Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E01100g5.700ON117794844410.0
Kwal_55.197075.700ON114394832230.0
SAKL0E14872g5.700ON114095523930.0
NDAI0F003105.700ON125998922880.0
KLLA0A00638g5.700ON115595922520.0
Skud_9.215.700ON122196722300.0
ZYRO0G06644g5.700ON116694721960.0
NCAS0G002505.700ON118374519340.0
KNAG0L021105.700ON120074219110.0
CAGL0H06567g5.700ON116969918920.0
YIL147C (SLN1)5.700ON122072318820.0
KAFR0D022405.700ON118772818760.0
Smik_9.225.700ON123073518590.0
Suva_9.415.700ON121972918560.0
TDEL0B022105.700ON109574918030.0
TPHA0D045905.700ON112770417520.0
Kpol_2001.745.700ON111370016950.0
TPHA0E002505.700ON106870815900.0
Kpol_1043.685.700ON104268515590.0
Ecym_40205.700ON112569214990.0
AFR284W5.700ON110374514480.0
TBLA0E021005.700ON114071713631e-168
TBLA0I016805.700ON12142588022e-88
ADL388W4.385ON4821291673e-11
Ecym_74744.385ON4961211665e-11
CAGL0F09097g4.385ON6301401658e-11
KAFR0B069904.385ON5451211612e-10
NCAS0A064504.385ON6091211622e-10
TDEL0D003204.385ON5471211612e-10
Kpol_265.24.385ON5491211594e-10
TBLA0A107004.385ON5871201594e-10
Smik_8.2964.385ON6251311594e-10
KNAG0M001804.385ON6151201577e-10
SAKL0B12408g4.385ON4651211567e-10
KLLA0A10219g4.385ON4751201558e-10
Kwal_33.152885.230ON5871701569e-10
TPHA0C001504.385ON5101211551e-09
Suva_15.4124.385ON6171211551e-09
ZYRO0G00484g4.385ON6471211551e-09
Skud_8.2734.385ON6231211551e-09
NDAI0D034304.385ON5971171551e-09
KLTH0D17182g4.385ON4641211541e-09
Kwal_47.167704.385ON4611211522e-09
YHR206W (SKN7)4.385ON6221211513e-09
KLTH0B02684g5.230ON5951671479e-09
KNAG0B051405.230ON6481411442e-08
TDEL0E039805.230ON7301431443e-08
CAGL0D02882g5.230ON6671881408e-08
Suva_10.845.230ON6951911381e-07
NCAS0D029005.230ON7621521363e-07
Ecym_50775.230ON7951741344e-07
KAFR0J007005.230ON6201701335e-07
ZYRO0A11154g5.230ON7761591345e-07
YLR006C (SSK1)5.230ON7121741319e-07
ADR343C5.230ON7491711292e-06
NDAI0I020005.230ON8901641292e-06
Skud_12.725.230ON7021741273e-06
Smik_12.685.230ON7121741264e-06
Kpol_1004.45.230ON7141611237e-06
KLLA0E09505g5.230ON635981131e-04
SAKL0G12100g5.230ON738951112e-04
TPHA0N008505.230ON6701481068e-04
TBLA0D031705.230ON7651601060.001
Klac_YGOB_Anc_8.348.34ON15711101000.005
SAKL0B01210g8.34ON1588110970.011
Suva_6.268.34ON175399960.014
ACR218W8.34ON1569134950.020
ZYRO0F03014g8.34ON1604136950.020
NDAI0G031108.34ON1707147940.028
KLTH0E08052g4.117ON1238131920.045
TBLA0B015507.222ON394110910.045
Skud_6.388.34ON175890920.048
TDEL0C005908.34ON160289910.060
Kpol_1035.408.34ON1517113910.060
YFL033C (RIM15)8.34ON177089910.066
Smik_6.468.34ON176090890.096
CAGL0K12562g8.34ON1682137890.100
TPHA0D003608.34ON1536126840.40
TBLA0G034508.34ON197289830.45
SAKL0F08184g7.222ON41281820.48
Ecym_15088.34ON1694134820.62
Kwal_47.181517.222ON414109800.81
KLTH0G18612g8.34ON1524130810.83
TBLA0B093202.419ON72364801.0
TBLA0E049804.385ON79192781.8
NCAS0C044303.22ON131143745.5
KAFR0C035208.34ON145075746.2
KNAG0D017507.222ON40994727.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E01100g
         (1177 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...  1715   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1246   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...   926   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   885   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   872   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   863   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...   850   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   749   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   740   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   733   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   729   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   727   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   720   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   719   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   699   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   679   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   657   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   617   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   605   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   582   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   562   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   529   e-168
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   313   2e-88
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    69   3e-11
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    69   5e-11
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    68   8e-11
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    67   2e-10
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    67   2e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    67   2e-10
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    66   4e-10
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    66   4e-10
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    66   4e-10
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    65   7e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    65   7e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    64   8e-10
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    65   9e-10
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    64   1e-09
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    64   1e-09
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    64   1e-09
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    64   1e-09
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     64   1e-09
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    64   1e-09
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    63   2e-09
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    63   3e-09
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    61   9e-09
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    60   2e-08
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    60   3e-08
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    59   8e-08
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    58   1e-07
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    57   3e-07
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    56   4e-07
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    56   5e-07
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    56   5e-07
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    55   9e-07
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    54   2e-06
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    54   2e-06
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    54   3e-06
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    53   4e-06
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    52   7e-06
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    48   1e-04
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    47   2e-04
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    45   8e-04
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    45   0.001
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    43   0.005
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    42   0.011
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    42   0.014
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    41   0.020
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    41   0.020
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    41   0.028
KLTH0E08052g Chr5 (739063..742779) [3717 bp, 1238 aa] {ON} simil...    40   0.045
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    40   0.045
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    40   0.048
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    40   0.060
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    40   0.060
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    40   0.066
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    39   0.096
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    39   0.100
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    37   0.40 
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    37   0.45 
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    36   0.48 
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    36   0.62 
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    35   0.81 
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    36   0.83 
TBLA0B09320 Chr2 complement(2213166..2215337) [2172 bp, 723 aa] ...    35   1.0  
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    35   1.8  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    33   5.5  
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    33   6.2  
KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {O...    32   7.1  

