Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E01122g5.699ON47247222490.0
Kwal_55.197165.699ON46747613520.0
SAKL0E14850g5.699ON4704648151e-103
AFR283W5.699ON4524435423e-63
Ecym_40215.699ON4594635416e-63
ZYRO0G06666g5.699ON5035045071e-57
KLLA0A00660g5.699ON5244904802e-53
TDEL0B022205.699ON4894414598e-51
Smik_9.235.699ON5273733256e-32
Skud_9.225.699ON5373943062e-29
YIL146C (ATG32)5.699ON5293802974e-28
Suva_9.435.699ON5133892884e-27
CAGL0H06545g5.699ON4922052221e-18
KNAG0L021005.699ON4444532183e-18
TBLA0E020905.699ON7491711902e-14
NCAS0G002605.699ON5103151793e-13
KAFR0D022505.699ON5561441518e-10
TBLA0J002707.513ON53055741.6
KLLA0D10571g7.513ON52055741.8
Ecym_10811.77ON79674713.7
CAGL0I08327g7.513ON51855704.9
CAGL0F05665g8.394ON66443696.4
NOTE: 2 genes in the same pillar as KLTH0E01122g were not hit in these BLAST results
LIST: Kpol_2001.73 TPHA0D04580

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E01122g
         (472 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   870   0.0  
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   525   0.0  
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   318   e-103
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   213   3e-63
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   213   6e-63
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   199   1e-57
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...   189   2e-53
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   181   8e-51
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   129   6e-32
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   122   2e-29
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   119   4e-28
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   115   4e-27
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...    90   1e-18
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....    89   3e-18
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...    78   2e-14
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...    74   3e-13
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...    63   8e-10
TBLA0J00270 Chr10 complement(47475..49067) [1593 bp, 530 aa] {ON...    33   1.6  
KLLA0D10571g Chr4 complement(898296..899858) [1563 bp, 520 aa] {...    33   1.8  
Ecym_1081 Chr1 (158430..160820) [2391 bp, 796 aa] {ON} similar t...    32   3.7  
CAGL0I08327g Chr9 (812123..813679) [1557 bp, 518 aa] {ON} highly...    32   4.9  
CAGL0F05665g Chr6 complement(567360..569354) [1995 bp, 664 aa] {...    31   6.4  

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/472 (90%), Positives = 428/472 (90%)

Query: 1   MSQYITNPRQQSRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHLSVLQLLDRADPPSEL 60
           MSQYITNPRQQSRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHLSVLQLLDRADPPSEL
Sbjct: 1   MSQYITNPRQQSRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHLSVLQLLDRADPPSEL 60

Query: 61  SSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTDCSMVNTQGDATHQHAGILSSSDT 120
           SSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTDCSMVNTQGDATHQHAGILSSSDT
Sbjct: 61  SSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTDCSMVNTQGDATHQHAGILSSSDT 120

Query: 121 SEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEASSLREYQNSEIANPREENDNETVTM 180
           SEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEASSLREYQNSEIANPREENDNETVTM
Sbjct: 121 SEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEASSLREYQNSEIANPREENDNETVTM 180

Query: 181 SLMNSSNSFVMPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREM 240
           SLMNSSNSFVMPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREM
Sbjct: 181 SLMNSSNSFVMPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREM 240

Query: 241 NKYSAVMVIFXXXXXXXXXXXXVAAHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYH 300
           NKYSAVMVIF            VAAHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYH
Sbjct: 241 NKYSAVMVIFGEPKEGKELLEKVAAHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYH 300

Query: 301 LTVMSDHQDVHRLLRYLNTLSTEVDSGYETEVGXXXXXXXXXXXXXXXPQITVNRWVIWS 360
           LTVMSDHQDVHRLLRYLNTLSTEVDSGYETEVG               PQITVNRWVIWS
Sbjct: 301 LTVMSDHQDVHRLLRYLNTLSTEVDSGYETEVGSRKIRKRRKSSKKRSPQITVNRWVIWS 360

Query: 361 ISLTVGVGLGYCIXXXXXXXXXXXXXXXXXGDEVTIMEDIHNSPHESPFDNYLRHLLLAV 420
           ISLTVGVGLGYCI                 GDEVTIMEDIHNSPHESPFDNYLRHLLLAV
Sbjct: 361 ISLTVGVGLGYCISCLLSSTSSTLSVTLRSGDEVTIMEDIHNSPHESPFDNYLRHLLLAV 420

Query: 421 KRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEWLSEASDPTLPGVTALDLVLV 472
           KRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEWLSEASDPTLPGVTALDLVLV
Sbjct: 421 KRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEWLSEASDPTLPGVTALDLVLV 472

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/476 (58%), Positives = 330/476 (69%), Gaps = 13/476 (2%)

Query: 1   MSQYITNPRQQSRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHLSVLQLLDRADPPSEL 60
           MSQY T  R +         + ++P F+TS   LN RNSILDPHLSVLQLL+R +  SE 
Sbjct: 1   MSQYTTASRSRV--------NDRDPRFSTSE-RLNNRNSILDPHLSVLQLLERNEVHSEP 51

Query: 61  SSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTDCSMVNTQGDATHQHAGILSSSDT 120
              +H +I  P    RS  E +  SIS+SWQSI+HTD S++N  G+ +HQ AGILSSSDT
Sbjct: 52  QEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTDYSILNLIGETSHQPAGILSSSDT 111

