVASGFVAKLQTLSIICNLFIIVLFFIAVPIG 255

Query: 241 VSRSDTLNR-SFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEAR 299
                 +NR  FN G FIF    N S WN GW +C+AG MPAIWTIG +DSC+H +EEA+
Sbjct: 256 AK----VNRGKFNHGHFIFANYQNSSDWNNGWQFCLAGFMPAIWTIGGFDSCVHQSEEAK 311

Query: 300 DAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRW 359
           DA ++V  GIVGSI+VCWILGW + IV+LACM+PD+   +++++  ++ QIIYD LGK W
Sbjct: 312 DAKKSVALGIVGSISVCWILGWFILIVLLACMDPDVSKTMNTKYVLSIAQIIYDCLGKNW 371

Query: 360 TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXX 419
            + F+S+   CQFLMGAST+ A SRQ WAF+RD+G PFS + KKV+    +P  A+    
Sbjct: 372 AIAFMSLIAFCQFLMGASTITAVSRQIWAFSRDNGLPFSKYIKKVNKTYSIPFVAI-IAA 430

Query: 420 XXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSP 479
                      + + A+ ALFSLSVAG  ++   P  LRLT+GK  FRPGPFYLG F S 
Sbjct: 431 CCGTLVLGLLCLQDEAANALFSLSVAGNNLSWGTPTFLRLTFGKDLFRPGPFYLGKFLST 490

Query: 480 IINWISVFFQAFVIIMMMFP-SDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGP 538
           +  WISVF+  FVII++MFP S   VTP +MNY  VIGPG W+LS IYY  +++K+Y GP
Sbjct: 491 VNGWISVFWGLFVIILVMFPTSQHNVTPQSMNYACVIGPGVWILSFIYYITYKKKYYHGP 550

Query: 539 KSNLTDEEFQEYVGDDVIDAI 559
            SNLT+EE+   VG+DV+D I
Sbjct: 551 ASNLTEEEYVNAVGEDVLDNI 571

>ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,
           544 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDL210W (UGA4); 1-intron
          Length = 544

 Score =  462 bits (1189), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 228/545 (41%), Positives = 344/545 (63%), Gaps = 6/545 (1%)

Query: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELG-TITSAHGAPIRFVDARSATSDQQVLAELGY 59
           M A   +K +  +  + +  E  +    G  I  ++  P+ ++DA++   D ++LAE+GY
Sbjct: 1   MGAQDLDKQSSNSAVAEIYYESNKYGHKGDLIECSNKGPMNYIDAKNVHDDVELLAEIGY 60

Query: 60  KEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXX 119
           K+ELKR FS++QIFG+AFSIMGLLPSIAS L   L  G V + WGWF             
Sbjct: 61  KQELKRHFSTLQIFGIAFSIMGLLPSIASVLPVALPGGSVSMVWGWFIFGAFILAVGAAM 120

Query: 120 XXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAV 179
              +SA PT+G +Y   Y +AP R++ C+S+ +G  ++L+L A +CSI YGLA+QILS +
Sbjct: 121 AELASAFPTSGGLYYYTYYYAPPRLKACLSFLIGNGNSLALIAGLCSIEYGLAEQILSII 180

Query: 180 LVSNPDFNATDP-ITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIP 238
            +S+  +  +   + YG++   ++   +L S+ +   S LQT SI+ N  L+ LF I +P
Sbjct: 181 AISSNSYLVSSRWLLYGIYCMGLLATVLLASIATFSVSLLQTASIVMNLALVALFIIVLP 240

Query: 239 IGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEA 298
           +GV+ +    R FN   F+F   +N + W   + + + G +P +W IGA+DS +HM+EEA
Sbjct: 241 VGVAHN---GRGFNSAKFMFTNFENHTGWPDWFQFFLCGSLPIVWVIGAFDSTVHMSEEA 297

Query: 299 RDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKR 358
           ++A R+VP GI+ SI+ CW LG+ + +VI ACM PDID++L+ +F   + QI+Y+ALGK 
Sbjct: 298 KNATRSVPIGILSSISTCWALGFAIVVVIAACMGPDIDAILNGEFNHPLAQILYNALGKG 357

Query: 359 WTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXX 418
           W L  +   ++CQ+LMGAS + A+SRQ WAFARDDG PFS++ K V+     P+RA W  
Sbjct: 358 WALSVMVFIVVCQYLMGASILTASSRQIWAFARDDGLPFSSWIKVVNTKLSSPLRATWAS 417

Query: 419 XXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWS 478
                        G TAS ALFS++VA  Y+A + P  LR+ +GK+ +RPG FY+G FWS
Sbjct: 418 AFVALVIGLLTLAGPTASSALFSMAVAANYLAWMTPNLLRMLFGKEIYRPGSFYMGKFWS 477

Query: 479 PIINWISVFFQAFVIIMMMFPSDST-VTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKG 537
           P+INW ++ FQ F+I++MMFPSD+  +  +TMNYT +I    W+ S+ Y+  ++ + + G
Sbjct: 478 PVINWTAILFQVFIILVMMFPSDTAGLRASTMNYTAIITGFVWIGSIFYFLAYKHRTFIG 537

Query: 538 PKSNL 542
           PKSNL
Sbjct: 538 PKSNL 542

>Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii ABL116C
          Length = 572

 Score =  456 bits (1174), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 229/535 (42%), Positives = 338/535 (63%), Gaps = 5/535 (0%)

Query: 16  SHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKEELKREFSSIQIFGV 75
           ++  V V Q+  + T  S     + +++A++A  D ++LAE+GYK+EL R FS+IQ+FG+
Sbjct: 24  NNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGI 83

Query: 76  AFSIMGLLPSIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVS 135
           AFSIMGLLPSIAS L   L  G V   WGW                 +SA+PT+G +Y  
Sbjct: 84  AFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLYYY 143

Query: 136 CYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLV-SNPDFNATDPITY 194
            Y +AP + +  +S+ +G  ++L+L A +CS+ YGLAQ++LS V +  + DF  +   T+
Sbjct: 144 TYYYAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTF 203

Query: 195 GVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGG 254
            V+ A I+   ILTS+ +   S LQT+SI+ N  L V F I +PIGV+ +D++  +FNG 
Sbjct: 204 AVYCAAILATVILTSMATAAVSVLQTVSIVINLSL-VAFLIVLPIGVANNDSM--TFNGP 260

Query: 255 DFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSIT 314
            FIF    N S+W     + + G +P +W IGA+DS +HM+EEA++A +AVP  I+ SIT
Sbjct: 261 GFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSIT 320

Query: 315 VCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLM 374
           VCW+LG+ + + I ACM PDI+ +LD+ FGQ + Q++++ LGK+W + F+S+  +CQ++M
Sbjct: 321 VCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVM 380

Query: 375 GASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGET 434
           GAS + A SRQ WAFARDDG PFS + KKV+     P+RA W               G  
Sbjct: 381 GASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPV 440

Query: 435 ASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVII 494
           AS ALFS+ V   Y+A + P  LR+ +GK  F PG FY+G FWSPIINW+S+ FQ   I+
Sbjct: 441 ASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIV 500

Query: 495 MMMFPSDS-TVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQ 548
           +MM P++   +T ++MNYT +     W  S+IY+ +++ K ++GPKSNLTD +  
Sbjct: 501 LMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLN 555

>SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo-inositol
          Length = 541

 Score =  142 bits (359), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 131/557 (23%), Positives = 241/557 (43%), Gaps = 42/557 (7%)

Query: 3   ASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKEE 62
           +SS  + + +N   H+  E  Q++   T+             +S T + +  AEL     
Sbjct: 6   SSSYQEVSSQNGIQHLLKEEDQLQHTNTV-------------KSCTLEGERGAEL----- 47

Query: 63  LKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFXXXXXXXXXXXXXXX 121
            ++ FS   I GV F +      I++++  G+S+G P+ + +G                 
Sbjct: 48  -RKSFSLWSILGVGFGLTNSWFGISASMVTGISSGGPMMIVYGIIIIALVSVCIGISLGE 106

Query: 122 XSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLV 181
            SSA P AG  +    + AP + R+  +Y  G         +  S    +A +++    +
Sbjct: 107 LSSAYPHAGGQFWWSLKLAPPKYRRFAAYMCGSFAWAGSVFTSASTTLSVATELVGMYAL 166

Query: 182 SNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGV 241
           ++PDF       + +F    VC  +L           +++ +IS+  L +  F  I I +
Sbjct: 167 THPDFEVKR---WHIF----VCFELLHLFLMIFNCSGKSLPLISSSALYISLFSFITITI 219

Query: 242 SRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDA 301
           +     +  +N   F+F    N + W       I GL+   W+    D   HMA E    
Sbjct: 220 TVLACSHGQYNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEVEKP 279

Query: 302 VRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKR--- 358
            R +P  I+G++ + +I  +   I +   ++ ++D ++ S  G  +  I Y AL  +   
Sbjct: 280 ERVIPISIMGTVAIGFITSFCYVIAMFFSLH-NLDEIMSSNTGAPILDIYYQALQSKAGA 338

Query: 359 WTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXX 418
             LG L +F     ++   T    +R  W+FARD+G P+S ++ KV+   GVP+ A    
Sbjct: 339 IVLGCLILFTSFGCVIACHT--WQARLCWSFARDNGLPYSRYWSKVNPELGVPLNAHLMS 396

Query: 419 XXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWS 478
                          TA  +L +  +A + ++ + P+ + L + K+  + GPF+LG    
Sbjct: 397 CAWIVLLGVLYLASSTAFNSLITGCIAFLLLSYVVPV-ICLLWRKRQIQHGPFWLGKI-G 454

Query: 479 PIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGP 538
              N++ + +  F ++   FP+   VT   MNY  V+  G+ + SL+Y   W+   ++G 
Sbjct: 455 LFSNYVLLGWTVFALVFFCFPAVMPVTKDNMNYASVVIVGYLLYSLLY---WR---FRGR 508

Query: 539 KSNLTDEEFQEYVGDDV 555
            +    EE  EY G++V
Sbjct: 509 YTFYVVEE-DEYTGENV 524

>Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  137 bits (345), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 141/535 (26%), Positives = 229/535 (42%), Gaps = 37/535 (6%)

Query: 32  TSAHGAPIRFVDARSATSD---QQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIAS 88
           T  H   +R  +    + D   + V+A  G +  L++ FS   I GV F +      I++
Sbjct: 21  TDVHKRDVRVAEEFEPSDDADGKGVVAADG-EVHLRKSFSLWSILGVGFGLTNSWFGISA 79

Query: 89  TLDGGLSAG-PVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKC 147
           ++  G+S+G P+ + +G                  SSA P AG  +    + AP + ++ 
Sbjct: 80  SMVAGISSGGPMMIVYGIIIVALISVCIGTSLGELSSAYPHAGGQFWWSLKLAPPKYKRF 139

Query: 148 ISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAIL 207
            +Y  G         +  S    +A +++    + NP+F    P  + +F    VC  +L
Sbjct: 140 AAYMCGSFAYAGSVFTSASTTLSVATEVVGMYALMNPNF---IPKRWHIF----VCFELL 192

Query: 208 TS--LPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRS 265
               +      K   +   S+ ++ +L F  I I V      +  FN   F+F    N +
Sbjct: 193 HLFLMLFNCYGKSLPLISSSSLYISLLSFFTITITVLACS--HGKFNDAKFVFATFYNET 250

Query: 266 TWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCI 325
            W  G    I GL+   W+    D   HMA E     R +P  I+G++ + ++    +C 
Sbjct: 251 GWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGFVTS--LCY 308

Query: 326 VILACMN-PDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLMGA-STVVA-- 381
           VI    +  D+D+VL S  G  +  I   ALG +      +IF+ C  L  +   V+A  
Sbjct: 309 VIAMFFSIKDLDAVLSSTTGAPILDIYNQALGNKSG----AIFLGCLVLFTSFGCVIACH 364

Query: 382 --NSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGAL 439
              +R  W+FARD+G P S F+ +V+  TGVP+ A                   TA  +L
Sbjct: 365 TWQARLCWSFARDNGLPLSRFWSQVNPHTGVPLNAHLMSCAWISLIGLLYLASSTAFQSL 424

Query: 440 FSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFP 499
            +  +A + ++ I P+   L   K+D   GPF+LG F     N + + +  F I+   FP
Sbjct: 425 ITGCIAFLLLSYIIPVICLLA-KKRDIAHGPFWLGKF-GLFSNIVLLGWTVFSIVFFSFP 482

Query: 500 SDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGDD 554
               VT   MNY  V+  G+   S++Y   W+   YKG K     EE  E+  DD
Sbjct: 483 PVLPVTKDNMNYVCVVIVGYTAYSILY---WR---YKGKKEFHAVEE-SEHEQDD 530

>Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar to
           Ashbya gossypii AFL081W
          Length = 545

 Score =  134 bits (337), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 120/497 (24%), Positives = 213/497 (42%), Gaps = 15/497 (3%)

Query: 62  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFXXXXXXXXXXXXXX 120
           EL++ FS   + GV F +      ++ ++  G+S+G P+ + +G                
Sbjct: 46  ELRKSFSLWSVLGVGFGLTNSWFGLSVSMVTGISSGGPMMIIYGIVIIALISVCVGVSLG 105

Query: 121 XXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVG-FLDTLSLSASVCSIVYGLAQQILSAV 179
             SSA P AG  +    Q AP + ++  +Y  G F    S+ AS  S +    + +L   
Sbjct: 106 ELSSAYPHAGGQFWWSLQLAPNKYKRLAAYLCGSFAWAGSVFASASSTL-STTRLLLGMY 164

Query: 180 LVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPI 239
            + +P     D   + VF    VC   L           + + +IS+  L V  F  I I
Sbjct: 165 ALVHPSLEIKD---WHVF----VCYQALHMFLLLFNCHGRPLPLISSTALYVSLFSFITI 217

Query: 240 GVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEAR 299
            ++   + + +FN   F+F    N + W       I GL+   W+    D   HMA E  
Sbjct: 218 TITVLASSHGNFNDAKFVFANFRNETGWESNTIAFIVGLINPAWSFSCLDCATHMAFEVE 277

Query: 300 DAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRW 359
                +P  I+G++ + ++   + CI +   +  D+D +L S  G  +  I Y A G + 
Sbjct: 278 KPETVIPTAILGTVAIGFLTSIVYCIAMFFSIR-DLDGILSSTTGAPILDIYYQASGSKA 336

Query: 360 TLGFL-SIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXX 418
               L S+ ++  F    S     +R  W+FARD+GFP+S  + KV+   GVP+ A    
Sbjct: 337 CAIVLGSLVLLTSFTCVTSCHTWQARLCWSFARDNGFPYSRIWAKVNTELGVPLNAHLLS 396

Query: 419 XXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWS 478
                          TA  AL +  ++ + ++   P+ + L   +++ + GPF+LG F  
Sbjct: 397 CAVISLLGVLYLASSTAFNALVTGCISFLLLSYTVPV-ICLLLKQRNIKRGPFWLGKF-G 454

Query: 479 PIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYY-FVWQRKFYKG 537
              N++ + +  F ++    P    +T   MNY  ++   + + S++Y+ F   +KFY  
Sbjct: 455 TFSNYVLLAWTLFSLVFFSLPPMKPITKGNMNYVSIVILSYLLYSILYWKFSGHKKFYIY 514

Query: 538 PKSNLTDEEFQEYVGDD 554
            +    +E  +    DD
Sbjct: 515 QEKIPVEESDERAEIDD 531

>YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}
           HNM1Choline/ethanolamine transporter; involved in the
           uptake of nitrogen mustard and the uptake of glycine
           betaine during hypersaline stress; co-regulated with
           phospholipid biosynthetic genes and negatively regulated
           by choline and myo-inositol
          Length = 563

 Score =  132 bits (332), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 138/578 (23%), Positives = 237/578 (41%), Gaps = 47/578 (8%)

Query: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSA-TSDQQVLAELGY 59
           M    S+  ++  R   V+ E+               P+  +D++ A  +D +V      
Sbjct: 13  MQPDQSSNASMHKRDLRVEEEI--------------KPLDDMDSKGAVAADGEV------ 52

Query: 60  KEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFXXXXXXXXXXXX 118
              L++ FS   I GV F +      I++++  G+S+G P+ + +G              
Sbjct: 53  --HLRKSFSLWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIGTS 110

Query: 119 XXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSA 178
               SSA P AG  +    + AP + ++  +Y  G         +  S    +A +++  
Sbjct: 111 LGELSSAYPHAGGQFWWSLKLAPPKYKRFAAYMCGSFAYAGSVFTSASTTLSVATEVVGM 170

Query: 179 VLVSNPDFNATDPITYGVFAACIVCMAILTSLPS--RITSKLQTISIISNCFLIVLFFIA 236
             +++P+F    P  + +F    VC  +L           K   I   S+ ++ +L F  
Sbjct: 171 YALTHPEF---IPKRWHIF----VCFELLHLFLMFFNCYGKSLPIISSSSLYISLLSFFT 223

Query: 237 IPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAE 296
           I I V      +  FN   F+F   +N + W  G    I GL+   W+    D   HMA 
Sbjct: 224 ITITVLACS--HGKFNDAKFVFATFNNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAF 281

Query: 297 EARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALG 356
           E     R +P  I+G++ + ++  +   I +   +  D+D+VL S  G  +  I   ALG
Sbjct: 282 EVEKPERVIPIAIMGTVAIGFVTSFCYVIAMFFSIQ-DLDAVLSSTTGAPILDIYNQALG 340

Query: 357 KRWTLGFLSIFII-CQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAV 415
            +    FL   I+   F    +     +R  W+FARD+G P S  + +V+  TGVP+ A 
Sbjct: 341 NKSGAIFLGCLILFTSFGCVIACHTWQARLCWSFARDNGLPLSRLWSQVNPHTGVPLNAH 400

Query: 416 WXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGD 475
                             TA  +L +  +A + ++ I P+   L   K++   GPF+LG 
Sbjct: 401 LMSCAWITLIGLLYLASSTAFQSLITGCIAFLLLSYIIPVICLLA-KKRNIAHGPFWLGK 459