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score = 1715 bits (4441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 858/948 (90%), Positives = 858/948 (90%)

Query: 1   MARLKKFDLGAYAKRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMR 60
           MARLKKFDLGAYAKRKLKPPFLISIR                      GVYFTSSFKSMR
Sbjct: 1   MARLKKFDLGAYAKRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMR 60

Query: 61  AERLYVASQLKASQIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLD 120
           AERLYVASQLKASQIDQN           STRDVLQNALTQYLAGNTTTENWADAVTTLD
Sbjct: 61  AERLYVASQLKASQIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLD 120

Query: 121 KFLGSSNLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGM 180
           KFLGSSNLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGM
Sbjct: 121 KFLGSSNLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGM 180

Query: 181 LTDPVLNDTGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSV 240
           LTDPVLNDTGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSV
Sbjct: 181 LTDPVLNDTGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSV 240

Query: 241 ILVSTVYDNRELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLY 300
           ILVSTVYDNRELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLY
Sbjct: 241 ILVSTVYDNRELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLY 300

Query: 301 SKAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSH 360
           SKAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLAR                 FPLSH
Sbjct: 301 SKAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSH 360

Query: 361 WAVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARS 420
           WAVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARS
Sbjct: 361 WAVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARS 420

Query: 421 SKHKYIPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYIT 480
           SKHKYIPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYIT
Sbjct: 421 SKHKYIPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYIT 480

Query: 481 STNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE 540
           STNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE
Sbjct: 481 STNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE 540

Query: 541 GANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTE 600
           GANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTE
Sbjct: 541 GANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTE 600

Query: 601 LLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGD 660
           LLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGD
Sbjct: 601 LLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGD 660

Query: 661 SNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKES 720
           SNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKES
Sbjct: 661 SNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKES 720

Query: 721 STLGPTEKGGIKDVTESASSSNAXXXXXXXXXXXXNGSKAETTSGKLTXXXXXXXXXXXX 780
           STLGPTEKGGIKDVTESASSSNA            NGSKAETTSGKLT            
Sbjct: 721 STLGPTEKGGIKDVTESASSSNATWPPSPSTSETSNGSKAETTSGKLTESSEEDEKEEKL 780