Query: 121 SEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEASSLREYQNS--EIANPREENDNETV 178
           SEDEPD  LSPSPN +AF N A ++FPEA H  E  SL   Q+S  E +N  E+NDNETV
Sbjct: 112 SEDEPDHFLSPSPNEYAFANGAKTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETV 171

Query: 179 TMSLMNSSNSFVMPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPR 238
           T+SL+NSSNSFVMPKLSL Q  +KF ILIVGKPAQRFYRDIPRAY KMFEV D      R
Sbjct: 172 TLSLINSSNSFVMPKLSLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTR 231

Query: 239 EMNKYSAVMVIFXXXXXXXXXXXXVAAHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLV 298
           +++++SA+MVIF            V   +SNIIAVCQRGQQQQISN+LNR+SK++ +RL+
Sbjct: 232 DVDQFSAIMVIFTDPKNGQSLLEMVTGRSSNIIAVCQRGQQQQISNLLNRFSKTHHLRLI 291

Query: 299 YHLTVMSDHQDVHRLLRYLNTLSTEVDSGYETEVGXXXXXXXXXXXXXXXPQITVNRWVI 358
           YHLTVMSDHQDVHRLLRYL TLS E+DS Y+TEVG                   VNRWVI
Sbjct: 292 YHLTVMSDHQDVHRLLRYLYTLSNEIDSEYDTEVGPRKVRKRRKSYKKRETPAAVNRWVI 351

Query: 359 WSISLTVGVGLGYCIXXXXXXXXXXXXXXXX--XGDEVTIMEDIHNSPHESPFDNYLRHL 416
           WSISLTVGVG+GYCI                    DE+ ++E+   SPHE+  +NY R L
Sbjct: 352 WSISLTVGVGIGYCISCLLSSTMSVRGNTLTLHSSDEIALIEEAPISPHETVLENYFRQL 411

Query: 417 LLAVKRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEWLSEASDPTLPGVTALDLVLV 472
           +LA K+AVKQV+ SFKQ L G SLPVLWMQRIGK+W+SEASD TLPGVTALDLVL+
Sbjct: 412 VLAFKKAVKQVSQSFKQCLHGHSLPVLWMQRIGKDWMSEASDTTLPGVTALDLVLI 467

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  318 bits (815), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 276/464 (59%), Gaps = 32/464 (6%)

Query: 28  ATSSVPLNQRNSILDPHLSVLQLLDR-------------ADPPSELSSLKHGEIAKPATP 74
           A+ S+P  Q+ SILDPH SVLQLL+R             +  P EL S       +P +P
Sbjct: 20  ASGSMPF-QKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKS----AFNRPLSP 74

Query: 75  RRSGFESVNCSISESWQSIKHTDCSMVNTQGD-ATHQHAGILSSSDTSEDEPDAQLSPSP 133
            +   E++N SIS+SWQSIK  D S++N+  D ++ Q  GILSSSDTSE+E D   SPSP
Sbjct: 75  HKRYPEALNQSISDSWQSIKMVDYSILNSLHDTSSSQAVGILSSSDTSEEELDHLNSPSP 134

Query: 134 NNF-AFPNSATSIFPEAPHNLEASSLREYQNSEIANPR--EENDNETVTMSLMNSSNSFV 190
           ++   FPN     F      L AS+        + NP   EE+DNETVT+SL  SSNSFV
Sbjct: 135 SSQQVFPNGPPISFQTQAGVLTASA-------TLPNPGVLEEDDNETVTVSLAASSNSFV 187

Query: 191 MPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIF 250
           MP+LSL Q+S +F IL+VGKPA++F+ ++P+ Y KMF++ D   +S  +++ Y+AVM+IF
Sbjct: 188 MPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYTAVMIIF 247

Query: 251 XXXXXXXXXXXXVAAH--NSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQ 308
                       +        II +CQRGQ+QQ++++L  + K+ +IRL++  TVMS+HQ
Sbjct: 248 QDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSNHQ 307

Query: 309 DVHRLLRYLNTLSTEVDSGYETEVGXXXXXXXXXXXXXXXPQITVNRWVIWSISLTVGVG 368
           ++H+LLRYL+ LSTE+DSGYET+                  + T NRWVIW +SLTVGVG
Sbjct: 308 EIHKLLRYLHRLSTEIDSGYETD-ETHLKVRKRKKTHKKKSKGTSNRWVIWGLSLTVGVG 366

Query: 369 LGYCIXXXXXXXXXXXXXXXXXGDEVTIMEDIHNSPHESPFDNYLRHLLLAVKRAVKQVN 428
           +G CI                  D+V ++E++   P ++  +  +  ++  +++ VKQ N
Sbjct: 367 IGCCISFILSSYSSSVQIPHASRDDVVLVEEVPTLPDKAEGNGPIGQVITLLRKTVKQFN 426

Query: 429 SSFKQYLSGQSLPVLWMQRIGKEWLSEASDPTLPGVTALDLVLV 472
              KQ++  Q   + W+QR+GKE +SE SD T+  V ALDLVL+
Sbjct: 427 LVLKQFIYEQVGSLSWIQRVGKELISEDSDGTVGRVAALDLVLL 470

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  213 bits (542), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 137/443 (30%), Positives = 226/443 (51%), Gaps = 21/443 (4%)

Query: 35  NQRNSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIK 94
           NQ   ILDPHLSVL++LDR D       ++ G +      +R    S++ SISESWQ+IK
Sbjct: 26  NQHKGILDPHLSVLEMLDRQDGDGA-GQVEEGAVM--TVGKRRVERSLHHSISESWQAIK 82