Query: 476 FWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFY 535
           F     N + + +  F ++   FP    VT   MNY  V+  G+   S++Y   W+   Y
Sbjct: 460 F-GFFSNIVLLGWTVFSVVFFSFPPVLPVTKDNMNYVCVVIVGYTAYSILY---WK---Y 512

Query: 536 KGPKS--NLTDEEFQEYVGDDVIDAIMSNNEADYKPGD 571
           KG K    L + E ++    +  D I  + E      D
Sbjct: 513 KGKKEFHALEESENEQAEYSNNFDTIEDSREFSVAASD 550

>NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {ON}
           Anc_6.205
          Length = 569

 Score =  132 bits (332), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 122/482 (25%), Positives = 205/482 (42%), Gaps = 20/482 (4%)

Query: 62  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFXXXXXXXXXXXXXX 120
            L++ FS   I GV F +      I++++  G+S+G P+ + +G                
Sbjct: 54  HLRKSFSVWSILGVGFGLTNSWFGISASMVTGISSGGPMMVVYGIIIIALVSICIGTSLS 113

Query: 121 XXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVL 180
             SSA P AG  +    + AP + ++  +Y  G         +  S    +A +++    
Sbjct: 114 ELSSAYPHAGGQFFWSLKLAPPKHKRFAAYLCGSFAYAGSVFTSASTTLSVATEVVGMYA 173

Query: 181 VSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIG 240
           +++PDF       + +F    VC  +L  L        +++  IS   L +       I 
Sbjct: 174 LTHPDFKVQR---WHIF----VCFELLHLLLMLFNCYGKSLPFISASSLYISLVSFFTIT 226

Query: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARD 300
           V+     + +FN   F+F    N + W  G    I GL+   W+    D   HMA E   
Sbjct: 227 VTVLACSHGNFNDPKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEK 286

Query: 301 AVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWT 360
             R +P  I+G+I + +   +   I +   +  D+D +L S  G  +  I    LG +  
Sbjct: 287 PERVIPIAIMGTIAIGFATSFCYVIAMFFSLR-DLDKILTSTTGAPILDIYNQVLGNKSG 345

Query: 361 LGFLSIFIICQFLMGA-STVVA----NSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAV 415
               +IF+ C  L  +   V+A     +R  W+FARD+G P+S+ + +V+   GVP+ A 
Sbjct: 346 ----AIFLGCLVLFTSFGCVIACHTWQARLCWSFARDNGLPWSHLWAQVNPQMGVPLNAH 401

Query: 416 WXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGD 475
                             TA  +L +  +A + ++ I P+ + L   K+  R GPF+LG 
Sbjct: 402 LMSCAWISLIGILYLASSTAFNSLITGCIAFLLLSYIIPV-ICLLMKKRQIRHGPFWLGK 460

Query: 476 FWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFY 535
           F     N I + + AF II   FP    VT   MNY  V+  G+   +L+Y+    RK +
Sbjct: 461 F-GLFSNIILLAWTAFAIIFFSFPPVLPVTKDNMNYVAVVIVGYTSYALLYWRFKGRKEF 519

Query: 536 KG 537
             
Sbjct: 520 HA 521

>Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa]
           {ON} complement(106505..108265) [1761 nt, 587 aa]
          Length = 586

 Score =  132 bits (332), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 129/507 (25%), Positives = 219/507 (43%), Gaps = 21/507 (4%)

Query: 58  GYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFXXXXXXXXXX 116
           G +  L++ FS   I GV F +      I+++L  G+S+G P+ + +G            
Sbjct: 56  GDEVHLRKSFSLWSILGVGFGLTNSWFGISASLVTGISSGGPMMVVYGIIIIALISVCVG 115

Query: 117 XXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQIL 176
                 SSA P AG  +    + APQ+ ++  +Y  G         +  S    +A +++
Sbjct: 116 VSLGELSSAYPHAGGQFWWSLKLAPQKHKRFAAYLCGSFAYAGSVFTSASTTLSVATELV 175

Query: 177 SAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIA 236
               +++P+F    P  + VF    VC  +L           +++ +IS   L +     
Sbjct: 176 GMYSLTHPEF---IPQRWHVF----VCFELLHLFLMLFNCYGKSLPLISTTSLYISLASF 228

Query: 237 IPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAE 296
           + I V+     + +FN   F+F    N++ W       I GL+   W+    D   HMA 
Sbjct: 229 LTITVTVLGCSHGNFNDPKFVFATFYNQTGWKNSVIAFITGLINPAWSFSCLDCATHMAF 288

Query: 297 EARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALG 356
           E     R +P  I+G+I + ++  +   I +   +  D+D++  S  G  +  I   ALG
Sbjct: 289 EVEKPERVIPIAIMGTIAIGFVTSFCYVIAMFFSIR-DLDALFASHTGAPILDIYNQALG 347

Query: 357 KRW---TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVR 413
            +     LG L +F     ++   T  A  R  W+F+RD G P+S+ + +V+   GVP+ 
Sbjct: 348 NKGGAIVLGCLILFTSFGCVIACHTWQA--RLCWSFSRDKGLPYSHLWAQVNPQLGVPLN 405

Query: 414 AVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYL 473
           A                   TA  +L +  +A + ++ I P+   L   K+  + GPF+L
Sbjct: 406 AHLMSCAWISLIGILYIASTTAFNSLITGCIAFLLLSYIIPVICLLK-KKRQIKHGPFWL 464

Query: 474 GDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRK 533
           G F     N + + +  F I+   FP    VT   MNY  V+  G+ +  LIY+     K
Sbjct: 465 GKF-GLFSNIVLLGWTLFAIVFFSFPPQLPVTKDNMNYVSVVIVGYTLYVLIYW-----K 518

Query: 534 FYKGPKSNLTDEEFQEYVGDDVIDAIM 560
           F    + + T+EE +E  GD V D  M
Sbjct: 519 FKGSKEFHATEEESEEEEGDLVEDGDM 545

>Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON}
           YGL077C (REAL)
          Length = 562

 Score =  131 bits (330), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 138/554 (24%), Positives = 236/554 (42%), Gaps = 44/554 (7%)

Query: 27  ELGTITSAHGAPIRFVDARSATSD---QQVLAELGYKEELKREFSSIQIFGVAFSIMGLL 83
           E  + T  H   +R  +    + D   + V+A  G +  L++ FS   I GV F +    
Sbjct: 16  EQSSNTHIHKRDVRVEEEIKPSDDMDGKGVVAADG-EVHLRKSFSLWSILGVGFGLTNSW 74

Query: 84  PSIASTLDGGLSAG-PVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQ 142
             I++++  G+S+G P+ + +G                  SSA P AG  +    + AP 
Sbjct: 75  FGISTSMVAGISSGGPMMIIYGIIIVALISICIGTSLGELSSAYPHAGGQFWWSLKLAPP 134

Query: 143 RVRKCISYSVGFLDTLSLSASV---CSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAA 199
           + ++  +Y  G   + + + SV    S    +A +++    + +P+F    P  + +F  
Sbjct: 135 KYKRFAAYMCG---SFAFAGSVFTSASTTLSVATEVVGMYALMHPEFT---PKRWHIF-- 186

Query: 200 CIVCMAILTS--LPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFI 257
             VC  +L    +      K   I   S+ ++ +  F  I I V      +  FN   F+
Sbjct: 187 --VCFELLHLFLMLFNCYGKSLPIISSSSLYISLFSFFTITITVLACS--HGKFNDAKFV 242

Query: 258 FGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCW 317
           F    N + W  G    I GL+   W+    D   HMA E     R +P  I+G++ + +
Sbjct: 243 FATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGF 302

Query: 318 ILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLMGAS 377
           +  +   I +   +  D+ +VL S  G  +  I   ALG +    FL   I+   L    
Sbjct: 303 VTSFCYVIAMFFSIK-DLSAVLSSTTGAPILDIYNQALGNKSGAIFLGCLIL---LTSFG 358

Query: 378 TVVA----NSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGE 433
            V+A     +R  W+FARD+G P S ++ +V+   GVP+ A                   
Sbjct: 359 CVIACHTWQARLCWSFARDNGLPLSRYWAQVNPHIGVPLNAHLMSCAWISLIGLLYLASS 418

Query: 434 TASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVI 493
           TA  +L +  +A + ++ I P+   L   K+D   GPF+LG F     N + + +  F +
Sbjct: 419 TAFQSLITGCIAFLLLSYIIPVVCLLA-KKRDIAHGPFWLGKF-GFFSNIVLLGWTIFSV 476

Query: 494 IMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIY-YFVWQRKFYKGPKS---------NLT 543
           +   FP    VT   MNY  V+  G+   SL+Y +F  +++F+   +S         N  
Sbjct: 477 VFFSFPPVLPVTKDNMNYVCVVIVGYTAYSLLYWHFKGKKEFHAVEESEDEQADFANNFE 536

Query: 544 DEEFQEY--VGDDV 555
           +E+ QE+  V  DV
Sbjct: 537 NEDSQEFSLVASDV 550

>AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL077C (HNM1)
          Length = 542

 Score =  131 bits (329), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 115/476 (24%), Positives = 200/476 (42%), Gaps = 16/476 (3%)

Query: 61  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFXXXXXXXXXXXXX 119
           + L++ FS   + GV F +      I+ ++  G+ S GP+ + +G               
Sbjct: 40  QLLRKSFSLWSVLGVGFGLTNSWFGISVSMITGIGSGGPMMIVYGIVIIALVSVCVGVSL 99

Query: 120 XXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAV 179
              SSA P AG  +    + AP + R+  +Y  G L       +  S     A +++   
Sbjct: 100 AELSSAYPHAGGQFWWSLKLAPPKHRRLAAYLCGSLAWAGSVFTSASTTLSAATELVGMY 159

Query: 180 LVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPI 239
            +  P+F       + VF    VC  IL           +++ ++S+  L V  F  + I
Sbjct: 160 ALVRPEFVVRK---WHVF----VCYQILHCFLMLFNCYGRSLPLVSSSALYVSLFSFVTI 212

Query: 240 GVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEAR 299
            ++        FN   F+F    N + W       I GL+   W+    D   HMA E  
Sbjct: 213 TITVVACSRGHFNDPKFVFATFRNETGWQNSAIAFIVGLINPAWSFSCLDCATHMAFEVE 272

Query: 300 DAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKR- 358
              R +P  I+G++ + ++  +   I +   +  D+  ++ S  G  +  I Y ALG R 
Sbjct: 273 QPERVIPIAILGTVAIGFLTSFCYVIAMFFSLR-DLSEIMTSNTGVPILDIYYQALGSRA 331

Query: 359 --WTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVW 416
               LG L +      ++ + T    +R  W+FARD G P+S+ + +V+   GVP+ A  
Sbjct: 332 GALVLGSLVLLTSVGCIISSHT--WQARLCWSFARDGGLPYSHLWARVNRSVGVPLNAHL 389

Query: 417 XXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDF 476
                            TA  +L +  +A + ++ I P+ + L   K+  + GPF+LG F
Sbjct: 390 MSCVCISLLGILYMASSTAFNSLITGCIAFLLLSYIVPV-ICLLLKKRQIKHGPFWLGPF 448

Query: 477 WSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQR 532
                N++ + +  FV+I    P    VT   MNY  V+  G+ +  LI++ +  R
Sbjct: 449 -GAFCNYVLLAWTVFVLIFFSLPPLKPVTKDNMNYVSVVVVGYILYVLIFWRLQGR 503

>NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205
          Length = 600

 Score =  130 bits (327), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 135/555 (24%), Positives = 232/555 (41%), Gaps = 34/555 (6%)

Query: 13  NRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGY--------KEELK 64
           +R+   D    +++EL T    H       +     ++ Q++ + G         +  L+
Sbjct: 13  HRRDEFD---EKLKELPTTEQQHTIKSITPEGDENDTESQIINKNGNNNTTTNGSEVHLR 69

Query: 65  REFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFXXXXXXXXXXXXXXXXS 123
           + FS   + GV F +      I++++  G+S+G P+ + +G                  S
Sbjct: 70  KSFSLWSVLGVGFGLTNSWFGISTSMVTGISSGGPMMVIYGIIIIALISICIGTSLGELS 129

Query: 124 SAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVSN 183
           SA P AG  +    + AP + ++  +Y  G         +  S     A +++    +++
Sbjct: 130 SAYPHAGGQFWWSLKLAPPKYKRLAAYMCGSFAYAGSVFTSASTTLSAATEVVGMYALTH 189

Query: 184 PDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSR 243
            DF    P  + VF    VC  IL           +++ IIS   L +     + I ++ 
Sbjct: 190 EDF---VPKRWHVF----VCFEILHLFLMIFNCYGKSLPIISASSLYISLSSFLIITITV 242

Query: 244 SDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVR 303
                  FN   F+F    N + W       I GL+   W+    D   HMA E     R
Sbjct: 243 LACSRGQFNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEVEKPER 302

Query: 304 AVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGF 363
            +P  I+ +I + +I  +   I +   +  D+DS+L S  G  +  I   ALG +     
Sbjct: 303 VIPIAILSTIAIGFITSFCYVISMFFSLR-DLDSILKSTTGAPILDIYNQALGNKAG--- 358

Query: 364 LSIFIICQFLMGA-STVVA----NSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXX 418
            +I + C  L  +   V+A     +R  W+FARD+G P+S  + +V+   GVP+ A    
Sbjct: 359 -AIILGCMILFTSFGCVIACHTWQARLGWSFARDNGLPYSKLWAQVNPQVGVPLNAHLMS 417

Query: 419 XXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWS 478
                          TA  +L +  +A + ++ I P++  L   K+  R GPF+LG F  
Sbjct: 418 CAWISLIGILYLASSTAFNSLITGCIAFLLLSYIIPVSC-LLLKKRQIRHGPFWLGKF-G 475

Query: 479 PIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGP 538
              N + + +  F I+   FP+   VT   MNY  V+  G+ + S++Y   W  K YK  
Sbjct: 476 LFSNIVLLLWTVFAIVFFSFPAMMPVTKDNMNYVAVVIAGYTLYSVLY---WNFKGYKEF 532

Query: 539 KSNLTDEEFQEYVGD 553
            ++  +EE QEY  D
Sbjct: 533 HASEEEEEQQEYAND 547

>TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.205
           YGL077C
          Length = 586

 Score =  129 bits (324), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 132/537 (24%), Positives = 224/537 (41%), Gaps = 36/537 (6%)

Query: 10  TIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKE-ELKREFS 68
           T  N+  HV+             S +GA +          DQQ+   +G  E  L++ FS
Sbjct: 15  TTSNKVIHVNSHAISRNTSNIELSTNGAKL---------DDQQLNHHVGDGEVHLRKSFS 65

Query: 69  SIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFXXXXXXXXXXXXXXXXSSAMP 127
           +  I GV F +      I+++L  G+S+G P+ + +G                  SSA P
Sbjct: 66  AWSILGVGFGLTNSWFGISTSLVTGISSGGPLMVVYGIIIIALISVCVGVSLGELSSAYP 125

Query: 128 TAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVSNPDFN 187
            AG  +    + AP + RK  +Y  G         +  S    +A +++    + +P+F 
Sbjct: 126 HAGGQFWWSLKLAPPKHRKFAAYLCGSFAYAGSVFTSASTTLSVATEVVGMYALKHPEF- 184

Query: 188 ATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTL 247
              P  + VF  C   + +   L +     L  IS  S    +  FF    I V+     
Sbjct: 185 --KPQRWHVFI-CFELLHLFLMLFNCYGKSLPLISSSSLYISLTSFF---TITVTVLACS 238

Query: 248 NRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPF 307
           +  FN   F+F    N + W       I GL+   W+    D   HMA E     + +P 
Sbjct: 239 SGKFNDSKFVFASFYNETGWKNNGIAFITGLINPAWSFSCLDCATHMAFEVEKPEKIIPL 298

Query: 308 GIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIF 367
            I+G+I + ++  +   I +   +  D+D +L+S  G  +  I   ALG        +IF
Sbjct: 299 AIMGTIAIGFVTSFCYVIAMFFSIR-DLDKLLNSTTGAPILDIFNQALGNSSG----AIF 353

Query: 368 IICQFLMGA-STVVA----NSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXX 422
           + C  L  +   V+A     +R  W+F+R+ G P+S+ + +V+   GVP+ A        
Sbjct: 354 LGCLILFTSFGCVIACHTWQARLCWSFSRNKGLPYSHLWSQVNPNVGVPLNAHLMSCALI 413

Query: 423 XXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIIN 482
                      TA  +L +  +A + ++ I P+ + L   ++  + GPF+LG F     N
Sbjct: 414 SIIGVLYIASSTAFNSLITACIAFLLLSYIIPV-ICLLLKRRQIKHGPFWLGKF-GLFSN 471

Query: 483 WISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPK 539
            + + +  F I+   FP    VT   MNY  V+  G+ + +++Y   W    +KG K
Sbjct: 472 IVLLCWTIFAIVFFSFPPQLPVTKDNMNYVSVVIVGYSIYAILY---WH---FKGSK 522

>KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]
           {ON} similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 547

 Score =  128 bits (321), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 128/529 (24%), Positives = 215/529 (40%), Gaps = 26/529 (4%)

Query: 42  VDARSATSDQQVLAELGY-------KEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGL 94
           V   S   +Q + ++  Y       +  L++ FS   I GV F +      I+ ++  G+
Sbjct: 29  VHEESKLEEQSISSKDAYDAYGGTGEGHLRKSFSLWSILGVGFGLTNSWFGISVSMVTGI 88

Query: 95  -SAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVG 153
            S GP+ + +G                  SSA P AG  +    Q AP + R+  +Y  G
Sbjct: 89  YSGGPMMVVYGIIIIALISICIAVTLGELSSAFPHAGGQFWWSLQLAPPKYRRLAAYLCG 148

Query: 154 FLDTLSLSASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSR 213
                    S  S    +A +++    +++PDF       + VF    VC  IL      
Sbjct: 149 SFAWAGAIFSSASTTLSVASELVGMYALTHPDFEVKR---WHVF----VCFQILHLFLMM 201