Query: 781 XXXXXXXXXXXXXXXXYRGEAEVSGKDDTNNETQREDSNENQNEDARSIESENASSYDDA 840
                           YRGEAEVSGKDDTNNETQREDSNENQNEDARSIESENASSYDDA
Sbjct: 781 DHDDKDEGDEESEEEEYRGEAEVSGKDDTNNETQREDSNENQNEDARSIESENASSYDDA 840

Query: 841 IFHSRLRKGNSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSR 900
           IFHSRLRKGNSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSR
Sbjct: 841 IFHSRLRKGNSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSR 900

Query: 901 QYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELC 948
           QYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELC
Sbjct: 901 QYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELC 948

 Score =  357 bits (915), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 166/166 (100%), Positives = 166/166 (100%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ 1071
            DRPFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ
Sbjct: 1012 DRPFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ 1071

Query: 1072 DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIK 1131
            DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIK
Sbjct: 1072 DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIK 1131

Query: 1132 ECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGKTEGQA 1177
            ECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGKTEGQA
Sbjct: 1132 ECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGKTEGQA 1177

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
           YIL147C (SLN1) - histidine kinase osmosensor that
           regulates an osmosensing MAP kinase cascade and is
           similar to bacterial two-component regulators [contig
           159] FULL
          Length = 1143

 Score = 1246 bits (3223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/948 (67%), Positives = 717/948 (75%), Gaps = 45/948 (4%)

Query: 1   MARLKKFDLGAYAKRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMR 60
           M RL   DLGA+ +R+L+ P ++SIR                      GVYFTSSFKS+R
Sbjct: 1   MVRLNNIDLGAFFQRRLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLR 60

Query: 61  AERLYVASQLKASQIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLD 120
           AERL+VA+QLK+SQIDQN           STRD+LQNALTQYLAGNT+TENW+DA TTLD
Sbjct: 61  AERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLD 120

Query: 121 KFLGSSNLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGM 180
           KFLGSSNLFSLARVYDSSFQDVLN SNN SGNL+PE++LTQLFPLST+V+LPSSLE  GM
Sbjct: 121 KFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGM 180

Query: 181 LTDPVLNDTGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSV 240
           LTDPVLN + YLMSMSLPIFANPSIILST+KVYGYITVVISAEGLK+V+NDTTAL+DSSV
Sbjct: 181 LTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSV 240

Query: 241 ILVSTVYDNRELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLY 300
           I+VSTVYD+ ELAGYHLVFPPY M  D+I++ Y I N SFL DA K  KGGSIKST F  
Sbjct: 241 IIVSTVYDDHELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFN 300

Query: 301 SKAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSH 360
           +K +A+GYSPC+S L QWVAIITQPE+ FL PSTRLA+                 FPLSH
Sbjct: 301 NKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSH 360

Query: 361 WAVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARS 420
           WAVQPIVRLQKATEIITAGRGLRSDN STL+SHKR+STAESFSS     S+RRSGSVAR+
Sbjct: 361 WAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARA 420

Query: 421 SKHKYIPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYIT 480
            + KYIP+S+K     N  + I     EN ED  +QKV+SPTP S+ +E ++ +SERYIT
Sbjct: 421 GRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYIT 480

Query: 481 STNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE 540
           STNLIEARVP Y RLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE
Sbjct: 481 STNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE 540

Query: 541 GANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTE 600
           GANEAKTVFIANISHELRTPLNGILGMTAIAMAE D  KVKSSLKLIFRSGELLLHIMTE
Sbjct: 541 GANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTE 600

Query: 601 LLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGD 660
           LLTFSKNVLKRTKLEERDF + +IALQVESIFGKLAKDQHVNLTISI+PN+LR+MVLWGD
Sbjct: 601 LLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGD 660

Query: 661 SNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKES 720
           SNRIVQIVMNLVSNALKFTPVDG+V+VKF LLGEYDE K+    +    V+P  ES   S
Sbjct: 661 SNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSS 720

Query: 721 STLGPTEKGGIKDVTESASSSNAXXXXXXXXXXXXNGSKAETTSGKLTXXXXXXXXXXXX 780
                         TE+    NA              S AE+T  K              
Sbjct: 721 --------------TEAKDEKNAESCVDSDTNVLSLPSTAESTDEK-------------- 752