Query: 95  HTDCSMVNTQGD--ATHQHAGILSSSDTSEDEPDAQLSPSPNNFAFPNSATSIFPEAPHN 152
            +D S ++   +  A H   GILSSSDTSE+E  A++ PS +      S+          
Sbjct: 83  RSDYSFLSGTHEVGAMHSSVGILSSSDTSEEE--AEMRPSAHGTVHLGSSL--------- 131

Query: 153 LEASSLREYQNSEIANPREENDNETVTMSLMNSSNSFVMPKLSLIQQSQKFCILIVGKPA 212
             AS +R+    E  +  EE+D +TVT+S+ +SS S VMPKLSL Q+  +  +L+VG+PA
Sbjct: 132 --ASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEPQLLLVGQPA 189

Query: 213 QRFYRDIPRAYHKMFEVRDVGHLSPREMN-KYSAVMVIFXXXXXXXXXXXXVA--AHNSN 269
           ++F+  IP+ Y K+F+V+++G ++  ++  +Y AVMV+F            +   A    
Sbjct: 190 RKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCPT 249

Query: 270 IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLNTLSTEVDSGYE 329
           +I VCQ+GQ+  ++ +L RY+    IR+     +MS+H + HRLL++L+ L  E +SGYE
Sbjct: 250 VIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLKHLHNLCNESESGYE 309

Query: 330 TEVGXXXXXXXXXXXXXXXPQITVNRWVIWSISLTVGVGLGYCIXXXXXXXXXXXXXXXX 389
           TE+                  + +  W IW+ S T+G+G+G CI                
Sbjct: 310 TELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCISLMATTRFTFFSSAPL 369

Query: 390 XGDEVTIMEDIHNSPHESPFDNYLRHLLLAVKRAVKQVNSSFKQYLSGQSLPVLWMQRIG 449
               V   +   +   + P    + H  +  K  ++Q+ +S + +   +     W+   G
Sbjct: 370 PLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTIRQLGTSLRLFFFEKFESRTWVHIFG 429

Query: 450 KEWLSEASDPTLPGVTALDLVLV 472
            +  S+    +L  +  LD +++
Sbjct: 430 MDLHSDDPLASLGRLMPLDFIML 452

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  213 bits (541), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 152/463 (32%), Positives = 236/463 (50%), Gaps = 32/463 (6%)

Query: 26  HFATSSVPLNQRNSILDPHLSVLQLLD-----RADPPSELSSLKHGEIAKPATPRRSGFE 80
           H     +P   + SILDPHLSVL++L+     + + P ELS       ++ +  +  G  
Sbjct: 13  HTQNGGLPGTTQRSILDPHLSVLEILEGKELNKVEGPHELSG-----ASRVSGKQFEGER 67

Query: 81  SVNCSISESWQSIKHTDCSMVNTQGDATHQH---AGILSSSDTSEDEPDAQLSPSPNNFA 137
            ++ SISESWQSIK TD   ++   D + Q     GILSSSDTSE+E D   SP P N A
Sbjct: 68  VLHHSISESWQSIKSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHPSPPPPNSA 127

Query: 138 FPNSATSIFPEAPHNLEASSLREYQNSEIANPREENDNETVTMSLMNSSNSFVMPKLSLI 197
                + I   A     A+       S + +  E++D ETVT+SL N+  S VMPKLSL 
Sbjct: 128 SSAFDSRIINIAGQAFSATL------SHLRSEDEDDDGETVTVSLPNTMTSLVMPKLSLS 181

Query: 198 QQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMN-KYSAVMVIFXXXXXX 256
            +  +  +LIVG+PA++F+  IP++Y KMFE+  +  L  ++++ KYS +MVIF      
Sbjct: 182 DRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGLA 241

Query: 257 XXXXXXVAAH--NSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLL 314
                 +        II +CQ+GQ+Q +S++L +Y   N I+L  +  VMS+H + HRLL
Sbjct: 242 PELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNHHEKHRLL 301

Query: 315 RYLNTLSTEVDSGYETEVGXXXXXXXXXXXXXXXPQITVNR-WVIWSISLTVGVGLGYCI 373
           ++L+ LS+  DSGYETEV                 + +  R WV+W+ S+T+G+G+G C+
Sbjct: 302 KHLHQLSSGSDSGYETEVTVEPVKKLPRKAKKRPSKPSTFRDWVVWTASITIGIGIGCCV 361

Query: 374 XXXXXXXXXXXXXXXXXGDEVTIM----EDIHNSPHESPFDNYLRHLLLAVKRAVKQVNS 429
                             D++T      E    S H     N   H     K ++K++ S
Sbjct: 362 SLMVSTRYAFLVPRQLAVDDITSSPLSPEGTDKSSH-----NLFLHAYSLCKTSLKKLAS 416

Query: 430 SFKQYLSGQSLPVLWMQRIGKEWLSEASDPTLPGVTALDLVLV 472
           S + + S +     W+  +G E   + S  ++  +  LD +++
Sbjct: 417 SLRPFFSDRLESCTWIHTLGIELSYDDSLISMGRIMPLDFIML 459

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  199 bits (507), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 165/504 (32%), Positives = 231/504 (45%), Gaps = 89/504 (17%)

Query: 36  QRNSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKH 95
           +R SILDPHLSVL+LL R        +LK GE++           + N SIS+SWQ+I  
Sbjct: 22  ERRSILDPHLSVLELLRRPSDTRPHEALK-GEVSDIVGNCAGTTGTGNGSISQSWQTIHR 80