Query: 214 ITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNW 273
                + + +IS   L +       I V+     +  +N   F+F    N + W  G   
Sbjct: 202 FNCSGKALPVISQSSLYISLISFFTITVTVLACSHGKYNDAKFVFATFYNETGWKNGVIA 261

Query: 274 CIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNP 333
            I GL+   W+    D   HMA E  +  R +P  I+ ++ + ++  +   I +   +  
Sbjct: 262 FIVGLINPAWSFSCLDCATHMAFEVENPERVIPISILCTVGIGFLTSFSYVIAMFFSLQ- 320

Query: 334 DIDSVLDSQFGQAMTQIIYDALGKR---WTLGFLSIFIICQFLMGASTVVANSRQFWAFA 390
           D+++V  S  G  + +I   A         LG L +F     ++   T  A  R  W+FA
Sbjct: 321 DLEAVASSNTGMPILEIFRQATKSTPGAVVLGCLILFTSFGCVIACHTWQA--RLCWSFA 378

Query: 391 RDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMA 450
           RD+G P+S ++ K+D   GVP+ A                   TA  +L +  +A +  +
Sbjct: 379 RDNGIPYSKYWAKIDPELGVPLNAHLLSCALISLLGCLYMASTTAFNSLITGCIAFLLFS 438

Query: 451 LIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMN 510
              P+   L   K++ + GPF+LG F     N + + +  F ++   FP+   VT   MN
Sbjct: 439 YSVPVVCLLAR-KRNIKHGPFWLGKF-GAFSNIVLLGWNLFALVFFCFPAVMPVTKDNMN 496

Query: 511 YTVVIGPGFWVLSLIYY-FVWQRKFYKGPKSNLTDEEFQEYVGDDVIDA 558
           Y  V+  GF +  L ++ F  ++ FY     N TD   QE V  +   A
Sbjct: 497 YASVVIVGFLLFYLGFWQFKAKKVFYIREDEN-TDSN-QESVTTEAFHA 543

>TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.205
           YGL077C
          Length = 553

 Score =  128 bits (321), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 128/528 (24%), Positives = 213/528 (40%), Gaps = 31/528 (5%)

Query: 12  KNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKEELKREFSSIQ 71
           K+  S  + +   + E+ T  S  GA               ++ E G +  L++ FS   
Sbjct: 4   KSLSSAYEADRTSLSEVHTRESHKGAL--------EYGKDTMMTERGGEVHLRKSFSLWS 55

Query: 72  IFGVAFSIMGLLPSIA-STLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAG 130
           I GV F +      I+ S + G  S GP+ + +G                  SSA P AG
Sbjct: 56  ILGVGFGLTNSWFGISVSMVTGIFSGGPMMIVYGIIIVALISICVGASLGELSSAYPHAG 115

Query: 131 AVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVSNPDFNATD 190
             +    + AP + ++  +Y  G         +  S     A +++    +++PDF    
Sbjct: 116 GQFWWSLKLAPPKHKRFAAYLCGSFAYAGSVFTSASTTLSAATEVVGMYALAHPDFT--- 172

Query: 191 PITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRS 250
           P  + VF    VC  I+    +      +++ +IS   L +       I V+     +  
Sbjct: 173 PKRWHVF----VCFEIMHLFLTLFNCYGKSLPLISASALYISLLSFFTITVTVLACSSGK 228

Query: 251 FNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIV 310
           FN   F+F    N + W       I GL+   W+    D   HMA E     R +P  I+
Sbjct: 229 FNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIM 288

Query: 311 GSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIIC 370
           G++ + +   +   I +   +  D+DS++ S  G  +  I   ALG   T G  +IF+ C
Sbjct: 289 GTVAIGFATSFCYVISMFFSIR-DLDSLMQSATGAPILDIYNQALGN--TSG--AIFLGC 343

Query: 371 QFLMGA-STVVA----NSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXX 425
             L  +   ++A     +R  W+FARD G PFS    +V+   GVP+ A           
Sbjct: 344 MVLFTSFGCIIACHTWQARLGWSFARDKGLPFSGLLSQVNPQVGVPLNAHLMSCALISLI 403

Query: 426 XXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWIS 485
                   TA  +L +  +A + ++   P+ + L   K+  + GPF+ G       N + 
Sbjct: 404 GLLYLASSTAFNSLCTGCIAFLLLSYSIPV-ICLLRKKRQIKHGPFWFGKL-GYFFNIVL 461

Query: 486 VFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRK 533
           + +  F I+   FP    VT   MNY  V+  GF   +L+Y   W+ K
Sbjct: 462 LGWAVFCIVFFSFPPALPVTKDNMNYVSVVIVGFTAYALLY---WKFK 506

>ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {ON}
           similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 569

 Score =  127 bits (318), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 130/564 (23%), Positives = 231/564 (40%), Gaps = 35/564 (6%)

Query: 6   SNKGTIKNRKSHVDVEVGQMRELGT--ITSAHGAPIRFVDARSATSDQQVLAELGYKEEL 63
           S  G  + R S  ++   +  E     ++       ++ D   +   ++V+        L
Sbjct: 2   STSGEFQQRSSQSEIHKREFYEAPNEELSMDKNDMDKYDDESGSGGSEEVV--------L 53

Query: 64  KREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFXXXXXXXXXXXXXXXX 122
           ++ FS   I GV F +      I+++L  GLS+G P+ + +G                  
Sbjct: 54  RKSFSLWSILGVGFGLTNSWFGISASLVTGLSSGGPLLVIYGIILISLISITIGVSLGEL 113

Query: 123 SSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVS 182
           +SA P AG  +    + AP + ++  +Y  G         +  S    +A ++++   ++
Sbjct: 114 TSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSFAYAGAIFTSASTTLSVASELVAMYQLT 173

Query: 183 NPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVS 242
           + DF    P  + VF    V   IL     +     +++ +I++  L +     I I ++
Sbjct: 174 HEDFT---PKRWQVF----VTYLILHFFLMQFNCYGKSLPLIASSSLYISLLSFIVITIT 226

Query: 243 RSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAV 302
                +  FN   F+F    N + W+ G    I GL+   W+    D   HMA E     
Sbjct: 227 VLACSSGHFNSAKFVFSHFYNETGWSSGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPE 286

Query: 303 RAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRW--- 359
             +P  I+G+I + +I  +   I +   +  D+ SVL++  G  +  I   AL  +    
Sbjct: 287 TIIPTAILGTIAIGFITSFCYVISLFFSIR-DLPSVLNNTGGFPVLVIYEQALNSKAGAI 345

Query: 360 TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXX 419
            LG L +F     ++ + T    SR  W+F+RD G PF+  + KV+   GVP+ A     
Sbjct: 346 VLGCLILFTSFGCVIASHT--WQSRLCWSFSRDGGLPFAGLWSKVNSRMGVPLNAHLMSC 403

Query: 420 XXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSP 479
                         TA  +L +  +A + ++   P+ + L   K+    GPF+ G F   
Sbjct: 404 VWVAIIGFLYLASSTAFNSLITACIAFLLLSYSIPV-ICLLMKKRQIAHGPFWFGKF-GL 461

Query: 480 IINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGP- 538
             N   + +  F ++   FP D  V    MNY  V+  G+++ SLIY+  W  K +    
Sbjct: 462 FCNIALLLWTVFCLVFFSFPPDYPVNKDNMNYVSVVIVGYFLYSLIYWKFWASKDFHTHD 521

Query: 539 --------KSNLTDEEFQEYVGDD 554
                      +++E F EY G D
Sbjct: 522 DDDDEQTVAQEISNEGFDEYDGTD 545

>KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo- inositol
          Length = 532

 Score =  125 bits (315), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 120/497 (24%), Positives = 210/497 (42%), Gaps = 25/497 (5%)

Query: 62  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGG-LSAGPVGLGWGWFXXXXXXXXXXXXXX 120
            L+++FS   I GV F +      I++++  G +S GP+ + +G                
Sbjct: 46  HLRKQFSLWSILGVGFGLTNSWFGISTSMITGIMSGGPMMVVYGIIIIALISICIAVSLG 105

Query: 121 XXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVL 180
             SSA P AG  +    + AP + ++  +Y  G L       +  S    +A +I+    
Sbjct: 106 ELSSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSLAWAGSVFTSASTTLSVAAEIVGMYA 165

Query: 181 VSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIG 240
           +++P+F      T+       VC  +L           + + +IS+  L +  F  I I 
Sbjct: 166 LTHPEFEVKRWHTF-------VCFEVLHLFLMLFNCYGKALPLISSSSLYISLFSFITIT 218

Query: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARD 300
           ++     +  +N   F+F    N + W       I GL+   W+    D   HMA E   
Sbjct: 219 ITVLACSHGKYNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEVEK 278

Query: 301 AVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRW- 359
             R +P  I+G++ + ++  +   I +   +  ++D V++S     +  I Y ALG +  
Sbjct: 279 PERVIPISILGTVAIGFVTSFCYVIAMFFSLQ-NLDKVVNSNTQVPILDIYYQALGSKAG 337

Query: 360 --TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWX 417
              LG L +F     ++   T  A  R  W+FARD+G PFS ++ +V    GVP+ A   
Sbjct: 338 AIVLGCLLLFTSFGCVIACHTWQA--RLCWSFARDEGLPFSRYWARVSPELGVPLNAHLM 395

Query: 418 XXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFW 477
                           TA  +L +  +  + ++   P+   L   K++ + GPF+LG F 
Sbjct: 396 SSFWIVLLGCLYLASSTAFNSLITGCIMFLLLSYTIPVVC-LLLKKRNIKHGPFWLGKF- 453

Query: 478 SPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKG 537
               N + + +  F I+   FPS   V    MNY  V+  G+ + SL++   WQ   ++G
Sbjct: 454 GCFSNVVLLGWMLFSIVFFCFPSQMPVVKDNMNYASVVIVGYLLFSLLF---WQ---FRG 507

Query: 538 PKSNLTDEEFQEYVGDD 554
                T    +E  G+D
Sbjct: 508 RH---TFHALEEEAGED 521

>TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {ON}
           Anc_6.205 YGL077C
          Length = 594

 Score =  125 bits (313), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 133/554 (24%), Positives = 229/554 (41%), Gaps = 30/554 (5%)

Query: 12  KNRKSHVDVE----VGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKEELKREF 67
           KN + +  VE         +LG+++S+    I  +D  S  ++     E+     L++ F
Sbjct: 10  KNSEVYTIVEANDDTASFNQLGSVSSS---KISDLDKNSINNEFNQTEEV----HLRKSF 62

Query: 68  SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAM 126
           S   I GV F +      I++++  G+ S GP+ + +G                  SSA 
Sbjct: 63  SLWSILGVGFGLTNSWFGISASMVTGIESGGPMMIVYGIIIISLISICVGVSLGELSSAY 122

Query: 127 PTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVSNPDF 186
           P AG  +    + AP + R+  +Y  G         +  S    +A +++    + +  F
Sbjct: 123 PHAGGQFFWSLKLAPPKHRRFAAYMCGSYAYAGSVFTSASTTLSVATELVGMYALCHESF 182

Query: 187 NATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDT 246
               P  + VF    VC  +L           +++  IS+  L +       I ++    
Sbjct: 183 ---VPRRWHVF----VCFELLHLFLLLFNCYGKSLPFISSSSLYISLLSFFTITITVLAC 235

Query: 247 LNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVP 306
            +  +N   F+F    N + W  G    I GL+   W+    D   HMA E     R +P
Sbjct: 236 AHGKYNDAKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIP 295

Query: 307 FGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRW---TLGF 363
             I+G+I + +I  +   I +   +N D++++ +S  G  +  I   AL  +     LG 
Sbjct: 296 MAIMGTIAIGFITSFCYVIAMFFSLN-DLNALFNSHTGAPILDIYNQALHNKAGAIVLGC 354

Query: 364 LSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXX 423
           L +F     ++   T  A  R  W+FA D G P+S ++ +V+   GVP+ A         
Sbjct: 355 LVLFTSFGCVIACHTWQA--RLCWSFATDQGLPYSKWWAEVNPTLGVPLNAHLMSCGWIA 412

Query: 424 XXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINW 483
                     TA  +L +  +A + ++ I P+ + L   K+  + GPF+LG F     N 
Sbjct: 413 IIGLLYLASSTAFNSLITGCIAFLLLSYIIPV-ICLLQKKRQIKHGPFWLGKF-GLFSNI 470

Query: 484 ISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLT 543
           + + +  F I+   FP +  V    MNY  V+  GF    LIY   W+ K  K   S   
Sbjct: 471 VLLCWTLFSIVFFSFPPNLPVNRNNMNYVCVVIVGFTCYQLIY---WKWKGAKEFHSAQD 527

Query: 544 DEEFQEYVGDDVID 557
           D++  EY  +  I+
Sbjct: 528 DDDNIEYENNSNIN 541

>Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  124 bits (312), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 118/494 (23%), Positives = 208/494 (42%), Gaps = 17/494 (3%)

Query: 62  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFXXXXXXXXXXXXXX 120
            L++ FS   I GV F +      I++++  G+S+G P+ + +G                
Sbjct: 53  HLRKSFSLWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIGTSLG 112

Query: 121 XXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVL 180
             SSA P AG  +    + AP + ++  ++  G         +  S    +A +++    
Sbjct: 113 ELSSAYPHAGGQFWWSLKLAPPKYKRFAAFMCGSFAYAGSVFTSASTTLAVATEVVGMYA 172

Query: 181 VSNPDFNATDPITYGVFAACIVCMAILTSLPS--RITSKLQTISIISNCFLIVLFFIAIP 238
           + + +F    P  + +F    VC  +L           K   I   S+ ++ +L F  I 
Sbjct: 173 LMHSEFT---PKRWHIF----VCFELLHLFLMFFNCYGKSLPIISSSSLYISLLSFFTIT 225

Query: 239 IGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEA 298
           I V      +  FN   F+F    N + W  G    I GL+   W+    D   HMA E 
Sbjct: 226 ITVLACS--HGKFNDSKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEV 283

Query: 299 RDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKR 358
               R +P  I+G+I + ++  +   I +   +  D+D +L S  G  +  I   ALG +
Sbjct: 284 EKPERVIPIAIMGTIAIGFVTSFCYVIAMFFSIK-DLDGILSSTTGAPILDIYNQALGNK 342

Query: 359 WTLGFLSIFII-CQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWX 417
               FL   I+   F    +     +R  W+F+RD+G P S  + +V+  TGVP+ A   
Sbjct: 343 SGAIFLGCLILFTSFGCVIACHTWQARLCWSFSRDNGLPLSRLWSQVNPHTGVPLNAHLM 402

Query: 418 XXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFW 477
                           TA  +L +  +A + ++ I P+   L   K+D   GPF+LG F 
Sbjct: 403 SCAWISLIGLLYLASSTAFQSLITGCIAFLLLSYIIPVVCLLN-KKRDIAHGPFWLGKF- 460

Query: 478 SPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYY-FVWQRKFYK 536
               N + + +  F ++   FP    VT   MNY  V+  G+   S++Y+ +  +++F+ 
Sbjct: 461 GFFSNIVLLGWTLFAVVFFSFPPVLPVTKDNMNYVCVVIVGYTAYSILYWKYKGKKEFHA 520

Query: 537 GPKSNLTDEEFQEY 550
             +S +   +F  +
Sbjct: 521 VEESEIDQTDFANH 534

>KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {ON}
           Anc_6.205 YGL077C
          Length = 543

 Score =  122 bits (305), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 126/526 (23%), Positives = 213/526 (40%), Gaps = 22/526 (4%)

Query: 33  SAHGAPIRFVDARSATSDQQVLAE------LGYKEELKREFSSIQIFGVAFSIMGLLPSI 86
           S H    R    + + +D + L++      L  +  L++ FS   I GV F +      I
Sbjct: 18  SVHKRQSRVSLTQLSLNDDESLSKGAADTLLDGEPHLRKSFSLWSILGVGFGLTNSWFGI 77

Query: 87  A-STLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVR 145
           + S + G +S GP+ + +G                  SSA P AG  +    + AP R R
Sbjct: 78  SVSMVTGIMSGGPMMIVYGIIIIALISVCVGGSLGELSSAYPHAGGQFWWALKLAPARHR 137

Query: 146 KCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMA 205
           +  ++  G         +  S       +++    + +P F       +  F    + + 
Sbjct: 138 RFAAFLCGSFAYAGSVFTSASTTLSAGTEVVGMYALKHPGFVVKRWHVFVCFELIHLFLM 197

Query: 206 ILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRS 265
           +          K   +   S+ ++ ++ F+ I I V    +   SFN   F+F    N +
Sbjct: 198 LFNCY-----GKSLPLISSSSLYISLISFLTITITVLACSS--GSFNDSKFVFATFYNET 250

Query: 266 TWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCI 325
            W       I GL+   W+    DS  HMA E     R +P  I+G++ + ++  +   I
Sbjct: 251 GWKNSGMAFIMGLINPAWSFSCLDSATHMAFEVERPERVIPTAIMGTVAIGFVTSFCYVI 310

Query: 326 VILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFII-CQFLMGASTVVANSR 384
            +   +  DI +VL S  G  + +I   ALG      FL   ++   F    S     +R
Sbjct: 311 AMFFSIR-DISAVLKSTTGAPILEIYRQALGNEGGAIFLGCLVLFTSFGCIISCHTWQAR 369

Query: 385 QFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSV 444
             W+F+RD+G P+S ++ +V+   GVP+ A                   TA  +L +  +
Sbjct: 370 LCWSFSRDNGLPYSKWWSQVNPDVGVPLNAHLMSCAWISLIGVLYLASSTAFNSLITACI 429

Query: 445 AGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTV 504
           A + ++   PI   L + ++D   GPF+LG F     N + + +  F ++   FP    V
Sbjct: 430 AFLLLSYSVPIVC-LLWRRRDIPQGPFWLGKF-GLFANVVLLAWTVFAVVFFSFPPVLPV 487

Query: 505 TPTTMNYTVVIGPGFWVLSLIYY-FVWQRKFYK---GPKSNLTDEE 546
               MNY  V+  GF   SL+Y+ F   R F+K    P   L D E
Sbjct: 488 DRNNMNYVCVVIVGFVTYSLLYWRFKGSRDFHKVEDEPGEKLVDAE 533

>CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P19807 Saccharomyces
           cerevisiae YGL077c HNM1 choline permease
          Length = 556

 Score =  121 bits (304), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 116/479 (24%), Positives = 204/479 (42%), Gaps = 17/479 (3%)

Query: 62  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFXXXXXXXXXXXXXX 120
            L++ FS   I GV F +      I++++  G+ S GP+ + +G                
Sbjct: 43  HLRKSFSLWSILGVGFGLTNSWFGISASMVTGINSGGPMMIVYGIIIIALISVCIGVSLG 102

Query: 121 XXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVL 180
             SSA P AG  +    + AP + ++  +Y  G         +  S     A +++   +
Sbjct: 103 ELSSAYPHAGGQFWWSLKLAPTKHKRFAAYLCGSFAYAGSLFTSASTTLSAATELVGMYV 162

Query: 181 VSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIG 240
           +++P+F    P  + +F  C   + +   L +     L  IS  S    +  FF+   I 
Sbjct: 163 LTHPEFT---PKRWHIFV-CFELLHLFLMLFNCYGKSLPLISASSLYISLTSFFV---IT 215

Query: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARD 300
           V+     +  FN   F+F    N + W       I GL+   W+    D   HMA E   
Sbjct: 216 VTVLACSSGKFNDAKFVFATFYNETGWKNSVIAFIVGLINPAWSFSCLDCATHMAFEVEK 275

Query: 301 AVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKR-- 358
             R +P  I+G+I + ++  +   I +   +  D+D++L S  G  +  I   A   +  
Sbjct: 276 PERVIPIAIMGTIAIGFLTSFCYVIAMFFSIR-DLDALLASNTGAPILNIYEQATNSKAG 334

Query: 359 -WTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWX 417
              LG L   +I  F    +     +R  W+FARD+G P+S ++ +V+   GVP+ A   
Sbjct: 335 AIVLGCL--VLITSFGCIIACHTWQARLGWSFARDNGLPYSKYWSQVNPNAGVPLNAHLM 392

Query: 418 XXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFW 477
                           TA  +L +  +A + ++ I P+ + L   K+  R GPF+LG F 
Sbjct: 393 SSALIALIGVLYLASTTAFNSLITGCIAFLLLSYIIPV-ICLLMRKRQIRQGPFWLGKF- 450

Query: 478 SPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYY-FVWQRKFY 535
               N + + +  F I+   FP    V+   MNY  V+  G+ V ++ Y+ F  +++F+
Sbjct: 451 GLFSNIVLLGWTLFAIVFFSFPPVLPVSKDNMNYVSVVIVGYTVYAIAYWEFKGKKEFH 509

>KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.205
           YGL077C
          Length = 538

 Score =  119 bits (298), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 130/526 (24%), Positives = 221/526 (42%), Gaps = 27/526 (5%)

Query: 44  ARSATSDQQVLAELGYKEE----LKREFSSIQIFGVAFSIMGLLPSI-ASTLDGGLSAGP 98
           + + + D ++L++   +++    L++ FS   I GV F +      I AS + G  S GP
Sbjct: 22  SNTPSKDPEILSDKLIEQDEDIHLRKSFSLWSILGVGFGLTNSWFGISASMITGITSGGP 81

Query: 99  VGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTL 158
           + + +G                  SSA P AG  +    Q A  + ++  +Y  G     
Sbjct: 82  MMIVYGIIIIALISICIGVSLGELSSAYPHAGGQFHWTLQLASPKHKRFAAYMCGSFAYA 141

Query: 159 SLSASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAI--LTSLPSRITS 216
               +  S    +A  ++    +++ +F    P  + VF    VC  +  L  +      
Sbjct: 142 GSVFTSASTTLSVATLLVGMYSLTHENF---IPKRWHVF----VCFELVHLFLMLFNCYG 194

Query: 217 KLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIA 276
           K   +   S+ ++ +  F  I I V    +    FN   F+F    N + W       I 
Sbjct: 195 KSLPLISSSSLYISLFSFFTITITVLACSS--GKFNDSKFVFATFYNETGWKSSAIAFIV 252

Query: 277 GLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDID 336
           GL+   W+    D   HMA E     R +P  I+G+I + ++  +   I +   +  +I 
Sbjct: 253 GLINPAWSFSCLDCATHMAFEVEKPERVIPMAIMGTIAIGFLTSFAYVISMFFSIR-NIQ 311

Query: 337 SVLDSQFGQAMTQIIYDALGKRW---TLGFLSIFIICQFLMGASTVVANSRQFWAFARDD 393
            VL+S  G  + +I   ALG +     LG L +F     ++   T  A  R  W+FARD 
Sbjct: 312 DVLNSNSGAPILEIYNQALGNKAGAVILGCLVLFTSFGCVIACHTWQA--RLCWSFARDK 369

Query: 394 GFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIF 453
           G P+S F+ +V+   GVP+ A                   TA  +L +  +A + ++   
Sbjct: 370 GLPYSRFWSQVNPTFGVPLHAHLMSCTLISIIGLLYLASSTAFNSLITACIAFLLLSYSI 429

Query: 454 PITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTV 513
           P+ + L   K+D   GPF+LG F     N + + +  F ++   FPS   V    MNY  
Sbjct: 430 PV-ICLLLRKRDMNRGPFWLGKF-GLFSNIVLLAWTVFSLVFFSFPSQIPVNRNNMNYVS 487

Query: 514 VIGPGFWVLSLIYYFVW-QRKFYKGPK--SNLTDEEFQEYVGDDVI 556
           V+  G+   S+ Y+FV  + +FY      S+ ++EE      +DVI
Sbjct: 488 VVIAGYTFFSVSYWFVKGKNEFYLDDNIISSSSEEEADIVTREDVI 533

>Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {ON}
           YGL077C (HNM1) - Transporter (permease) for choline and
           nitrogen mustard; share homology with UGA4 [contig 168]
           PARTIAL
          Length = 342

 Score =  100 bits (248), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 87/328 (26%), Positives = 141/328 (42%), Gaps = 16/328 (4%)

Query: 234 FIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLH 293
           FI I I V      N  +N   F+F    N + W       I GL+   W+    D   H
Sbjct: 25  FITITITVLACSRGN--YNDPKFVFATFFNETGWRNSGIAFIVGLINPAWSFSCLDCATH 82

Query: 294 MAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYD 353
           MA E     R +P  I+G++ + ++  +   I +   ++ ++D ++ S  G  +  I   
Sbjct: 83  MAFEVERPERVIPISILGTVAIGFVTSFCYVIAMFFSLH-NLDEIVGSNTGAPILDIYLQ 141

Query: 354 ALGKRW---TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGV 410
           ALG +     LG L +F     ++   T    +R  W+FARD+G P+S  + KV    GV
Sbjct: 142 ALGNKAGAVVLGCLVLFTSFGCVIACHT--WQARLCWSFARDEGLPYSRIWAKVSPELGV 199

Query: 411 PVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGP 470
           P+ A                   TA  +L +  +  +  + I P+ + L   K++ + GP
Sbjct: 200 PLNAHLMSCFWIVLLGLLYLASTTAFNSLITGCIMFLLFSYIVPV-ICLLIKKRNIKHGP 258

Query: 471 FYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVW 530
           F+LG F     N + + +  F ++   FP    V    MNY  V+  G+ + SL++   W
Sbjct: 259 FWLGKF-GLFANIVLLGWSLFALVFFCFPFVMPVDKDNMNYASVVIVGYILFSLLF---W 314

Query: 531 QRKFYKGPKSNLTDEEFQEYVGDDVIDA 558
               +KG  S    EE +E V     DA
Sbjct: 315 H---FKGRHSFHLLEEEEENVFPLETDA 339

>TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa]
           {ON} Anc_1.173 YKL174C
          Length = 659

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 104/528 (19%), Positives = 215/528 (40%), Gaps = 25/528 (4%)

Query: 46  SATSDQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGW 103
           + T   Q +    Y ++L +   S   + G+ F +M  +  + +++  GL + GP  + W
Sbjct: 37  AETEGPQEVEHFNYHQDLDKSLLSRGSVMGLGFGLMSPVLGMCTSMAIGLMNGGPATIMW 96

Query: 104 GWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSAS 163
           G+                  S  P    ++VS    AP++++   S+  G+L  +     
Sbjct: 97  GFLISGIMVWFCSLSLGEIVSKFPME--LHVSSAMLAPKKLKLICSWYTGWLTLIGNWTM 154

Query: 164 VCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISI 223
             SI +  AQ  +S +L++N D  +   + +       + + I+  +  ++   ++ I+ 
Sbjct: 155 STSITFAGAQLTISLILMANNDLISETNLIFFTVIVFYLVVTIVGIVNLKLARFIEIINK 214

Query: 224 ISNCFLI-VLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWC----IAGL 278
           +   ++I  + FI I +    S      +    F     DN  +   G+  C    I G 
Sbjct: 215 VCVYWIIYAILFIDILLLFFHSG----KYRSLKFALFHFDNSLS---GYANCFVSFIIGF 267

Query: 279 MPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSV 338
             + +T+  +     +A+E ++A R +P  +  S+ +  + G++  + I+  + PD  ++
Sbjct: 268 QQSNFTLQGFSMLPALADEVKEAERDIPRAMSASVLISTVSGFIFLLPIMLIL-PDNTNL 326

Query: 339 LDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAFARDDGFPF 397
                   +  I   +    +   FL + I+   F  G  ++  +SR  ++F+RD   P 
Sbjct: 327 FADHKILPIVSIFTQSTHSTFVSFFLVLMILGNLFFSGIGSITTSSRVVYSFSRDHAIPK 386

Query: 398 SNFFKKVD--GLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPI 455
             F+  VD   ++ VP  +V                   A  A    +V  +  A + P+
Sbjct: 387 HEFWTYVDPQSVSKVPKYSVLLSMAVSYLLGILALFSTAAFNAFIGAAVLCLCSATVLPL 446

Query: 456 TLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVI 515
            L L   ++  R  P  +      I+N  S+ +    +  +  PS   VT  TMNY +++
Sbjct: 447 VLVLFTRRRILRNAPIKIHYKLGWIVNITSIVWLLLSMGSVCLPSQVPVTVRTMNYALIV 506

Query: 516 GPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGDDVIDAIMSNN 563
                +   I YF W +  +  P   L DE+++      ++++  S+N
Sbjct: 507 YVACLIAITILYFRWGKYHFTLP---LVDEDYKNLTS--IMESATSSN 549

>CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa]
           {ON} highly similar to uniprot|P36029 Saccharomyces
           cerevisiae YKL174c
          Length = 621

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 107/543 (19%), Positives = 218/543 (40%), Gaps = 22/543 (4%)

Query: 40  RFVDARSATSDQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLD-GGLSAG 97
            +V     T + + +    YK+EL +   S   + G+ F +M  +  + +++  G L+ G
Sbjct: 34  HYVQEDEVTDEPEEVEHFNYKQELDKSLLSRNSVIGLGFGLMSPVLGMCTSMGIGMLNGG 93

Query: 98  PVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDT 157
           P+ +  G+F                 S  P    ++V     AP R++   S+  G+L  
Sbjct: 94  PLSIMLGFFISGILIWFSSLSLGEIVSKFPME--LHVGSAMIAPPRLKLICSWFTGWLML 151

Query: 158 LSLSASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSK 217
           +       SI +  AQ  +S +L++N +  +    T+ +    IV   ++T +       
Sbjct: 152 IGNWTMSTSITFAGAQLTISLILMANNELISE---THLILFTVIVFYMVVTLVGLVNLKF 208

Query: 218 LQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNR-STWNKGWNWCIA 276
            + I II+   +  + +  I I +         F    +     DN  S ++  +   + 
Sbjct: 209 ARFIEIINKVCVYWIIYAIIFIDILLLIFHKGKFRSLKYALFHFDNSMSGYSSAFLSFLI 268

Query: 277 GLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDID 336
           G   + +T+  +     +A+E +   + +P G+  ++ +    G +  + I+  + PDI+
Sbjct: 269 GFQQSNFTLQGFSMLPALADEVKKPEKDIPRGMSTAVLLSTFSGLIFLLPIMLIL-PDIE 327

Query: 337 SVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAFARDDGF 395
           ++  +     +  I   +        FL + I+   F  G  ++  +SR  ++F+RD   
Sbjct: 328 TIFSNHKVLPIVTIFTKSTHSMVVSVFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAI 387

Query: 396 PFSNF--FKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIF 453
           P  +   F   D  + VP  ++               +   A  A    +V  +  A   
Sbjct: 388 PRYDLWTFVPPDSQSRVPKYSILLSMGISYFLGLLALISTAAFNAFIGAAVLCLCSATFI 447

Query: 454 PITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTV 513
           P+ L L  G++  +  P  +   +   IN  SV +   V++ + FP+   VT   MNY +
Sbjct: 448 PLVLVLCTGRRSIKHAPVKIRYKFGWFINIASVLWLLLVMVSVCFPTQLPVTVKGMNYAI 507

Query: 514 VIGPGFWVLSL----IYYFVWQRKFYKGPKSNLTDEEFQEYVGDDVIDAIMSNNEADYKP 569
           V+    +VL L    I YF W +  ++ P S+  D +   +  +        +NE ++  
Sbjct: 508 VV----YVLCLIGITILYFKWGKYNFRLPLSD--DAKNNPFSLEAQFPTTKEDNEYEHSG 561

Query: 570 GDA 572
            +A
Sbjct: 562 SNA 564

>Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {ON}
           YKL174C - Hypothetical ORF [contig 110] PARTIAL
          Length = 549

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 105/507 (20%), Positives = 212/507 (41%), Gaps = 17/507 (3%)

Query: 50  DQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLD-GGLSAGPVGLGWGWFX 107
           +Q+ +    Y+++L R F S   I G+ F++M  +  +++T++ G L+ GP+ +  G+  
Sbjct: 36  EQEEVQAFKYEQQLDRSFLSKGSIIGLGFALMSPVLGMSTTMNIGLLNGGPMTILLGFLI 95

Query: 108 XXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSI 167
                           S  P    ++      AP   +   S+  G+L  L       SI
Sbjct: 96  NGLATWLCSLSLGEIVSRFPIE--LHGGSAMLAPYNYQLSCSWFTGWLMLLGNWTMSTSI 153

Query: 168 VYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNC 227
            +  AQ ++S V ++N        I      A  + + I+  +  R  S ++ ++ +   
Sbjct: 154 TFAGAQLVISLVTMANDQLIGEKYIVLFTVLAFYIIVTIVGLINLRFASFIEAVNKVCVY 213

Query: 228 FLI-VLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNR-STWNKGWNWCIAGLMPAIWTI 285
           ++I  + FI I + +  S +  RS     F F   DN  S ++      + G   + +T+
Sbjct: 214 WIIYAVIFIDILLLLFHSGSY-RSLKYALFHF---DNSFSGYSSKALSFMIGFQQSSFTL 269

Query: 286 GAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQ 345
             +     +A+E +   R +P G+  ++    + G +  + I+  + PD  +++D+    
Sbjct: 270 QGFSMLPALADEVKRPERDIPKGMFTAVLTSTLTGIVFLLPIMIIL-PDTKTIIDNPKLM 328

Query: 346 AMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAFARDDGFPFSNFFKKV 404
            +  I   +    +   FL I I+   F  G  ++  +SR  ++ +RD   P+S F+  V
Sbjct: 329 PIVLIFTQSTHSMFVSLFLVIMILGNLFFSGIGSITTSSRAVYSMSRDMALPYSEFWSYV 388

Query: 405 DGLTG--VPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYG 462
           D  +   VP  ++               V   A  A    +V  +  A   P+ L +   
Sbjct: 389 DPTSDHRVPKNSILLSMGISYLLGLLALVSTAAFNAFMGAAVMCLCSATCIPLVLVMMSR 448

Query: 463 KKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVL 522
           ++  R  P  +      ++N IS+ +  F ++++ +P    VT  +MNY  ++   F   
Sbjct: 449 RRALRGAPVKVRYRMGWLVNIISILWLLFTMVVICWPPKLPVTLGSMNYAFLVYLLFLTG 508

Query: 523 SLIYYFVWQRKFYKGP---KSNLTDEE 546
             + YF W +  +K P   + N ++E 
Sbjct: 509 ITVLYFRWGKYNFKTPLIGEENKSNES 535

>KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 549

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 98/501 (19%), Positives = 206/501 (41%), Gaps = 14/501 (2%)

Query: 45  RSATSDQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLD-GGLSAGPVGLG 102
           + A  +++ +    Y+++L R F S   + G+ F +M  +  +++T+  G L+ GP+ + 
Sbjct: 31  QDADEEEEEVQRFKYEQQLDRSFLSKSSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIV 90

Query: 103 WGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSA 162
            G+                  S  P    ++      A Q+ +   S+  G+L  L    
Sbjct: 91  IGFLINGIATWLCSLSLGEIVSRFPIE--LHGGSAMLARQKFKLACSWFTGWLMLLGNWT 148

Query: 163 SVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTIS 222
              SI +  AQ ++S V ++N      + I      A  + + I+  +  +    ++T++
Sbjct: 149 MSTSITFAGAQLLVSLVTMTNDKLIGENYIVVTTVLAFYLIVTIVGLINLKFAGFIETVN 208

Query: 223 IISNCFLI-VLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNR-STWNKGWNWCIAGLMP 280
            +   +++  + FI I + +  S      +    +     DN  S ++      I G   
Sbjct: 209 KVCVYWIVYAVIFIDILLLLFHSG----KYRSLKYALAHFDNSFSGYSSAALSFIIGFQQ 264

Query: 281 AIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLD 340
           + +T+  +     +A+E +++ R +P G+  ++    + G +  + I+  + PD  ++++
Sbjct: 265 SSFTLQGFSMLPALADEVKESERDIPKGMSTAVLTSTVTGVVFLLPIMLIL-PDTQTIIN 323