Query: 96  TD-C-SMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNL 153
            D C S+V  +  +    AGILSSSDTSEDEPDA  SPS        +        P   
Sbjct: 81  NDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPS--------AVHQQLHATPPQK 132

Query: 154 EASSLREYQNSEIANP-----------------------REENDNETVTMSLMNSSNSFV 190
              SL +Y++  +  P                        EE+DN+T+T SL +SSNSF+
Sbjct: 133 HTKSLEDYRSLNVGIPLVLPEDSNNINNNNKNGSTTGSNGEEDDNDTITKSLNSSSNSFI 192

Query: 191 MPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIF 250
           MPKLSL Q++QKF IL++G+P  +FY  IP+ Y  MFE+    H  P E  +Y+ ++V+F
Sbjct: 193 MPKLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFEL-PRSH-DPAEFKQYTGILVVF 250

Query: 251 XXXXXXXXXXXXVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQ 308
                       V   N N  +I VCQ GQ+QQ+ N+L    K+  + L+Y   V+++  
Sbjct: 251 QELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQP 310

Query: 309 DVHRLLRYLNTLSTEVDSGYETEV-----GXXXXXXXXXXXXXXXPQIT----------- 352
           D+  + R+L  LS  V    + +      G                + +           
Sbjct: 311 DLLGMFRFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKKR 370

Query: 353 -----VNRWVIWSISLTVGVGLGYCIXXXXXXX---------------XXXXXXXXXXGD 392
                VNRWV+W +SLT+GVG+GYCI                                  
Sbjct: 371 HNNEKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQ 430

Query: 393 EVTIMEDIHNSPHESPFDNYLRHLLLAVKRAVKQVNSSFKQYLSGQSLPVLWMQRIGK-- 450
           E+ + E   +S H  PF     H L   K+A+KQ N + KQ+L G+ L    M+RIG   
Sbjct: 431 ELKLGEMDMDSDH--PFG----HALFLFKQALKQWNLAVKQFL-GRHLSC--MERIGPAN 481

Query: 451 --EWLSEASDPTLPGVTALDLVLV 472
             EW    SD     V AL  V++
Sbjct: 482 CLEW--PTSDEHTNRVLALGYVML 503

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score =  189 bits (480), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 142/490 (28%), Positives = 227/490 (46%), Gaps = 57/490 (11%)

Query: 36  QRNSILDPHLSVLQLLDRADPPSELSSLKHGE--IAKPATPRRSGFESVNC-----SISE 88
           QR+SILDPH SV+ LL+     +  S L   +  I +           +N       +++
Sbjct: 37  QRHSILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTD 96

Query: 89  SWQSIKHTDCSMVN----------TQGDATHQHAGILSSSDTSEDEPDAQLSPSPN---- 134
           SWQ+I   + S +N          + GD   Q  G+LSS DTSE+E +   +PSPN    
Sbjct: 97  SWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAPSPNLSAS 155

Query: 135 -----NFAFPNSATSIFPEAPHN-----------LEASSLREYQNSEIANPREENDNETV 178
                  A+P S+T    +               ++++   ++  +E+     E++   V
Sbjct: 156 QQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMV 215

Query: 179 TMSLMNSSNSFVMPKLSLIQQSQKFCILIV--GKPAQRFYRDIPRAYHKMFEVRDVGHLS 236
            +    + + FVMPKLSL +  ++F ILI+  G  A  FY  + R +  MF+V  +   S
Sbjct: 216 NLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEAS 275

Query: 237 PREMNKYSAVMVIFXXXXXXXXXXXXVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNE 294
             E  KY+A M+IF            +     +  +I +CQ+GQ+Q ++  +  ++ SN+
Sbjct: 276 KEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNK 335

Query: 295 IRLVYHLTVMSDHQDVHRLLRYLNTLSTEVDSGYETEVGXXXXXXXXXXXXXXXPQITVN 354
           I+L+ +  V+SDH ++H LLR+L++L  EVDS YET++                P +   
Sbjct: 336 IKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDI-PKKTKPRKGAKKKPAPHL-AK 393

Query: 355 RWVIWSISLTVGVGLGYCIXXXXXXXXXXXXXXX-----XXGDEVTIMEDI--HNSP--- 404
           RW  W IS+ +GVG+G C+                        E+  + D    NSP   
Sbjct: 394 RWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVDAIEGNSPSIL 453

Query: 405 -HESP--FDNYLRHLLLAVKRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEWLSEASDPTL 461
              SP    ++L  +   VK    Q+N   KQ+LS   +   W+Q IGKE++   S  T+
Sbjct: 454 EESSPQSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSIGKEFMQPDSQSTI 513

Query: 462 PGVTALDLVL 471
             VTALDLV+
Sbjct: 514 SKVTALDLVM 523

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  181 bits (459), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 134/441 (30%), Positives = 201/441 (45%), Gaps = 54/441 (12%)

Query: 36  QRNSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKH 95
           ++ S+LDPHLSVL+LL+R      +              +     +   SIS SWQ+I  
Sbjct: 27  EKKSLLDPHLSVLELLERTGDTQRVGR---------GVEKADDMANTTNSISSSWQAIHR 77

Query: 96  TDCSMVNTQGDATHQHA--GILSSSDTSEDEPDAQLSPSPNNFA-FPNSATSIFPEAPHN 152
            D  +       + Q A  GILSSSDTSE+E D   SP+  +F  F  S     P  P  
Sbjct: 78  NDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQP--PRLPFK 135

Query: 153 LEASSLREYQNSE------IANPREENDNETVTMSLMNSSNSFVMPKLSLIQQSQKFCIL 206
           L+   +   ++ E        +  +E D+ET+T SL NSSNSFVMPKLSL Q+S K  IL
Sbjct: 136 LDVPVILPARDQEPSGQTQTPDNDDERDDETLTKSLSNSSNSFVMPKLSLSQKSHKLRIL 195

Query: 207 IVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIFXXXXXXXXXXXXV--A 264
           I+G+P  +FY+ IP+ Y   FE+  +    P E  +++ ++++F            V   
Sbjct: 196 ILGRPGLKFYQSIPKRYQHFFELSRLQ--DPSEFRQFTGILIVFQELKEMVSLLNRVCQC 253

Query: 265 AHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLNTLSTEV 324
           A    +I VCQ GQ QQ+ N+L    KS  I L+Y   V+S+H D++ + R+L  LS  +
Sbjct: 254 APTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLNNMYRFLLDLSKTI 313

Query: 325 ---------------------DSGYETEVGXXXXXXXXXXXXXXXPQITVNRWVIWSISL 363
                                 S    +                  +  +N+W++W ISL
Sbjct: 314 SDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKRRSKETKINKWIVWGISL 373

Query: 364 TVGVGLGYCIXXXXXXXXXXXXXXXXXG-------DEVTIMED--IHNSPHESPFDNYLR 414
           TVGVG+GYC+                         D V + +D  +    ++   +N   
Sbjct: 374 TVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMGEYDHDLENPFA 433

Query: 415 HLLLAVKRAVKQVNSSFKQYL 435
           H L  +K+ +KQ N + KQ+L
Sbjct: 434 HALYLLKQTLKQWNWAMKQFL 454

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  129 bits (325), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 101/373 (27%), Positives = 171/373 (45%), Gaps = 47/373 (12%)

Query: 40  ILDPHLSVLQLLDRAD-PPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTD- 97
           +LDPHLSVL+LL +    PS +        +   +   SG ++VN SIS SWQ+I+  D 
Sbjct: 41  LLDPHLSVLELLGKTGHSPSPMGQ------SLVTSIDISGHQNVNDSISGSWQAIQPLDL 94

Query: 98  -CSMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAF-------PNSATSIFP-E 148
             S +  +  +   +  ILSSSDTSE+E +   +P+ +            N  +S  P  
Sbjct: 95  GASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGTNVTSSSHPFR 154

Query: 149 APHNL--------EASSLREYQNSEIANPREENDNETVTMSLMNSSNSFVMPKLSLIQQS 200
             H +        E +  +E   ++  +   E D+ T+T SL +S+NSFVMPKLSL Q++
Sbjct: 155 QLHKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKN 214

Query: 201 QKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIFXXXXXXXXXX 260
             F +LI+G+    FY+ IP+ Y  +FE+    +       +Y+ +++IF          
Sbjct: 215 PVFRLLILGRTGSNFYQSIPKEYQSLFELPK--YHDSATFPQYTGIIIIFQELREMVSLL 272

Query: 261 XXVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLN 318
             +  ++    II +CQ GQ  Q+ N+L  + ++  I+L++   V+++ +D+ ++ + L 
Sbjct: 273 NRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQ 332

Query: 319 TLSTEVDSG------------------YETEVGXXXXXXXXXXXXXXXPQITVNRWVIWS 360
            LS E                      Y+                    Q     W  W 
Sbjct: 333 DLSLEYAEDENEEGDDDETTKSRSYYRYKKANNSKRKSPKSNKKPKKKKQRFFTSWFTWG 392

Query: 361 ISLTVGVGLGYCI 373
           IS+T+G+  G C+
Sbjct: 393 ISITIGISFGCCV 405

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  122 bits (306), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 105/394 (26%), Positives = 170/394 (43%), Gaps = 57/394 (14%)

Query: 29  TSSVPLNQRNSILDPHLSVLQLLDRAD-PPSELSSLKHGEIAKPATPRRSGFESVNCSIS 87
           +S V   +   +LDPHLSVL+LL +    PS +    H  +        S    VN SIS
Sbjct: 30  SSEVEAGEDKGLLDPHLSVLELLGKTGHSPSPMG---HSLVTSIDI---SSHHYVNDSIS 83

Query: 88  ESWQSIKHTD--CSMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAF----PNS 141
            SWQ+I   D   S V  +  +   +  ILSSSDTSE+E +   +P+ +           
Sbjct: 84  GSWQAIHPLDLGASFVPERSSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEG 143

Query: 142 ATSIFPEAPHN---------LEASSLREYQNSEIANPRE---------ENDNETVTMSLM 183
           A+   P  P           L A     Y   +  +            E D+ T+T SL 
Sbjct: 144 ASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQDDDDNNVDDDYDDGAYEEDSGTITKSLT 203

Query: 184 NSSNSFVMPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKY 243
           +S+NSFVMPKLSL Q++  F +LI+G+    FY+ IP+ +  +FE+    +       +Y
Sbjct: 204 SSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPK--YHDSTAFPQY 261

Query: 244 SAVMVIFXXXXXXXXXXXXVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNEIRLVYHL 301
           + +++IF            +  ++    II +CQ GQ  Q+ N+L  + ++  I+L+Y  
Sbjct: 262 TGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPP 321

Query: 302 TVMSDHQDVHRLLRYLNTLSTEVD--------------------SGYE--TEVGXXXXXX 339
            V+++ +D+ ++ + L  LS E                      S Y             
Sbjct: 322 VVVTNRRDLKKMFQRLQDLSLEYAEDGDNDDEDNDDEIIHTNSRSYYRNKKANSSKKKSF 381