Query: 341 SQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLM-GASTVVANSRQFWAFARDDGFPFSN 399
           +     +  I   +    +   FL I I+   L  G  +V  +SR  ++ +RD   P+S 
Sbjct: 324 NPKVMPIALIFTQSTHSIFVSLFLVIMILGNLLFSGIGSVTTSSRAVYSMSRDMALPYSE 383

Query: 400 FFKKVDGLTG--VPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITL 457
           F+  VD  +   VP  ++               +   A  A    +V  +  A   P+ L
Sbjct: 384 FWSYVDPSSKHRVPKNSILLSMGISYLLGLLALLSTAAFNAFMGAAVLCLCSATCIPLVL 443

Query: 458 RLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGP 517
            L   ++  R  P  +       +N  S+ +  F ++++  P    VT ++MNY  V+  
Sbjct: 444 VLISRRRALRGSPIKVRYRLGWFVNIASILWLVFTMVVICIPPQVPVTFSSMNYAFVVYL 503

Query: 518 GFWVLSLIYYFVWQRKFYKGP 538
            F     + YF W R  +K P
Sbjct: 504 LFLAAITVLYFRWGRYNFKTP 524

>SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 568

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 103/518 (19%), Positives = 204/518 (39%), Gaps = 33/518 (6%)

Query: 52  QVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLD-GGLSAGPVGLGWGWFXXX 109
           +V+ +  Y+++L +   S   + G+ F +M  +  +++T+  G L+ GP+ +  G+    
Sbjct: 41  EVVEQFQYEQKLDKSLLSRGSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIVAGFMVVG 100

Query: 110 XXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVY 169
                         S  P    ++      A ++ R   S+  G+L  L       SI +
Sbjct: 101 FATWLCSLSLGEIVSKFPIE--LHGGSAMLAAKKHRLVFSWYTGWLMLLGNWTMSTSITF 158

Query: 170 GLAQQILSAVLVSNPDFNATDPI---TYGVFAACIVCMAILTSLPSRITSKLQTISIISN 226
             AQ ++S + ++N      D +   T  VF A +  + ++    +R    +  + +   
Sbjct: 159 AGAQLVISLISLANDSLVPKDSVIFYTVVVFYAIVTVVGVVNLKFARFIETINKVCVYWI 218

Query: 227 CFLIVLFFIAIPIGVSRSDTLNRSFNGGDF-----IFGQVDNR-STWNKGWNWCIAGLMP 280
            + I+            +D L   F+ G++          DN  S +       + G   
Sbjct: 219 IYAIIF-----------TDILLLLFHTGEYRSLKYALAHFDNSLSGYRSAALSFMIGFQQ 267

Query: 281 AIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLD 340
           + +T+  +     +A+E ++  R +P G+  S+ +  + G LV ++ +  + PD  ++L+
Sbjct: 268 SNFTLQGFSMLPALADEVKEPERDIPRGMSLSVVLSALSG-LVFLLPIMLILPDTSAILN 326

Query: 341 SQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLM-GASTVVANSRQFWAFARDDGFPFSN 399
           +     +  I   +        FL + I+   L  G  ++  +SR  ++ +RD   P+  
Sbjct: 327 NDRVMPIVLIFTQSTHSIVVSFFLVLMILGNLLFSGIGSITTSSRAVYSMSRDHALPYHE 386

Query: 400 FFKKVD--GLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITL 457
            +  V+    + VP  ++               V   A  A    +V  +  A   P+ L
Sbjct: 387 LWTYVEPASQSRVPKYSILLTMAISYVLGLLALVSTAAFNAFVGAAVLCLCSATCIPVVL 446

Query: 458 RLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGP 517
            L   ++  R  P  +      ++N  SV +  F + ++  P    VT  TMNY   +  
Sbjct: 447 VLASRRRALRGSPIKVRYKLGWLVNLASVAWLVFTMFVISMPPQVPVTLVTMNYAAFVFA 506

Query: 518 GFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGDDV 555
            F V     YF W R  ++ P   L DE  +   G DV
Sbjct: 507 AFMVGITALYFCWGRHHFRAP---LVDENSKA--GGDV 539

>ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar to
           uniprot|Q0CZS0 Aspergillus terreus NIH2624 ATEG_00814
           Hypothetical protein
          Length = 535

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 108/489 (22%), Positives = 195/489 (39%), Gaps = 37/489 (7%)

Query: 85  SIASTLDGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRV 144
           +I ++L+ G   GP G+ + +                 +S++P +G VY     WA    
Sbjct: 63  AIVASLNNG---GPPGIMYEFIAVSVFYWAIGASIAELASSVPASGGVY----HWAAMTP 115

Query: 145 RK----CISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAAC 200
            K       +  G+ D L+ +  + S    +A  I+ +  + +PD   T+   + V+   
Sbjct: 116 GKKWGPICGWFAGWFDFLAWNFGIASNANMVASMIVYSYGLFHPD---TELQRWHVY--- 169

Query: 201 IVCMAILTSLPSRITS----KLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDF 256
            +C  ILT L   +       L TI+ I +  ++  +F+ + +      T  +     DF
Sbjct: 170 -ICFLILTWLCCFVVMFADWALPTINRIGSFLILGGWFVTVVVCAVMPSTTGKGHASNDF 228

Query: 257 IFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVC 316
           ++ +  N + ++      + G++   +++G  D   H+AEE  DA R +P  +   I V 
Sbjct: 229 VWSKWQNNTGYSSDGFAFLLGMLNGAFSVGTPDCITHLAEEIPDAGRNLPKVLFWQILVG 288

Query: 317 WILGWLVCIVILACMN--PDI-DSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFL 373
           +I      I +   +N  P I  S   S  G+   Q      G    L  + + IIC  +
Sbjct: 289 FITAITYMIAMFYAINNLPIIFSSNTFSPLGEIYLQATNSRGGAIGLLLIIYLPIICAIV 348

Query: 374 MGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGE 433
                 +   R  +  ARD+  PFS +   +      P  A +                 
Sbjct: 349 ---GCYITAGRTLYVLARDNATPFSKYLGAIHPRYKSPFWATFACGVLCTCLGAIYVGSA 405

Query: 434 TA----SGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQ 489
           TA     G+   L+ A  ++A++      L   +     G F +G F    +N IS  + 
Sbjct: 406 TAFNAFVGSFVLLTTAAFFLAML----PNLLTKRSKLPLGSFNMGKF-GYAVNIISCLYI 460

Query: 490 AFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQE 549
               ++  FP     T   MNYT V+  G  ++  I++ V  RK YKGP  ++ +++   
Sbjct: 461 LVFFVIYCFPYSLPATAENMNYTSVMVSGLTLMVAIWWMVHGRKNYKGPTFDMVEKDNCS 520

Query: 550 YVGDDVIDA 558
            + DD + A
Sbjct: 521 VLTDDYLVA 529

>TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.173
           YKL174C
          Length = 647

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 107/522 (20%), Positives = 216/522 (41%), Gaps = 33/522 (6%)

Query: 59  YKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGLS-AGPVGLGWGWFXXXXXXXXXX 116
           Y+++L +   S   I G+ F +M  +  + +++  GL   GP+ +  G+           
Sbjct: 54  YEQQLDKSLLSKSSIVGLGFGLMSPVLGMCTSMSIGLKDGGPLTILIGFMVSGIFTWFCS 113

Query: 117 XXXXXXSSAMPTA---GAVYVSCY---QWAPQRVRKCISYSVGFLDTLSLSASVCSIVYG 170
                  S  P      +  +S Y        ++R   S+  G+L  +       SI + 
Sbjct: 114 LSLGEVVSKYPNELHISSAMLSSYLTDNTLDSKLRYIASWYTGWLMLIGNWTMSTSITFA 173

Query: 171 LAQQILSAVLVSNPDF-NATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFL 229
            AQ  +S +L+   D  + T  I + V    +V + I+  +  + +  ++TI+ I  C +
Sbjct: 174 GAQLTISLLLLMKSDLISETHLILFTVIVFYLV-VTIVGFINLKFSRFIETINKI--C-V 229

Query: 230 IVLFFIAIPIGVSRSDTLNRSFNGGDF------IFGQVDNRSTWNKGWNWCIAGLMPAIW 283
           I +F+  I I     D L   F  G F      +F   ++ S +   +   I G   + +
Sbjct: 230 IWIFYAIIFI-----DVLLLVFQAGKFRSLKYALFHFDNSLSGYTSAFLSFIIGFQQSNF 284

Query: 284 TIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQF 343
           T+  +     +A+E +   R +P G+  ++ +    G +  + I+  + PD+D++ +++ 
Sbjct: 285 TLQGFSMLPALADEVKRPERDIPRGMSTAVLLSTFSGVVFLLPIMLIL-PDLDNIFNNKN 343

Query: 344 GQAM--TQIIYDALGKRWTLGFLSIFIICQFLM-GASTVVANSRQFWAFARDDGFPFSNF 400
              +    I   +   ++   FL   I+   L  G  ++  +SR  ++F+RD   P+   
Sbjct: 344 SNLLPIVSIFTQSTHSKFVSVFLVFCILGNLLFSGIGSITTSSRAVYSFSRDHALPYHEL 403

Query: 401 --FKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLR 458
             F   D ++ VP  ++W                  A  A    +V  +  A + P+ L 
Sbjct: 404 WTFVDSDSVSKVPKYSIWLSMGVSYTLGLLALFSTAAFNAFVGAAVLCLCTATVIPLILV 463

Query: 459 LTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPG 518
           L  G++  R  P  +      I+N +SV +    ++ + FP    VT +TMNY +++   
Sbjct: 464 LISGRRSIRNAPVKMKYKLGWIVNILSVAWLLLAMVSVCFPPQIPVTFSTMNYALMVYIF 523

Query: 519 FWVLSLIYYFVWQRKFYKGP---KSNLTDEEFQEYVGDDVID 557
             ++  + YF W +  +  P   K++LT       +   ++D
Sbjct: 524 CLIIITVLYFQWGKNNFVLPHPMKTSLTSNPSTYAMSKSLVD 565

>KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 560

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 108/550 (19%), Positives = 227/550 (41%), Gaps = 30/550 (5%)

Query: 6   SNKGTIK--NRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQV---LAELGYK 60
           + KG +   + ++ +  E+ +   L  +      P R +   +   DQ +   + E  Y 
Sbjct: 20  NKKGELTKGSHRAELHFEMPEYIWLSNLNGNIHIPERLLSLLNE-EDQDIPDEVKEFTYV 78

Query: 61  EEL-KREFSSIQIFGVAFSIMGLLPSIASTLD-GGLSAGPVGLGWGWFXXXXXXXXXXXX 118
           ++L K   S   + G+ F +M  +  +++T+  G L+ G   + +G+             
Sbjct: 79  QQLDKNLLSRTSVIGLGFGLMSPVLGMSTTMSIGLLNGGSPSIIFGYLICGIMTWISSLS 138

Query: 119 XXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSA 178
                S  P    ++ +    AP R+R  +S+  G+L          SI +  AQ I+S 
Sbjct: 139 LSEIVSKYPIE--LHGAAAMLAPGRLRLRMSWYCGWLMLFGSWTMSTSITFAGAQLIISL 196

Query: 179 VLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIP 238
           + ++N     +  +T        + + ++  +  + +S ++TI+ +  C   +L+ I   
Sbjct: 197 LTMTNESLIDSRWLTLWTVLMFYLIVTVVGVINLKFSSFIETINKV--CVYWILYAILFT 254

Query: 239 IGVSRSDTLN-RSFNGGDFIFGQVDNRSTW--NKGWNWCIAGLMPAIWTIGAYDSCLHMA 295
             +      N RSF     +F + DN  +   +   ++ I G   + +T   +     ++
Sbjct: 255 STLLLLFQPNHRSFKD---VFTKFDNSLSGYSSMALSFLIGGFQQSNFTFQGFAMLSALS 311

Query: 296 EEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDAL 355
           +E     + +P+ +  S+ +  + G    I ++  + PD+  V++ + G     +I+   
Sbjct: 312 DETEKPEKDIPYSMTRSVIISLVSGLFFLIPMMLIL-PDVSEVMNHE-GVMPIVLIFTKS 369

Query: 356 GKRWTLGFLSIFIICQFLM-----GASTVVANSRQFWAFARDDGFPFSNFFKKVD--GLT 408
            K     F+SIF++   L      G  +V  +SR  ++ +RD G P+ + +  VD    +
Sbjct: 370 TKSL---FVSIFLVLLILGNLLFSGIGSVTTSSRALYSLSRDRGIPYHHLWTYVDPASES 426

Query: 409 GVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRP 468
            VP  +V               +   A  A    +V  +  A + PI L L + +K  + 
Sbjct: 427 KVPKYSVMLSMGVSYVLALLALISTAAFNAFVGCAVLCLCSASMLPILLSLYHRRKLVKG 486

Query: 469 GPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYF 528
             F +      I N ++V +  F ++++  P    VT  +MNY+ V+   F ++  + Y 
Sbjct: 487 SAFRIKYRLGYITNCLTVIWLLFTMVIISLPQKVPVTFRSMNYSSVVYFLFMIMVTVLYD 546

Query: 529 VWQRKFYKGP 538
            W    ++ P
Sbjct: 547 RWGIYNFRAP 556

>NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON}
           Anc_1.173
          Length = 612

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 103/519 (19%), Positives = 205/519 (39%), Gaps = 31/519 (5%)

Query: 42  VDARSATSDQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPV 99
           +   S T + + +    Y +EL +   S   + G+ F +M  +  +++++  GL + GP 
Sbjct: 31  IHEESDTDEVESVEHFKYNQELDKSLLSRSSVVGLGFGLMSPVLGMSTSMAIGLINGGPA 90

Query: 100 GLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLS 159
            + WG+                  S  P    ++VS    AP+  +   S+  G+L  L 
Sbjct: 91  TILWGFIISGICIWFCSLSLGEVVSKFPME--LHVSSAMLAPKDAKLICSWYTGWLMLLG 148

Query: 160 LSASVCSIVYGLAQQILSAVLVSNPDFNATDPI---TYGVFAACIVCMAILTSLPSRITS 216
                 SI +  AQ  +S +L++  D  A   +   T  +F   +  + ++    +R   
Sbjct: 149 NWTMSTSITFAGAQLTISLILMAKSDLIAEKYMIGFTVIIFYLVVTLVGLINLKFARFIE 208

Query: 217 KLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDF------IFGQVDNRSTWNKG 270
            +  +     C + +++ I +       D L   F+ G +      +F   ++ S ++  
Sbjct: 209 TINKV-----CVVWIIYAICV------IDILLLIFHQGKYRSLKFALFNFDNSLSGYSNF 257

Query: 271 WNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILAC 330
           +   I G   + +T+  +     +A+E +   + +P G+  ++ +    G +  I I+  
Sbjct: 258 FVSFIIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVLLSTFSGIIFLIPIMII 317

Query: 331 MNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAF 389
           + PD D +  +     +  I   +   +    FL + I+   F  G  ++  +SR  ++F
Sbjct: 318 L-PDSDKLFSNNQMLPIVNIFTQSTHSKIVSLFLVLSILGNLFFSGIGSITTSSRAVYSF 376

Query: 390 ARDDGFPFSNF--FKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGM 447
           +RD   P      F K +  + VP  ++                   A  A    +V  +
Sbjct: 377 SRDHAIPHHELWTFVKPESQSKVPKNSILLSMAISYFLGILALFSTAAFNAFIGAAVLCL 436

Query: 448 YMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPT 507
             A   P+ L L   ++  R  P  +       +N IS+ +    +I + FP    VT  
Sbjct: 437 CSATCIPLVLVLFRRRRIIRSAPVKIRYKLGWAVNIISIVWLILSMISVCFPPKIPVTWG 496

Query: 508 TMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEE 546
           TMNY +++   F +   I Y  W +  +K P   L DE+
Sbjct: 497 TMNYALIVYVIFLIAITIMYLKWGKYNFKLP---LIDED 532

>Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa]
           {ON} complement(159457..161325) [1869 nt, 623 aa]
          Length = 622

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 112/548 (20%), Positives = 217/548 (39%), Gaps = 32/548 (5%)

Query: 41  FVDARSATSDQ-----QVLAELGYKEELKREFSSIQI-----FGVAFSIMGLLPSIASTL 90
           F +  +A  D+     +V+ +  Y++EL +   S+       FG+   ++G+  S++  L
Sbjct: 24  FENLHTALHDEGNDQVEVVEQFKYEQELDKSLLSLSSVVGLGFGLMSPVLGMCTSMSIGL 83

Query: 91  DGGLSAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISY 150
             G   GP+ +  G+                  S  P    ++ S    AP  ++   S+
Sbjct: 84  KNG---GPLTIIMGFLLSGISIWFCSLSLGEVVSKFPME--LHGSSALLAPDSLKLICSW 138

Query: 151 SVGFLDTLSLSASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSL 210
             G+L  +       SI Y  AQ  +S +L++N D  +   +   +F   IV   ++T +
Sbjct: 139 YTGWLMLIGNWTMSTSITYAGAQLTISLILMNNSDLISEANL---IFFTVIVFYMVVTIV 195

Query: 211 PSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNR-STWNK 269
                   + I II+   ++ + +  I I +      +  F    +     DN  S +  
Sbjct: 196 GLVNLKFSRFIEIINKICVLWIIYAIIFIDILLLIFHSGKFRSLKYALFHFDNHLSGYGS 255

Query: 270 GWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILA 329
           G    I G   + +T+  +     ++EE +     +P G+  ++ +  + G     VI  
Sbjct: 256 GVLSFIIGFQQSNFTLQGFSMLPALSEEVKRPENDIPRGMSNAVLLSTLSG-----VIFL 310

Query: 330 CMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQ-----FLMGASTVVANSR 384
                I   +D+ F       I +   K      +SIF++       F  G  ++  +SR
Sbjct: 311 IPILIILPDIDTLFTGHKILPIVNIFTKSTNSTVVSIFLVLMILGNLFFSGIGSITTSSR 370