Query: 340 XXXXXXXXXPQITVNRWVIWSISLTVGVGLGYCI 373
                     Q ++ RW  W +S+T+G+  G C+
Sbjct: 382 KSNKKPKKKKQRSLTRWFTWGVSITIGISFGCCV 415

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  119 bits (297), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 98/380 (25%), Positives = 165/380 (43%), Gaps = 49/380 (12%)

Query: 35  NQRNSILDPHLSVLQLLDRAD-PPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSI 93
            +   +LDPHLSVL+LL +    PS +       I        SG  +VN SIS SWQ+I
Sbjct: 36  GEDKGLLDPHLSVLELLSKTGHSPSPMGQNLVTSI------DISGNHNVNDSISGSWQAI 89

Query: 94  KHTD--CSMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAF----PNSATSIFP 147
           +  D   S +  +  +   +  ILSSSDTSE+E +   +P+ +           A  + P
Sbjct: 90  QPLDLGASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGANVVSP 149

Query: 148 EAPH------------NLEASSLREYQNSEIANPREENDNETVTMSLMNSSNSFVMPKLS 195
             P               E +   E  +    +   E D+ T+T SL +S+NSFVMPKLS
Sbjct: 150 SHPFKQLQKIISLPLPGKEKTPFNEQDDDGDEDEAFEEDSVTITKSLTSSTNSFVMPKLS 209

Query: 196 LIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIFXXXXX 255
           L Q++  F +LI+G+    FY+ IP+ Y  +FE+    +       +Y+ +++IF     
Sbjct: 210 LTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPK--YHDSATFPQYTGIVIIFQELRE 267

Query: 256 XXXXXXXVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRL 313
                  +  ++    +I +CQ GQ  Q+ N+L  + ++  ++L++   V+++ +D+ ++
Sbjct: 268 MVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPPVVVTNKRDLKKM 327

Query: 314 LRYLNTLSTEVDSGYETEVGXXXXXXXXXXXXXXXPQIT--------------------V 353
            + L  LS E       E                  +                       
Sbjct: 328 FQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYCRNKKAENSKKKSPKSNKKPKRKKQKFF 387

Query: 354 NRWVIWSISLTVGVGLGYCI 373
             W  W IS+T+G+  G C+
Sbjct: 388 TSWFTWGISITIGISFGCCV 407

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  115 bits (288), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 103/389 (26%), Positives = 168/389 (43%), Gaps = 68/389 (17%)

Query: 40  ILDPHLSVLQLLDR-ADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTD- 97
           +LDPHLSVL+LL +    PS L        +   +   S   +V  +IS SWQ+I+  D 
Sbjct: 41  LLDPHLSVLELLGKTGSSPSPLGQ------SLVTSIDISNHHNVIDNISGSWQTIQPLDL 94

Query: 98  -CSMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSP---NNFAFPNSATSI-------- 145
             S +  +  +   +  ILSSSDTSE+E D   +P+    N        TS+        
Sbjct: 95  GASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFK 154

Query: 146 -------FPEAPHNLEASSLRE---YQNSEIANPREENDNETVTMSLMNSSNSFVMPKLS 195
                   P  P        +E     +++  N   E D+ T+T SL +S+NSFVMPKLS
Sbjct: 155 QLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLS 214

Query: 196 LIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMN-----KYSAVMVIF 250
           L +++  F +LI+G+    FY+  P+ Y  +FE+       P+  +     +Y+ ++++F
Sbjct: 215 LSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFEL-------PKSHDSTIFPQYTGIVIVF 267

Query: 251 XXXXXXXXXXXXVA--AHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQ 308
                       +   A    II +CQ GQ  Q+ N+L  + K++ I+L+Y   V ++ +
Sbjct: 268 QELREMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATNRK 327

Query: 309 DVHRLLRYLNTLSTEV----------------------DSGYE--TEVGXXXXXXXXXXX 344
           D+ ++ + L  LS E                        S Y                  
Sbjct: 328 DLKKMFQRLQDLSLEYVEDEKNEDEDEDNDDEIIQPYSRSYYRSKKGGSSKKKSSKSNKK 387

Query: 345 XXXXPQITVNRWVIWSISLTVGVGLGYCI 373
                Q +  RW  W +S+T+G+  G C+
Sbjct: 388 SKKKKQRSSTRWFTWGVSITIGISFGCCV 416

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 94/205 (45%), Gaps = 32/205 (15%)

Query: 189 FVMPKLSLIQQ-SQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVM 247
           FVMPKLSL  + SQ   +L+VG+ ++RF++DIPR Y + F +       P E   Y  ++
Sbjct: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSS--DPSEFQNYIGIV 252

Query: 248 VIFXXXXXXXXXXXXVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMS 305
           ++F            +  +     II +CQ GQ+ ++ NIL  + K++ I L Y    ++
Sbjct: 253 IVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIA 312

Query: 306 DHQDVHRLLRY----LNTLSTEVD---------------SGYETEVGXXXXXXXXXXXXX 346
           + + + +L ++    +N L  E D               SGY                  
Sbjct: 313 NEKSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSDETSGYRKN--------NRRKKHG 364

Query: 347 XXPQITVNRWVIWSISLTVGVGLGY 371
             P    ++W+ W ISLT+GV +GY
Sbjct: 365 GKPSTNYSKWITWGISLTIGVSIGY 389

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 33/70 (47%), Gaps = 22/70 (31%)

Query: 38  NSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTD 97
           +SILDPH SV++LL R    SE+             P  SG       + ESWQ I+ +D
Sbjct: 27  SSILDPHHSVMELLQRQMEGSEV-------------PSESGV------LGESWQQIRESD 67

Query: 98  CSMVNTQGDA 107
              V   GD+
Sbjct: 68  ---VGDGGDS 74

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 100/453 (22%), Positives = 191/453 (42%), Gaps = 68/453 (15%)

Query: 38  NSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTD 97
           NS+LDPHLSVL+LL++       S  + G    P + R  G   +   +SESW +++  +
Sbjct: 6   NSVLDPHLSVLELLEK-------SCERGGHAEAPGSSRNKGAGQIQ--LSESWCTVERDE 56

Query: 98  CSMVNTQGDATHQHAGILSSSDTSED-EPDAQLSPSPNNFAFPNSATSIFPEAPHNLEAS 156
            S +     +   + G+LSSSDTSE+ EP+             ++             A 
Sbjct: 57  LSAMERSA-SQQTNNGVLSSSDTSEEGEPEQGSPGDGEGGGVADTRM-----------AR 104

Query: 157 SLREYQNSEIANPREENDNETVTMSLMNSSNSFVMPKL-----------SLIQQSQKFCI 205
                Q++       ++D+ TV+ SL +SSNSF+MPKL           S   Q++ F +
Sbjct: 105 PAMSLQSTSSTLDGVDDDSATVSKSLTSSSNSFIMPKLYTTVAGAPSTVSTALQTRCFKV 164

Query: 206 LIVGKPAQRFYRD-IPRAYHKMFE----VRDVGHLSPREMNKYSAVMVIFXXXXXXXXXX 260
            ++G+ A +F ++ +P  +   FE    V D+   + R+      ++++           
Sbjct: 165 AVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADRQ-----GILIVVQEVRELISLL 219

Query: 261 XXV--AAHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLN 318
             V  A     ++AV  R +Q Q+ N+L  +++   + L++    +S+++ + ++  +++
Sbjct: 220 NRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRLVSLLHPPVPLSNNEALDKMFHFVD 279

Query: 319 TLSTEVDSG-------YETEVGXXXXXXXXXXXXXXXPQITVNRWVIWSISLTVGVGLG- 370
            L+ + +           T+                 P+ T  RW++W +S+++G+G G 
Sbjct: 280 NLARQQEPAGVIHNDPQTTQEQHPDHNEDDPHRGPSKPEGTFKRWLLWGVSISLGIGAGY 339

Query: 371 YCIXXXXXXXXXXXXXXXXXGDEVTIMEDIHNS-----------PHESPFDNYLRHLLLA 419
           YC+                  D          +            H++     LRH L  
Sbjct: 340 YCVSYVVSSSMCVSCFNFRHTDHTLAATTSTAAAAAAAATPSGIDHDADSHTTLRHCLSI 399

Query: 420 VKRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEW 452
           VK ++K+  +  KQ +     P  ++ R  +EW
Sbjct: 400 VKNSLKRATAFVKQAMHK---PFHYIDR-SQEW 428

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 87/171 (50%), Gaps = 17/171 (9%)

Query: 163 NSEIANPREENDNETVTMSLMNSSNSFVMPKLSLIQQSQKFCILIVGKPAQ-RFYRDIPR 221
           NS I N     +N  +T S+ +SSNSF+MPKLS     +KF ILI+G      FY++IP 
Sbjct: 313 NSTITNSY---NNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPT 369

Query: 222 AYHKMFEVRDVGHLSPREMN----KYSAVMVIFXXXXXXXXXXXXVAAHNSN---IIAVC 274
           +Y  +FE      L P   +     Y+ + ++             +  ++ N   II +C
Sbjct: 370 SYKYLFE------LPPNNFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPIC 423

Query: 275 QRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLNTLSTEVD 325
           ++GQ  ++ NIL  Y K+ ++ L+Y   V ++   ++ L  +LN LS  V+
Sbjct: 424 EKGQINEVKNILKPYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVE 474

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 18/21 (85%)

Query: 353 VNRWVIWSISLTVGVGLGYCI 373
           + + + W++SL+VGVGLG+C+
Sbjct: 610 LKKIIYWTVSLSVGVGLGFCL 630

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 90/315 (28%), Positives = 146/315 (46%), Gaps = 67/315 (21%)

Query: 39  SILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTDC 98
           S+LDPHLSVL++L+R D           +    A+ R          IS SWQ+I+    
Sbjct: 37  SLLDPHLSVLEMLERKD----------NDTVMEASSR----------ISRSWQNIESPAD 76

Query: 99  S--MVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEAS 156
           S  +++ +         ILSSS  + DE   +++         NSA           E S
Sbjct: 77  SKQLLSAKSSQVSNLVSILSSSSDTSDEEVDRINS-------LNSAG----------EGS 119

Query: 157 SLREYQN-SEIANP----------REENDN---ETVTMSLMNSS---NSFVMP---KLSL 196
           S + Y N S + NP            +ND+    T+T SL +SS   NSFVMP     S 
Sbjct: 120 S-KNYNNPSPLQNPIYLPEFTDVTAGDNDDGIASTITKSLTSSSTISNSFVMPTLSLSSS 178

Query: 197 IQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEV-RDVGHLSPREMNKYSAVMVIFXXXXX 255
             Q +KF ILI G+    FYR IP+ Y  +F V   +  L+  EM+ ++A ++IF     
Sbjct: 179 QSQQRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKE 238