Query: 385 QFWAFARDDGFPFSNFFKKVD--GLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSL 442
             ++F+RD G P+ N +  VD   ++ VP  ++W                  A  A    
Sbjct: 371 SVYSFSRDRGIPYHNLWTYVDPSSVSKVPKYSIWLSMAISYFLGLLALFSTAAFNAFIGA 430

Query: 443 SVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDS 502
           +V  +  A + P+ L L   ++  R  P  +      I+N ISV +    ++ + FP   
Sbjct: 431 AVLCLCSATVIPLILVLFSRRRVIRNAPVKMKYKLGWIVNIISVLWLLLSMVSVCFPPQI 490

Query: 503 TVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQ-EYVGDDVIDAIMS 561
            VT  TMNY +++     +   + YF W +  ++ P  +  ++  + +    +   A+  
Sbjct: 491 PVTFQTMNYALIVYIFCLISITVLYFKWGKYNFQLPSVDEMNKPRKLKNESINTTTAVNG 550

Query: 562 NNEADYKP 569
           NN + Y P
Sbjct: 551 NNVSGYVP 558

>Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar to
           Ashbya gossypii AEL125C
          Length = 583

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 118/549 (21%), Positives = 217/549 (39%), Gaps = 43/549 (7%)

Query: 50  DQQVLAE-LGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWF 106
           D  VL E   Y++ L +   S   + G+ F +M  +  ++++L  GL + GP+ +   + 
Sbjct: 37  DDTVLVEHFQYEQRLDKSLLSKYSVIGLGFGLMSPVLGMSTSLSTGLVNGGPLTILGAFI 96

Query: 107 XXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCS 166
                            S  P    ++ S    AP   R   +Y  G+L  L       S
Sbjct: 97  ICGFMNWLTSLSIGEVVSKYPIE--LHGSVAMLAPDNYRLVTAYFTGWLMLLGNCVMNAS 154

Query: 167 IVYGLAQQILSAVLVSNPDFNATDPI---TYGVFAACIVCMAILTSLPSRITSKLQTISI 223
           I Y  A+ I+S V +S     + D +   T  V+  CI    I+ S  +R    + T+  
Sbjct: 155 IQYAGARLIISLVTISGDSLISEDNLIIWTVLVYFLCITITGIINSNFARYLEIINTV-- 212

Query: 224 ISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDF-----IFGQVDNR-STWNKG-WNWCIA 276
              C   +L+ +A        D L   F+ G F      F   DN+ S ++    ++ + 
Sbjct: 213 ---CIYWILYAVAF------IDILLLMFHYGSFRPFLYAFFHFDNKLSGYSSAVLSFMVG 263

Query: 277 GLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDID 336
           G   + +T+  +     +++E R+  + +P G+  S+ V  I G +  I IL  + P+ +
Sbjct: 264 GFQQSNFTLQGFSLLPALSDETREPEKDIPKGMSQSVLVSTICGIIYLIPILLVI-PEPE 322

Query: 337 SVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLM-GASTVVANSRQFWAFARDDGF 395
            +++      +  I   +   +    F  + I+   L  G  ++  +SR  ++ +RD G 
Sbjct: 323 EIMNDSRVMEIVLIFTKSTRSKIVSYFQVLLILGNLLFSGIGSITTSSRAVYSMSRDHGL 382

Query: 396 PFSNFFKKV--DGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIF 453
           P+S+ +  V  D  + VP  AV+              +   A  +    SV  +  A   
Sbjct: 383 PYSDLWSYVSPDSQSQVPRYAVYLSMGISYIFGLLPFISGNAYNSFIGASVLCLCSASSI 442

Query: 454 PITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTV 513
            I   +  G++  +     +       ++   + +   V+  M  P    VT  TMNYT 
Sbjct: 443 AIICVMLTGRRGIKGAGVKIRYRLGWPVDVFVLLWLGLVMFCMCMPVTVPVTINTMNYTF 502

Query: 514 VIGPGFWV-LSLIYYFVWQRKFYKGPK----SNLTDEEFQ-----EYVG--DDVIDAIMS 561
           +I   F V +S +Y F W +  +  P+     NL  ++         +G   D+ D   S
Sbjct: 503 LIFLVFLVGISGLYNF-WGKYNFSIPELSENYNLESQQLSFRPQASKIGTSSDMDDTFTS 561

Query: 562 NNEADYKPG 570
           N+ +   P 
Sbjct: 562 NDSSTAPPN 570

>TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {ON}
           Anc_1.173 YKL174C
          Length = 593

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 98/528 (18%), Positives = 210/528 (39%), Gaps = 21/528 (3%)

Query: 34  AHGAPIRFVD------ARSATSDQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSI 86
           AH AP   +D        ++T   +V+    Y+++L +   S   + G+ F +M  +  +
Sbjct: 17  AHLAPNEILDNLHTIIHENSTDVPEVVEHFEYEQQLDKSLLSRSSVVGLGFGLMSPVLGM 76

Query: 87  ASTLDGGL-SAGPVGLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVR 145
            +++  GL + GP  + +G+                  S  P    ++ +    AP+ ++
Sbjct: 77  CTSMGIGLVNGGPFTIMFGFPICGFFSFLCASSLGEVVSKYPIE--LHGASAMIAPKSIK 134

Query: 146 KCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMA 205
              S+  G+L  L        + +  AQ I+S V + + D  A   +  G++   +    
Sbjct: 135 PMCSWFTGWLMLLGNWFMSIGVTFAGAQLIISLVNIGDRDVIADGRL--GIYTVLVYYGV 192

Query: 206 ILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNR- 264
           +       +       +I   C   +++ +   I V       + F    +     DN  
Sbjct: 193 VTVVGVVNLKYARYVEAINKVCIYWIIYAVLF-IDVLLLLFHRQKFRSLPYALFHFDNTL 251

Query: 265 STWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVC 324
           S ++  +   I G   + +T+  +     +A+E +   + +P G+  ++ +  ++G +  
Sbjct: 252 SGYSSAFLSFIIGFQQSNFTLQGFSMLPALADEVQVPEKDIPRGMSSAVLISTLIGMIFL 311

Query: 325 IVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANS 383
           + I+  + PD+D + ++     +  +   +   ++   FL + I+   F  G  ++  +S
Sbjct: 312 LPIMLIL-PDVDGLFENTKVLPIVDVFTHSTNSKFVSVFLILLILGNLFFSGIGSITTSS 370

Query: 384 RQFWAFARDDGFPFSNFFKKVD--GLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFS 441
           R  ++F+RD   P    +  VD    + VP  ++                   A  A   
Sbjct: 371 RAVYSFSRDCAIPNHQLWTYVDPTSESKVPKYSILLSMGVSYILGLLPLFSTAAFNAFIG 430

Query: 442 LSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSD 501
            +V  +  A + P+ L L   ++  R  P  +      I N  SV +    ++ +  P  
Sbjct: 431 CAVLCLCSATLIPLVLVLLTRRRILRDAPVKIKYKLGWIANVGSVIWLPLSMVSVCMPPQ 490

Query: 502 STVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQE 549
             VTP TMNY +V+    +   ++ YF W +  +K P   L D++ ++
Sbjct: 491 IPVTPKTMNYALVVFIACFAGIIVLYFKWGKYNFKLP---LVDKQIED 535

>KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {ON}
           Anc_1.173 YKL174C
          Length = 714

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 109/533 (20%), Positives = 214/533 (40%), Gaps = 39/533 (7%)

Query: 42  VDARSATSDQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPV 99
           +   S  ++ +++    Y++EL +   S   I G+ F +M  +  + +++  GL + GP 
Sbjct: 28  IHEDSDENEPEIVEHFKYEQELDKSLLSRSSIVGLGFGLMSPVLGMCTSMAIGLINGGPA 87

Query: 100 GLGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLS 159
            + WG+                  S  P    ++V     AP  ++   S+  G+L  + 
Sbjct: 88  TIMWGFLISGICIWFCSLSLGEIVSKFPME--IHVGSAMLAPASLKLISSWYTGWLMLIG 145

Query: 160 LSASVCSIVYGLAQQILSAVLVSNPDFNATDP--ITYGVFAACIVCMAILTSLPSRITSK 217
                 SI +  AQ  +S +L++N D    DP  + Y V    +V + I+  +  +    
Sbjct: 146 NWTMSTSITFAGAQLTISLILMNNNDL-IKDPHLVLYTVIVFYLV-VTIVGLINLKFARF 203

Query: 218 LQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDF-----IFGQVDN-RSTWNKGW 271
           ++TI+ +  C   +L+       V   D L   F+ G +          DN RS +    
Sbjct: 204 IETINKV--CVYWILY------AVIFIDILLLIFHKGKYRSLKYALTHFDNSRSGYGNFV 255

Query: 272 NWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACM 331
              I G   + +T+  +     +A+E R   + +P G+  ++ +    G +  + I+  +
Sbjct: 256 ISFIIGFQQSNFTLQGFSMLPALADEVRVPEKDIPRGMSNAVLLSAFSGIISLLPIMIIL 315

Query: 332 NPDIDSVL--DSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAF 389
            PD+D+ +  D +    +            +   + + +   F  G  ++ A+SR  ++F
Sbjct: 316 -PDMDTFIFYDGRVLPIVNIFTQSTDSVILSTLLVLLILGNLFFSGIGSITASSRSVYSF 374

Query: 390 ARDDGFPFSNF--FKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGM 447
           +RD   P  +   F K +  + VP  ++                   A  A    +V  +
Sbjct: 375 SRDHAIPGYDLWTFVKPESESKVPKNSILLSMLISYILGLLALFSTAAFNAFIGAAVLCL 434

Query: 448 YMALIFPITLRLTYGKKDFRPGP----FYLGDFWSPIINWISVFFQAFVIIMMMFPSDST 503
             A   P+ L L   ++  +  P    + LG  W   IN  S+ +    +  +  P+   
Sbjct: 435 CSATCIPLVLVLFRRRRILKSAPVKIRYKLG--WG--INIFSICWLLLSMFSVCLPTRIP 490

Query: 504 VTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEY-VGDDV 555
           VT  TMNY +V+     +   + YF W +  ++ PK+   D +  +Y +G DV
Sbjct: 491 VTFKTMNYALVVYVVCLISITVLYFFWGKSNFRLPKA---DGQVAKYEMGSDV 540

>ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} similar
           to uniprot|P36029 Saccharomyces cerevisiae YKL174C TPO5
           Protein involved in excretion of putrescine and
           spermidine putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 591

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 96/515 (18%), Positives = 207/515 (40%), Gaps = 25/515 (4%)

Query: 45  RSATSDQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLD-GGLSAGPVGLG 102
             A ++ ++     Y++EL +   S   + G+ F +M  +  + +++  G L+ GP  + 
Sbjct: 33  EEADNEPEIAEHFEYEQELDKSLLSRTSVIGLGFGLMSPVLGMCTSMGIGLLNGGPFTIM 92

Query: 103 WGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSA 162
           +G+                  S  P    ++ +    AP  +++  S+  G+   L    
Sbjct: 93  FGFQVCGVFSFLCACSLGEVVSKFPME--LHGASAILAPDYIKRISSWLTGWFLLLGNWF 150

Query: 163 SVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILT---SLPSRITSKLQ 219
               + +  AQ I+S + ++N D  +     Y V    ++  A++T    +  +    ++
Sbjct: 151 MSIGVTFAGAQLIISLIAMANFDLISEK---YLVLYTVLIYYAVVTIVGVVNLKYAKYVE 207

Query: 220 TISIISNCFLI--VLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNR-STWNKGWNWCIA 276
           TI+ +   ++I  VLF   + +   R+      F    +     DN  S +       I 
Sbjct: 208 TINKVCIYWIIYAVLFIDVLLLLFHRN-----KFRSLPYALFHFDNELSGYRSVIISFII 262

Query: 277 GLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDID 336
           G   + +T+  +     +A+E +   + +P G+  ++ +  ++G +    I+  + PD  
Sbjct: 263 GFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSSAVLISTVIGIIFLFPIMVIL-PDSR 321

Query: 337 SVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAFARDDGF 395
            +  +Q    +  I   +   ++   FL + I+   F  G  ++  +SR  ++F+RD   
Sbjct: 322 DLFSNQKVLPIVNIFKKSTDSQFVSIFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAI 381

Query: 396 PFSNFFKKVD--GLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIF 453
           P+   +  VD    + VP  ++                   A  A    +V  +  A + 
Sbjct: 382 PYYRLWTYVDPQSESRVPKYSILLSMSISYILGLLPLFSNAAFNAFIGCAVLCLCSATLI 441

Query: 454 PITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTV 513
           P+ L L   ++  +  P  +      I N  SV +    +  +  P    VT  TMNY +
Sbjct: 442 PLLLVLVTRRRVLKNAPVKIKYKLGWIANIGSVCWLLLSMFSVCLPPQIPVTAKTMNYAL 501

Query: 514 VIGPGFWVLSLIYYFVWQRKFYKGP---KSNLTDE 545
           ++    + +  I Y+ W RK ++ P   K+++ +E
Sbjct: 502 LVFLFCFFIICILYYKWGRKHFQLPQVDKASIAEE 536

>SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 560

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 125/307 (40%), Gaps = 42/307 (13%)

Query: 257 IFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRA--VPFGIVGSIT 314
           IF +  N + W+      I GL+  +W     DS  HM +E   +     VP  I+G++ 
Sbjct: 261 IFSEFSNTTGWSSSGMAFIVGLINPLWAFAGIDSATHMVDEVGHSTSRTLVPRAIIGTVL 320

Query: 315 VCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIIC---- 370
           + ++  +   I +  C+  D  SV++S     + QI Y A G R     LSIF+ C    
Sbjct: 321 LGFVTSFTYSIGMFYCIT-DTKSVVESIL--PILQIYYQATGNR----NLSIFLQCCCIT 373

Query: 371 -QFLMGASTVVANSRQFWAFAR-----DDGFP------FSNFFKKVDGLTGVPVRAVWXX 418
              + G ++    SR  W+ +R     D   P      F   F  V+ L  VP+ +    
Sbjct: 374 SGVVCGIASGTWQSRILWSISRDFENIDTNKPRPVFRYFCKRFGHVNSLLKVPLTSHLFS 433

Query: 419 XXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRL-TYGKKDF--RPGP----- 470
                          TA  A+ +  +  + ++   P T+ L   GK+ F  R G      
Sbjct: 434 QVIVAIIGCIFMGSTTAFNAIITACITLLLLSYAIPCTILLVVVGKRQFYRRIGQELDEL 493

Query: 471 -------FYLGDFW-SPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNY-TVVIGPGFWV 521
                  F+  + W   I N  ++ +  F +I + FP    V+   MNY +VV G    V
Sbjct: 494 KLSTSSIFHSKNVWFGYIANGFTIAWALFCLIFLSFPYTLPVSAGNMNYVSVVYGAIALV 553

Query: 522 LSLIYYF 528
           +S+I YF
Sbjct: 554 ISVIVYF 560

>Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346)
           [1671 bp, 556 aa] {ON} ANNOTATED BY YGOB -
          Length = 556

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 119/308 (38%), Gaps = 44/308 (14%)

Query: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEA-- 298
           VSRS+  + S+     IFGQ  N + W+      + GL+  +W     DS  HM +E   
Sbjct: 246 VSRSNYSDISWPKSSDIFGQFRNTTGWSSSGMAFVVGLINPLWAFAGIDSATHMVDEVGY 305

Query: 299 RDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKR 358
           + +   VP  I+ +I + ++  +   I +  C+  D + V +S     + +I Y A G R
Sbjct: 306 KASTTLVPQAILSTIIIGFLTSFTYAIGMFFCVT-DTEKVTESIL--PILEIYYQATGNR 362

Query: 359 WTLGFLSIFIICQFLM-----GASTVVANSRQFWAFARDDGFPFSN-------------F 400
                LS+ + C  ++     G ++V   SR  W+  +D    FS              F
Sbjct: 363 ----NLSVLMQCCCILTGALCGIASVTWQSRILWSLGKD----FSQVTTTRPVCKKTMGF 414

Query: 401 FKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLT 460
           F  V+     P+ A                   TA  A+ S  +  + +    P  + L 
Sbjct: 415 FGTVNSKLRAPLNAHLFSQLCVAIIGCIFMGSSTAFNAIISACITLLLLTYAVPCLIVLL 474

Query: 461 YGKKDFRP-------------GPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPT 507
            GK++F               G   +      I N +++ +  F +I + FP    V+  
Sbjct: 475 IGKREFYERAKSKLNVLGVNLGRVPVCSKIGQIPNVLTILWALFCLIFLSFPYSLPVSAN 534

Query: 508 TMNYTVVI 515
            MNY  V+
Sbjct: 535 NMNYVTVV 542

>KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {ON}
           Anc_1.173 YKL174C
          Length = 607

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 105/526 (19%), Positives = 205/526 (38%), Gaps = 27/526 (5%)

Query: 43  DARSATSDQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVG 100
           D  S  SD   +    Y++EL +   S   + G+ F +M  +  + +++  GL + GP+ 
Sbjct: 33  DEDSVNSD--TVEHFKYEQELDKSLLSRSSVIGLGFGLMSPVLGMCTSMSIGLINGGPLT 90

Query: 101 LGWGWFXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSL 160
           +  G+                  S  P    ++V+    AP++ +   S+  G+L  +  
Sbjct: 91  IMLGFILSGISIWFCSLSLGEIISKFPME--MHVASAMLAPKKFKLLCSWYTGWLMLIGN 148

Query: 161 SASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQT 220
                SI +  AQ  +S  L+ +    + +   + +F   IV   ++T +        + 
Sbjct: 149 WTMSTSITFAGAQLTISLFLMKDQYLISEE---HFIFYTVIVFYLVVTVVGLINLKFARF 205

Query: 221 ISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDN-RSTWNKGWNWCIAGLM 279
           I II+   +  + +  I I +        ++    +     DN RS ++      I G  
Sbjct: 206 IEIINKVCVYWIIYAIIFIDILLLIFHKGTYRSLKYALFHFDNSRSGYSNVLISFIIGFQ 265

Query: 280 PAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVL 339
            + +T+  +     +A+E +   R +P G+  S+ +    G +  + I+  + PD+ ++ 
Sbjct: 266 QSNFTLQGFSMLPALADEVKKPERDIPRGMSISVLISTFSGIIFLLPIMIIL-PDLSTIF 324

Query: 340 DSQFGQAMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAFARDDGFPFS 398
                  +  I   +        FL + I+   F  G  ++ A+SR  ++F+RD   P+ 
Sbjct: 325 TDHKVLPIVNIFIQSTDSMIVSFFLVLLILGNLFFSGIGSITASSRTVYSFSRDQAIPYY 384

Query: 399 N--FFKKVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPIT 456
           +   F K +  + VP  +V                   A  A    +V  +  A   P+ 
Sbjct: 385 DHWIFVKPESESKVPKNSVLLSMAISYVLGILALFSTAAFNAFIGAAVLCLCSATCIPLI 444

Query: 457 LRLTYGKKDFRPGP----FYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYT 512
           L L   ++  +  P    + LG  W   IN IS+ +    +  +  P    VT  TMNY 
Sbjct: 445 LILFGRRRILKNAPIKIRYKLG--WG--INIISILWLLLSMFSVCLPVQIPVTFQTMNYA 500

Query: 513 VVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGDDVIDA 558
           +++     +     Y  W ++ +K P +     E Q  + D   DA
Sbjct: 501 LMVYVFCLICVTFLYVKWGKRNFKLPLA-----EHQYDLLDSTTDA 541

>NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {ON}
           Anc_1.173 YKL174C
          Length = 641

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 95/504 (18%), Positives = 200/504 (39%), Gaps = 21/504 (4%)

Query: 52  QVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFXXX 109
           +V+    Y +EL +   S   I G+ FS+M     +++++  GL + GP  + WG+    
Sbjct: 41  EVVEHFKYNQELDKSLLSRGSIVGLGFSLMSAPLGMSTSMAIGLINGGPATIIWGFLISG 100

Query: 110 XXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVY 169
                         S  P    ++VS    AP++++   S+  G+L  L       SI +
Sbjct: 101 ICIWFCSLSLGEVVSKFPME--LHVSSAMLAPKKLKLICSWYTGWLMLLGNWTMSTSITF 158

Query: 170 GLAQQILSAVLVSNPDFNATDPI---TYGVFAACIVCMAILTSLPSRITSKLQTISIISN 226
             AQ  +S +L++N D  +   +   T  +F   +  + ++    +R       I  I+ 
Sbjct: 159 AGAQLTISLILMTNSDLISEKYLIGFTVIIFYLVVTIVGLINLKFARF------IETINR 212

Query: 227 CFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWC-IAGLMPAIWTI 285
             +I + +  + I +         ++   +     DN  +   G+    + G   + +T+
Sbjct: 213 ACVIWIIYAILFIDILLLIFHRGKYHSLKYSLFHFDNSLSGYSGFLISFLIGFQQSNFTL 272

Query: 286 GAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQ 345
             +     +A+E +   + +P G+  ++ +    G +  I I+  + P+ D +  +    
Sbjct: 273 QGFSMLPALADEVKVPEKDIPRGMSNAVLLSAFSGIVFLIPIMIIL-PESDKLFTNHKIL 331

Query: 346 AMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAFARDDGFPFSN--FFK 402
            +  I   +    +   FL + I+   F  G  ++  +SR  ++F+RD   P      F 
Sbjct: 332 PIVNIFTQSTHSMFVSFFLLLMILGNLFFSGIGSITTSSRAVYSFSRDHAIPHHETWTFV 391

Query: 403 KVDGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYG 462
           + +  + VP  ++                   A  A    +V  +  A   P+ L L   
Sbjct: 392 QPESQSKVPKNSILLSMAISYILGLLALFSTAAFNAFIGAAVLCLCSATCIPLVLVLFRR 451

Query: 463 KKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVL 522
           ++  R  P  +       +N +S+ +    ++ +  P    VT  +MNY +++     ++
Sbjct: 452 RRVLRNAPVKIRYKLGWFVNIVSILWLLLSMVSVCLPPKIPVTLESMNYALIVYLLCIII 511

Query: 523 SLIYYFVWQRKFYKGPKSNLTDEE 546
             + YF W +  +K P   L +EE
Sbjct: 512 ITLMYFKWGKDNFKLP---LIEEE 532

>YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON}
           BIO5Putative transmembrane protein involved in the
           biotin biosynthesis pathway; responsible for uptake of
           7-keto 8-aminopelargonic acid; BIO5 is in a cluster of 3
           genes (BIO3, BIO4, and BIO5) that mediate biotin
           synthesis
          Length = 561

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 79/318 (24%), Positives = 130/318 (40%), Gaps = 43/318 (13%)

Query: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEA-- 298
           VSRSD     +     IFG  DN++ WN      + GL+  IW     DS  HM +E   
Sbjct: 252 VSRSDNTVDPWPKASNIFGSFDNQTGWNSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGY 311

Query: 299 RDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKR 358
             +   VP  I+ +I V ++  ++ C+ +  C+  D  +V++S     + +I Y A G R
Sbjct: 312 SKSRFLVPKVIITTIIVGFVTSFIYCVGLFFCIT-DQTAVVESIL--PIVEIFYQATGNR 368

Query: 359 WTLGFLSIFIICQ-----FLMGASTVVANSRQFWAFARDDGFPF-------SNFFKKVDG 406
                LS+F+ C      F+ G ++    SR   +F +    PF       +   KK+  
Sbjct: 369 N----LSVFLQCMCITTGFVSGIASGTWQSRILQSFGKSYA-PFYKEGSLGNKSLKKLAV 423

Query: 407 LT---GVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGK 463
           LT     P+ A +                 TA  A+ +  +  + M+   P  + L   K
Sbjct: 424 LTPGFKSPLYAHFLSQICVTIIGCIFMGSSTAFNAIITACITLLLMSYAVPSFIFLFVIK 483

Query: 464 KD-------------FRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMN 510
           K+              RP    +    S I + I + +  F ++ + FP    VT   MN
Sbjct: 484 KEKFIHRIESDVNCVSRPNRRRM----SMIPHIICILWTLFCLVFLSFPYTLPVTAGNMN 539

Query: 511 YT-VVIGPGFWVLSLIYY 527
           YT VV    F ++S++ +
Sbjct: 540 YTSVVYAVVFCIISIVVF 557

>Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {ON}
           YNR056C (REAL)
          Length = 532

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 132/322 (40%), Gaps = 41/322 (12%)

Query: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEA-- 298
           VSRS+    S+     IFG  DN++ W+      + GL+  IW     DS  HM +E   
Sbjct: 222 VSRSNNTVDSWPKASNIFGNFDNQTGWHSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGY 281

Query: 299 RDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKR 358
             +   VP  I+ +I V +I  ++ C+ +  C+  D  +V++S     + +I Y A G R
Sbjct: 282 SKSRFLVPKVIITTIVVGFITSFIYCVGLFFCIT-DKTAVVESIL--PIVEIFYQATGNR 338

Query: 359 WTLGFLSIFIICQ-----FLMGASTVVANSRQFWAFAR------DDGFPFSNFFKKVDGL 407
                LS+F+ C      ++ G ++    SR   ++ +       +G   +   KK+  L
Sbjct: 339 ----NLSVFLQCMCITTGYVAGIASGTWQSRILQSYGKSYAPFYKEGSLGNKSLKKLATL 394

Query: 408 T---GVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFP-ITLRLTYGK 463
           T     P+ A +                 TA  A+ +  +  + M+   P         K
Sbjct: 395 TPGFKSPLYAHFLSQICVTIIGCIFMGSSTAFNAIITACITLLLMSYAVPSFIFVFVVNK 454

Query: 464 KDF------------RPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNY 511
           ++F            RP    +    S I + I + +  F +I + FP    VT   MNY
Sbjct: 455 ENFTSRIENEVNGISRPKTRRM----SIIPHIICILWTLFCLIFLSFPYTLPVTAGNMNY 510

Query: 512 T-VVIGPGFWVLSLIYYFVWQR 532
           T VV    F +++++ +   +R
Sbjct: 511 TSVVYAVVFCIITIVVFPACRR 532

>Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {ON}
           YNR056C (REAL)
          Length = 531

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 98/408 (24%), Positives = 161/408 (39%), Gaps = 53/408 (12%)

Query: 142 QRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACI 201
            +V++  S  VG L+      +  SI   L+   +    + +PD+       + +F    
Sbjct: 126 SKVQRVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHPDYELKH---WHIFVGYQ 182

Query: 202 VCMAILTSLPSRITSKLQTIS----IISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFI 257
              AILT L +  +S L  IS      S     + F I I   VSRS+    ++     I
Sbjct: 183 CINAILT-LFNIYSSPLPYISQFGLYTSLLSFAMTFIICI---VSRSNNTIDAWPKASNI 238

Query: 258 FGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEA--RDAVRAVPFGIVGSITV 315
           FG  DN++ WN      + GL+  IW     DS  HM +E     +   VP  I+ +I V
Sbjct: 239 FGSFDNQTGWNSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIIV 298

Query: 316 CWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQ---- 371
            +I  ++ C+ +  C+  D  +V++S     + +I Y A G R     LS+F+ C     
Sbjct: 299 GFITSFIYCVGLFFCIT-DKTAVVESIL--PIVEIFYQATGNR----NLSVFLQCMCITT 351

Query: 372 -FLMGASTVVANSRQFWAFARDDGFPF-------SNFFKKVDGLT---GVPVRAVWXXXX 420
            F+ G ++    SR   +F +    PF       +   K++  LT     P+ A +    
Sbjct: 352 GFVAGIASGTWQSRILQSFGKSYA-PFYKEDSLGNKSLKRLAMLTPGFKSPLYAHFLSQI 410

Query: 421 XXXXXXXXXXVGETASGALFSLSVAGMYMALIFP-ITLRLTYGKKDF------------R 467
                        TA  A+ +  +  + M+   P         K+ F            R
Sbjct: 411 CVTVIGCIFMGSSTAFNAIITACITLLLMSYAVPSFIFVFVVDKEKFIHRIGNDVSCISR 470

Query: 468 PGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVI 515
           P    +    S I + I + +  F ++ + FP    VT   MNYT V+
Sbjct: 471 PNRRRM----SKIPHIICILWALFCLVFLSFPYTLPVTAGNMNYTSVV 514

>Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {ON}
           YNR056C (REAL)
          Length = 554

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 128/318 (40%), Gaps = 43/318 (13%)

Query: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEA-- 298
           VSRS+     +     IFG  DN++ WN      + GL+  +W     DS  HM +E   
Sbjct: 245 VSRSNNTVEKWPKASNIFGSFDNQTGWNSSGMAFVVGLVNPLWAFVGIDSATHMIDEVGY 304

Query: 299 RDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKR 358
             +   VP  I+ +I V ++  ++ C+ +  C+  D  +V++S     + +I Y A G R
Sbjct: 305 SRSRFLVPKVIITTIIVGFVTSFIYCVGLFFCIT-DKTAVVESIL--PIVEIFYQATGNR 361

Query: 359 WTLGFLSIFIICQ-----FLMGASTVVANSRQFWAFARDDGFPFSN-------FFKKVDG 406
                LS+F+ C      F+ G ++    SR   +F +    PF N         K++  
Sbjct: 362 N----LSVFLQCMCITTGFISGIASGTWQSRILQSFGKSYA-PFYNEGSLGNKSLKRLSI 416

Query: 407 LT---GVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFP-ITLRLTYG 462
           LT     P+ A +                 TA  A+ +  +  + M+   P         
Sbjct: 417 LTPKFKSPLYAHFLSQICVTIIGCIFMGSSTAFNAIITACITLLLMSYAVPSFIFVFVVN 476

Query: 463 KKDF------------RPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMN 510
           K+ F            RP    +    S + + I + +  F ++ + FP    VT   MN
Sbjct: 477 KEKFIYRIENDVNGISRPNRRRM----SMVPHIICILWTLFCLVFLSFPYTLPVTAGNMN 532

Query: 511 YT-VVIGPGFWVLSLIYY 527
           YT VV    F ++S++ +
Sbjct: 533 YTSVVYAVVFCIISIVVF 550

>AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL174C
          Length = 575

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 100/504 (19%), Positives = 203/504 (40%), Gaps = 27/504 (5%)

Query: 50  DQQVLAE-LGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWF 106
           D+ V  E   Y+++L R   S   + G+ F +M  +  +++TL  GL   GP  +   + 
Sbjct: 36  DEPVEVEHFQYEQKLDRTLLSRRSVIGLGFGLMSPVLGMSTTLGIGLVHGGPPTILGAFA 95

Query: 107 XXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCS 166
                            S  P    ++ S    AP+R R   +Y  G L  L       S
Sbjct: 96  LCGLMSWLTALAIGEVVSKYPIE--LHGSVALLAPERYRLVAAYYTGCLILLGNWVMNAS 153

Query: 167 IVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISN 226
           I Y  AQ I+S + +S  D  + + +     A   + + +   + ++  S L+ I+ +  
Sbjct: 154 IQYAGAQLIISLIAISG-DLVSEENLAIWTVAVYFLSITVTGVINAKFASFLEPINTV-- 210

Query: 227 CFLIVLFFIAIPIGVSRSDTLNRSFNGGDF-----IFGQVDNRSTWNKGW--NWCIAGLM 279
           C   +L+ +         D L   F+ G F      F   DNR +  +    ++ + GL 
Sbjct: 211 CIYWILYAVVF------IDVLLILFHKGSFRPFLSAFSNFDNRLSGYESMLLSFLVGGLQ 264

Query: 280 PAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVL 339
            + +T+  +     +++E ++  + +P G+  ++ V  + G +  + +L  M    + + 
Sbjct: 265 QSNFTLQGFSMLPALSDETQEPEKDIPKGMSQAVLVSTVCGVIYLVPLLLVMPSPEEVMS 324

Query: 340 DSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLM--GASTVVANSRQFWAFARDDGFPF 397
           DS+  + +  +++    +   + +L + +I   L+  G  ++  +SR  ++ +RD   P+
Sbjct: 325 DSRVMEIV--LLFTKSTRSNIVSYLQVMLILGNLLFSGIGSITTSSRAVYSISRDHAIPY 382

Query: 398 SNFFKKVD--GLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPI 455
              +  V     + VP  AV+              +  TA  +    SV  +  A    +
Sbjct: 383 YELWSYVSPGSQSQVPKYAVYLSMGASYLFGILPLISGTAYNSFIGASVMCLCSASGLAV 442

Query: 456 TLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVI 515
              +  G++  +     +       ++ + + +   V+  M  P    VT ++MNYT  I
Sbjct: 443 ICVMLNGRRGVKGAAVKIRCRLGWPVSIVVLLWLLLVMFCMCMPVTLPVTFSSMNYTSCI 502

Query: 516 GPGFWVLSLIYYFVWQRKFYKGPK 539
              F V     Y +W R  +K P+
Sbjct: 503 FAVFLVGIGALYNLWGRYHFKIPQ 526

>TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {ON} 
          Length = 543

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 88/387 (22%), Positives = 159/387 (41%), Gaps = 45/387 (11%)

Query: 161 SASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTS----LPSRITS 216
           SAS+C+    L+  IL    + +PD+       +  +    + MA + S    LP+ I+ 
Sbjct: 157 SASICA---SLSLSILGVYSLMHPDYELRHWNVFLTYELLNIAMAFVASWARWLPA-ISQ 212

Query: 217 KLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIA 276
               IS++S    ++ F I+I   +SRS   +  +  G  +FG+  N + W+      I 
Sbjct: 213 FGLGISVVS---YVLTFLISI---ISRSFNHSEQWPTGKTVFGEFTNTTGWSSSGMAFIV 266

Query: 277 GLMPAIWTIGAYDSCLHMAEEA--RDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPD 334
           GL+  +W+    DS  HM ++     + + VP  I+ +I + +   +   IV+  C+  D
Sbjct: 267 GLINPLWSFAGIDSATHMVDDVGYSASRKLVPRIIIATILLGFATAFPYAIVMFFCIT-D 325

Query: 335 IDSVLDSQFGQAMTQIIYDALGKRWTLGFL-SIFIICQFLMGASTVVANSRQFWAFAR-- 391
              V+ S     + QI Y A G +    F+ S  II  F+ G S+    +R  W+ +R  
Sbjct: 326 STQVVSSIL--PILQIYYQATGNKSLSAFMQSCCIITGFICGVSSSTWQNRILWSVSRTY 383

Query: 392 ------DDGFPFSNFFKKVDGLT---GVPVRAVWXXXXXXXXXXXXXXVGETASGALFSL 442
                 +     +    K+  ++    +PV A                   TA  A+ + 
Sbjct: 384 HLIECDEMNAKKAQVVAKIASISPTIRIPVYAHLLSHFFVAVIGCIFMGSSTAFNAIITA 443

Query: 443 SVAGMYMALIFP-ITLRLTYGKKDFRPG----PFYLG---------DFWSPIINWISVFF 488
            ++ + ++   P I +    GKK+F          LG           W  + N +++ +
Sbjct: 444 CISILLLSYAVPCIIMVFVVGKKNFYRNIASEQQALGLSHQVEESRASWYLVPNILTICW 503

Query: 489 QAFVIIMMMFPSDSTVTPTTMNYTVVI 515
             F +I + FP    V  + MNY  V+
Sbjct: 504 ALFCLIFLSFPYVIPVDSSNMNYVSVV 530

>Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {ON}
           YKL174C (REAL)
          Length = 616

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 93/502 (18%), Positives = 196/502 (39%), Gaps = 20/502 (3%)

Query: 50  DQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFX 107
           + +      Y + L +   S   I G+   +M  +  + +++  GL + GP+ +  G+  
Sbjct: 38  ENEEAEHFNYDQVLDKSLLSRSSIVGLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGFLI 97

Query: 108 XXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSI 167
                           S  P    ++V     AP+ ++   S+  G+L  +       SI
Sbjct: 98  SGMCTWFSSLSLGEIVSKFPME--LHVGSAMLAPKNLKLVCSWYTGWLMLIGNWTMSTSI 155