Query: 256 XXXXXXXVAAHNS------NIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQD 309
                  ++   S       II +CQ GQ+ ++ +IL  + K+N + L+  + +++D + 
Sbjct: 239 LVSLLNRISEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLLSPIIIINDERA 298

Query: 310 VHRLLRYLNTLSTEV 324
           + ++ + + ++S  V
Sbjct: 299 LLKMFKTMQSISKTV 313

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 18/20 (90%)

Query: 354 NRWVIWSISLTVGVGLGYCI 373
           N+WV+WSISLTVG G+GY I
Sbjct: 380 NKWVVWSISLTVGAGMGYII 399

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 77/144 (53%), Gaps = 11/144 (7%)

Query: 189 FVMPKLSLIQQ------SQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNK 242
           F+MP+LSL ++      + +F ILIVG+ + + ++ IP  +  +F+++    ++  E  K
Sbjct: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDIN--EYQK 281

Query: 243 YSAVMVIFXXXXXXXXXXXXVAAHNSN---IIAVCQRGQQQQISNILNRYSKSNEIRLVY 299
           ++A++V+             ++        +IA+C++    Q  N+L  Y +++ I L+Y
Sbjct: 282 FTAILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLY 341

Query: 300 HLTVMSDHQDVHRLLRYLNTLSTE 323
              V+S+ +++ R+L +L   S +
Sbjct: 342 QPFVISNTEELDRMLVFLKETSIK 365

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 19/20 (95%)

Query: 354 NRWVIWSISLTVGVGLGYCI 373
           N+W+IW ISL++GVG+GYCI
Sbjct: 435 NKWIIWGISLSIGVGIGYCI 454

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 28/100 (28%)

Query: 38  NSILDPHLSVLQLLDRA-----------------DPPSELSSLK-HGEIAKPATPRRSGF 79
           NSILDPHLSVL+LL+R                  D   E+++++ + E +  +TP     
Sbjct: 28  NSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTP----- 82

Query: 80  ESVNCSISESWQSIKHTDC--SMVNTQGDATHQH--AGIL 115
            SV   IS+SW +I+  D   S+ N       Q   AGIL
Sbjct: 83  -SVGDIISQSWHTIQRRDLEESLHNNSNKLVLQSATAGIL 121

>TBLA0J00270 Chr10 complement(47475..49067) [1593 bp, 530 aa] {ON}
           Anc_7.513 YER025W
          Length = 530

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 12  SRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHLSVLQLLDRADPPSELSSLKHG 66
           S QL+ N  +  E  F   ++P+  R+ ++ PHL V++  D   P +E+  LK G
Sbjct: 286 SAQLKYNIDAVNE--FIVKTIPVPPRDFMVSPHLIVIRSFDVNKPGTEIDDLKGG 338

>KLLA0D10571g Chr4 complement(898296..899858) [1563 bp, 520 aa] {ON}
           highly similar to uniprot|P32481 Saccharomyces
           cerevisiae YER025W GCD11 Gamma subunit of the
           translation initiation factor eIF2 involved in the
           identification of the start codon binds GTP when forming
           the ternary complex with GTP and tRNAi-Met
          Length = 520

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 12  SRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHLSVLQLLDRADPPSELSSLKHG 66
           S QL+ N  +  E  F   S+P+ QR+ +  P L V++  D   P +E+  LK G
Sbjct: 277 SAQLKYNIDAVNE--FIVKSIPVPQRDFLASPRLIVIRSFDVNKPGAEIEDLKGG 329

>Ecym_1081 Chr1 (158430..160820) [2391 bp, 796 aa] {ON} similar to
           Ashbya gossypii AFR673C
          Length = 796

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 97  DCSMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEAS 156
           D + V T GD      GI +S D  +DEP+ +L     N+A  + A SI         AS
Sbjct: 231 DYNKVETLGDDMEVDLGIFTSGD--DDEPEGKLYQQKFNYASLDCAASIVKTNSEAHGAS 288

Query: 157 S-LREYQNSEIANP 169
           S L E ++  + NP
Sbjct: 289 SILYENKDKYLLNP 302

>CAGL0I08327g Chr9 (812123..813679) [1557 bp, 518 aa] {ON} highly
           similar to uniprot|P32481 Saccharomyces cerevisiae
           YER025w GCD11
          Length = 518

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 12  SRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHLSVLQLLDRADPPSELSSLKHG 66
           S QL+ N  +  E  F   ++P+  R+ +L P L V++  D   P +E+  LK G
Sbjct: 277 SAQLKYNIDAVNE--FIVKTIPVPPRDFMLSPRLIVIRSFDVNKPGAEIDDLKGG 329

>CAGL0F05665g Chr6 complement(567360..569354) [1995 bp, 664 aa] {ON}
           highly similar to uniprot|P22213 Saccharomyces
           cerevisiae YDR189w SLY1
          Length = 664

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 121 SEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEASSLREYQN 163
           +E  P+ Q    P++F +  +A   FPEA  N+E S+L EY+N
Sbjct: 306 NETSPEKQYDIEPHDFFWLQNAHLPFPEAAENVE-SALNEYKN 347

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.129    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,533,948
Number of extensions: 1774634
Number of successful extensions: 7266
Number of sequences better than 10.0: 84
Number of HSP's gapped: 7526
Number of HSP's successfully gapped: 100
Length of query: 472
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 359
Effective length of database: 40,524,141
Effective search space: 14548166619
Effective search space used: 14548166619
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)