Query: 168 VYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNC 227
            +  AQ  +S +L++N D  +   + +       + + ++  +  +    ++TI+ +   
Sbjct: 156 TFAGAQLTISLILMTNSDLISEAHLIFYTVIVFYLVVTVVGLVNLKFARFIETINKVCVY 215

Query: 228 FLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGA 287
           +++        + +       RS     F F   +N S +   +   I G   + +T+  
Sbjct: 216 WIVYAIIFIDILLLIFHKGKFRSLKYALFHFD--NNLSGYKSAFLSFIIGFQQSNFTLQG 273

Query: 288 YDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAM 347
           +     +A+E +   R +P G+  ++ +    G +  I I+  + PD D++    F    
Sbjct: 274 FSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMLIL-PDNDAL----FTNHK 328

Query: 348 TQIIYDALGKRWTLGFLSIFIICQFLM-----GASTVVANSRQFWAFARDDGFPFSNFFK 402
              I +   K      LS F++   L      G  ++  +SR  ++F+RD   P    + 
Sbjct: 329 VLPIVNIFTKSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDHAIPHYGRWT 388

Query: 403 KV--DGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLT 460
            V  D  + VP  +V               +   A  A    +V  +  A   P+ L L 
Sbjct: 389 YVEPDSQSKVPKNSVILSMIISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLL 448

Query: 461 YGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFW 520
             ++  R  P  +   +   IN +S+ +    ++ +  P+   VT  TMNY +++   F 
Sbjct: 449 TRRRAIRSAPVKIRYKFGWFINIVSIAWVLLSMVSVCLPTQVPVTFKTMNYALMVYV-FC 507

Query: 521 VLSLI-YYFVWQRKFYKGPKSN 541
           +L +   YF W +  ++ P ++
Sbjct: 508 ILVITGLYFKWGKYNFRLPLAD 529

>Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C
           (BIO5) - transmembrane regulator of KAPA/DAPA transport
           [contig 159] FULL
          Length = 558

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 78/400 (19%), Positives = 148/400 (37%), Gaps = 39/400 (9%)

Query: 140 APQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAA 199
           A   +++  + +VG ++      +  S+   LA  IL    + N ++       + V+  
Sbjct: 150 ATSTIQRSTALAVGLINYFGAIFTTSSVFSSLAISILGVHSLLNEEYTLKHWHVFVVYEV 209

Query: 200 CIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFG 259
            ++ +  L S  S I   L    +  +    +L FI     V RS     ++     IFG
Sbjct: 210 LVIFLT-LVSCWSLILPALSKFGLGMSLITYMLTFIVSL--VCRSSNTEVAWPKPSMIFG 266

Query: 260 QVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEA--RDAVRAVPFGIVGSITVCW 317
           +  N + W       I GL+  +W     DS  HM +E     +++ VP  I+G+I + +
Sbjct: 267 EFKNTTGWKSSQMAFIVGLINPLWAFAGIDSATHMVDEVGYTASMKLVPRVIIGTILIGF 326

Query: 318 ILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLM--- 374
           +  +   I +  C+    D    S     + ++ Y A G +     LS+F+ C  ++   
Sbjct: 327 VTSFTYAIGMFFCIT---DPAKLSDAVLPILELYYQATGNK----NLSVFLQCCCIVSGI 379

Query: 375 --GASTVVANSRQFWAFARDDGF---------PFSNFFKKVDGLTGVPVRAVWXXXXXXX 423
             G ++V   SR  W+  RD                FF  V+     P+ A +       
Sbjct: 380 TCGVASVTWQSRILWSLGRDFSTLELRQTYSKKILKFFGVVNPTLKTPLNAHFFSQLLVA 439

Query: 424 XXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPG-------------P 470
                     TA  A+ +  +  + ++   P  +    G++ F                 
Sbjct: 440 IIGCIFMGSSTAFNAIITACITLLLLSYAIPCLILFMVGRRRFFKRIKKQLTESGISGVS 499

Query: 471 FYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMN 510
            + G     I N +++ +  F ++ + FP    V+   MN
Sbjct: 500 SFAGSRIGAIPNVLTILWTLFCLVFLSFPYTLPVSAGNMN 539

>Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 101/493 (20%), Positives = 197/493 (39%), Gaps = 31/493 (6%)

Query: 64  KREFSSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFXXXXXXXXXXXXXXXX 122
           K   S   I G+   +M  +  + +++  GL + GP  +  G+                 
Sbjct: 53  KSLLSRSSIVGLGLGLMSPVLGMCTSMAIGLINGGPFTIMLGFLISGVCIWFSSLSLGEI 112

Query: 123 SSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVS 182
            S  P    ++V     AP+ ++   S+  G+L  +       SI +  AQ  +S +L++
Sbjct: 113 VSKFPME--LHVGSAMLAPETLKLVCSWYTGWLMLIGNWTMSTSITFAGAQLTISLILMT 170

Query: 183 NPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVS 242
           N D  +     + +F   IV   ++T++        + I II+    + +++I     + 
Sbjct: 171 NSDLISE---AHLIFYTVIVFYLVVTAVGLVNLKFARFIEIINK---VCVYWII--YAII 222

Query: 243 RSDTLNRSFNGGDF------IFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAE 296
             D L   F+ G F      +F   +N S +   +   I G   + +T+  +     +A+
Sbjct: 223 FIDILLLVFHKGKFRSLKYALFHFDNNLSGYKSAFISFIIGFQQSNFTLQGFSMLPALAD 282

Query: 297 EARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALG 356
           E +   R +P G+  ++ +    G +  I I+  + PD D +    F       I +   
Sbjct: 283 EVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMIIL-PDNDLL----FTNHKVLPIVNIFT 337

Query: 357 KRWTLGFLSIFIICQFLM-----GASTVVANSRQFWAFARDDGFPFSNFFKKV--DGLTG 409
           K      LS F++   L      G  ++  +SR  ++F+RD   P+ + +  V  D  + 
Sbjct: 338 KSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDQAIPYYDKWTYVEPDSQSK 397

Query: 410 VPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPG 469
           VP  +V               +   A  A    +V  +  A   P+ L L   ++  R  
Sbjct: 398 VPKNSVILSMIISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLFTRRRAIRSA 457

Query: 470 PFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLI-YYF 528
           P  +   +   IN +S+ +    ++ +  P+   VT  TMNY +V+   F +L +   YF
Sbjct: 458 PVKIRYKFGWFINIVSIVWLLLSMVSVCLPTQLPVTFKTMNYALVVYI-FCILVITGLYF 516

Query: 529 VWQRKFYKGPKSN 541
            W +  ++ P ++
Sbjct: 517 KWGKYNFRLPLAD 529

>Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 94/502 (18%), Positives = 199/502 (39%), Gaps = 20/502 (3%)

Query: 50  DQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFX 107
           + +      Y + L +   S   I G+   +M  +  +++++  GL + GP+ +  G+  
Sbjct: 38  ENEEAEHFNYDQVLDKSLLSRGSIVGLGLGLMSPVLGMSTSMAIGLINGGPLTIMLGFLI 97

Query: 108 XXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSI 167
                           S  P    ++V     AP++++   S+  G+L  +       SI
Sbjct: 98  SGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPEKLKLACSWYTGWLMLIGNWTMSTSI 155

Query: 168 VYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNC 227
            +  AQ  +S +L++N +  +   +T+       + + I+  +  +    ++TI+ +   
Sbjct: 156 TFAGAQLTISLILMTNSNLISEAHLTFYTVIVFYLVVTIVGLVNLKFARFIETINKVCVY 215

Query: 228 FLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGA 287
           ++I        + +       RS     F F   ++ S +   +   I G   + +T+  
Sbjct: 216 WIIYAIIFIDILLLIFHKGKFRSLKYALFHFD--NSLSGYKSAFLSFIIGFQQSNFTLQG 273

Query: 288 YDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAM 347
           +     +A+E +   R +P G+  ++ +    G +  I I+  + PD D +    F    
Sbjct: 274 FSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMLIL-PDNDLL----FTNHK 328

Query: 348 TQIIYDALGKRWTLGFLSIFIICQFLM-----GASTVVANSRQFWAFARDDGFPFSNFFK 402
              I +   K      LS F++   L      G  ++  +SR  ++F+RD   P    + 
Sbjct: 329 VLPIVNIFTKSTASVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDRAIPHYEKWT 388

Query: 403 KV--DGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLT 460
            V  D  + VP  +V               +   A  A    +V  +  A   P+ L L 
Sbjct: 389 YVEPDSQSKVPKNSVILSMVISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLF 448

Query: 461 YGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFW 520
             ++  R  P  +   +   IN +S+ +    ++ +  P+   VT  TMNY +++   F 
Sbjct: 449 TRRRAIRSAPVKIRYKFGWFINIVSIAWLLLSMVSVCLPTQVPVTFKTMNYALMVYI-FC 507

Query: 521 VLSLI-YYFVWQRKFYKGPKSN 541
           +L++   YF W +  ++ P ++
Sbjct: 508 ILAITGLYFKWGKYNFRLPLAD 529

>YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON}
           TPO5Protein involved in excretion of putrescine and
           spermidine; putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 618

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 92/504 (18%), Positives = 199/504 (39%), Gaps = 20/504 (3%)

Query: 48  TSDQQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGW 105
           + + +      Y + L +   S   I G+   +M  +  + +++  GL + GP+ +  G+
Sbjct: 36  SQENEEAEHFNYDQVLDKSLLSRGSIVGLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGF 95

Query: 106 FXXXXXXXXXXXXXXXXSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVC 165
                             S  P    ++V     AP++++   S+  G+L  +       
Sbjct: 96  LISGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPEKLKLVCSWYTGWLMLIGNWTMST 153

Query: 166 SIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIIS 225
           SI +  AQ  +S +L++N +  +   + +       + + ++  +  +    ++TI+ + 
Sbjct: 154 SITFAGAQLTISLILMTNSNLISEAHLIFYTVIVFYLVVTVVGLVNLKFARFIETINKVC 213

Query: 226 NCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTI 285
             ++I        + +       RS     F F   +N S +   +   I G   + +T+
Sbjct: 214 VYWIIYAIIFIDILLLVFHKGKFRSLKYALFHFD--NNLSGYKSAFLSFIIGFQQSNFTL 271

Query: 286 GAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQ 345
             +     +A+E +   + +P G+  ++ +    G +  I I+  + PD D +    F  
Sbjct: 272 QGFSMLPALADEVKVPEKDIPRGMSNAVLLSAFSGVIFLIPIMLIL-PDNDLL----FTN 326

Query: 346 AMTQIIYDALGKRWTLGFLSIFIICQFLM-----GASTVVANSRQFWAFARDDGFPFSNF 400
                I +   K      LS F++   L      G  ++  +SR  ++F+RD   P+ + 
Sbjct: 327 HKVLPIVNIFTKSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDQAIPYYDK 386

Query: 401 FKKV--DGLTGVPVRAVWXXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLR 458
           +  V  D  + VP  +V               +   A  A    +V  +  A   P+ L 
Sbjct: 387 WTYVEPDSQSKVPKNSVVLSMIISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLV 446

Query: 459 LTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPG 518
           L   ++  R  P  +   +   IN +S+ +    ++ +  P+   VT  TMNY +++   
Sbjct: 447 LFTRRRAIRSAPVKIRYKFGWFINIVSIVWLLLSMVSVCLPTQVPVTFKTMNYALMVYV- 505

Query: 519 FWVLSLI-YYFVWQRKFYKGPKSN 541
           F +L +   YF W +  ++ P ++
Sbjct: 506 FCILVITGLYFKWGKYNFRLPLAD 529

>KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 564

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 93/414 (22%), Positives = 165/414 (39%), Gaps = 64/414 (15%)

Query: 145 RKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCM 204
           +K ++ +VG ++      +  SIV  L   I+    + +P F      T+ ++    V +
Sbjct: 153 QKNMAIAVGLINYFGCVFTTASIVSALVYSIMGIHSILHPSFELKQWHTFILYEILTVFL 212

Query: 205 AILTS----LPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRS-FNGGDFIFG 259
            +       LP  ++S    +S++S     +L        VSRS++++   +   + IF 
Sbjct: 213 TVFNCNYRCLP-FLSSFGLAMSLLSYAITFILCL------VSRSNSISEQPWPKSEDIFY 265

Query: 260 QVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARD--AVRAVPFGIVGSITVCW 317
           +  N + W       +  L+  +W+    DS  HM +E     A   VP  I+ +I + +
Sbjct: 266 KFHNNTGWKSNGMAFVVSLINPLWSFVGIDSATHMVDEVGHVAAQVLVPKVIITTIFIGF 325

Query: 318 ILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLMGAS 377
           I  +   I +  C+  D  +VL+S     +  I Y A G R     L++F      M AS
Sbjct: 326 ITSFSYSIALFYCVR-DTAAVLESI--APVVTIYYQATGNR----NLAVF------MQAS 372

Query: 378 TVVA-----------NSRQFWAFARD------DGFPFSNF----FKKVDGLTGVPVRAVW 416
           T+VA            SR  W+ +R+      DG   S F    F  +D +  VP+ A +
Sbjct: 373 TIVAGLTCGVASGTWQSRMLWSLSREMETMRPDGI-LSGFVTARFATIDSVNKVPLYAHF 431

Query: 417 XXXXXXXXXXXXXXVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDF---------- 466
                             A  A+ S +V  + ++   P  + L  G+  F          
Sbjct: 432 FSQALVVIIGCIMLGSTKAFNAIVSAAVTLLIVSYAIPSLILLVRGRNKFIAKCERETAN 491

Query: 467 ----RPGPFYL-GDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVI 515
                P  + +    W  I + ++V +  F ++M+ FP    VT + MNY  V+
Sbjct: 492 ETDIVPNKYSMWLKKWGVIPHTLTVAYALFCVVMLSFPYVKPVTSSNMNYVSVV 545

>KAFR0A06250 Chr1 complement(1262105..1263832) [1728 bp, 575 aa]
           {ON} Anc_4.195 YGR055W
          Length = 575

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 46/229 (20%), Positives = 90/229 (39%), Gaps = 16/229 (6%)

Query: 177 SAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIA 236
           + + ++  D + T+    G+  A I    ++ S+  +I   LQ    I   F+++  FI+
Sbjct: 160 AVMFLTAADADVTEWREKGIGCAVIAFAFLVNSINVKIGLYLQNALGIFKVFIVI--FIS 217

Query: 237 IPIGVSRSDTLNRSFNGGDF--IFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHM 294
           +   V+    L   +   +F   F   +N S +       +  L   IW+   Y +  + 
Sbjct: 218 VTGWVALGGGLKDGYQSHNFHNAFDGTENASAYG-----IVTALYNVIWSYVGYSNVNYA 272

Query: 295 AEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMT--QIIY 352
             E ++ VR +      S+    I+   V I   A +  D   ++ S+   A     I++
Sbjct: 273 LGEVKNPVRTLKLAGPTSLIFITIIYIFVNIAYFAVVPKD--KLVSSKLVLAADFFDIVF 330

Query: 353 DALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFF 401
               ++    F+ +  +   L   S + +  R      R+   PFSNFF
Sbjct: 331 GGNARKAAAAFVGLSALGNVL---SVIFSQGRIIQQLGREGVLPFSNFF 376

>Ecym_7299 Chr7 (630846..632495) [1650 bp, 549 aa] {ON} similar to
           Ashbya gossypii AGL026W
          Length = 549

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 10/62 (16%)

Query: 42  VDARSATSDQQVLAELG-YKEELKREFSSIQIFGVAFS---------IMGLLPSIASTLD 91
           +D   + +D++VL E   YK  +K  FS ++++G+AF+         +    PS+  TL+
Sbjct: 308 MDVGESDNDKEVLKEHNSYKFAIKLAFSDLKVWGIAFTVSLLVAASGVQNFFPSVVGTLN 367

Query: 92  GG 93
            G
Sbjct: 368 YG 369

>NCAS0J01180 Chr10 (204451..206208) [1758 bp, 585 aa] {ON} Anc_4.195
          Length = 585

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 35/177 (19%), Positives = 69/177 (38%), Gaps = 14/177 (7%)

Query: 229 LIVLFFIAIPIGVSRSDTLNRSFNGGDF--IFGQVDNRSTWNKGWNWCIAGLMPAIWTIG 286
           + ++ FI++   V+    L   +   +F   F   +N + +       +  L   IW+  
Sbjct: 215 IFIVLFISVTGWVALGGGLKDGYQTHNFHDAFAGTENATAYG-----IVTALYNVIWSFV 269

Query: 287 AYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQA 346
            Y +  +   E +D VR +      S+    I+   V +   A +  +   ++ S+   A
Sbjct: 270 GYSNVNYALGEVKDPVRTLKIAGPTSMVFIAIVYIFVNVAYFAVVPKE--KLISSKLVLA 327

Query: 347 MT--QIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFF 401
                I++   GK+    F+ +  +   L   S + +  R      R+   PFSNFF
Sbjct: 328 ADFFDIVFGEHGKKAAAAFVGLSALGNVL---SVIFSQGRIIQQLGREGVLPFSNFF 381

>NCAS0J02330 Chr10 (456915..459236) [2322 bp, 773 aa] {ON} 
          Length = 773

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 20/103 (19%)

Query: 133 YVSCYQWAPQRVRKCISYSVGFLDTLSLSASV-CSIVYGLAQQILSAVLVSNPDFNATDP 191
           Y +    +   +R+ +S    F  TLS +A+V  S +Y L   I             T+P
Sbjct: 340 YTTTVTQSNSTIRELVS----FYSTLSGTATVIASSIYTLPPLI-------------TEP 382

Query: 192 ITYG--VFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVL 232
           +TY   V A       ++TS P+ ITS   TIS+I++   + L
Sbjct: 383 VTYTKTVTANGTTITQVVTSFPNTITSSSNTISLITSSAQLAL 425

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,769,708
Number of extensions: 2083681
Number of successful extensions: 6820
Number of sequences better than 10.0: 86
Number of HSP's gapped: 6703
Number of HSP's successfully gapped: 86
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)