Query: 781 XXXXXXXXXXXXXXXXYRGEAEVSGKDDTNNETQREDSNENQNEDARSIESENASSYDDA 840
                            R E+E       ++E       +++NED +SI S N SSYDDA
Sbjct: 753 -----------NVKIGQRSESEA-----IDSEAIESSDEDDENEDTKSIGSGNTSSYDDA 796

Query: 841 IFHSRLRKGNSG-ENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLS 899
           IF +RLRK +S  ENE+GR LE P++  I+MEV DTGPGI+PAL ESVFEPFVQGDQTLS
Sbjct: 797 IFQTRLRKDSSNEENEEGRALESPKKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLS 856

Query: 900 RQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKEL 947
           RQYGGTGLGLSICRQLA MM+G+M LDS+VGVGSKF+FTVPLTQTKEL
Sbjct: 857 RQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKEL 904

 Score =  272 bits (696), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 146/164 (89%), Gaps = 1/164 (0%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ 1071
            DRPFLQSTGTALST  VTT+S+A++ K+LVAEDNNVNQEVIKRMLNLEGL+DV+LACDGQ
Sbjct: 979  DRPFLQSTGTALSTTLVTTSSLADRRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQ 1038

Query: 1072 DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIK 1131
            DAFDKVKA++  GK YDLIFMDVQMPRVDGL+ATRMIR EL Y+HPIVALTA+ADD NIK
Sbjct: 1039 DAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIK 1098

Query: 1132 ECIDAGMNGFLAKPIRRPKIKEILSEYCPTYF-KADGEKKGKTE 1174
            EC+DAGMNGFL+KPI+RPKIK IL EYCP    + +GE K ++E
Sbjct: 1099 ECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKEGEVKNESE 1142

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON}
           similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1140

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/955 (56%), Positives = 647/955 (67%), Gaps = 68/955 (7%)

Query: 11  AYAKRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQL 70
            + + KLKPPF + IR                      GVYFT+++KS+RA+RL+VA+QL
Sbjct: 5   GHLRSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQL 64

Query: 71  KASQIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFS 130
           K+SQIDQN           STRD LQ++L +Y AGNTT ENW++A   L+KFLGSS+LFS
Sbjct: 65  KSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFS 124

Query: 131 LARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTG 190
           +AR+YDS+F+ VLNA+NN SGNLVPE VLT LFPLST+  L SSL+  G+LTDPVLNDT 
Sbjct: 125 VARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTV 184

Query: 191 YLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNR 250
           Y+MSMSLPIFA+PSI+L+ S++ GYITVV+SAE LK VFNDTTAL+ S V ++S  Y N+
Sbjct: 185 YVMSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQ 244

Query: 251 EL-AGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYS 309
            L   YH VFPP+G+ +DIID  +TI N SF+  AF   K GS+K T F Y K VA+GYS
Sbjct: 245 SLPVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYS 304

Query: 310 PCSSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRL 369
           PC    VQWVA+I+QPE+ FL PSTRL                   FPL+HWAV+PIVRL
Sbjct: 305 PCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRL 364

Query: 370 QKATEIITAGRGLRSDNGSTLYSH-----KRSSTAESFSSALHPASIRRSGSVARSSKHK 424
           QKATEIITA RGLRS N S   S      KR ST+ S  S     + R      R + H 
Sbjct: 365 QKATEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPH---ERDNGHS 421

Query: 425 YIPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTNL 484
              E    T N  D +E +   +E     AL   +  TP S  ++Q S +S+ ++ STNL
Sbjct: 422 NF-ELHHRTSNSVDSQEAR---MELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNL 477

Query: 485 IEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANE 544
           I+ARVP Y RLFSDELSELT+TFNTMTDELDRHYALLEDRVRART+QLEAAKIEAE ANE
Sbjct: 478 IDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANE 537

Query: 545 AKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTF 604
           AKTVFIANISHELRTPLNGILGMTAI+MAE DMQKV++SLKLIFRSGELLLHI+TELLTF
Sbjct: 538 AKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTF 597

Query: 605 SKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRI 664
           SKNVL+RTKLEER+F + ++ALQV+SIFGKLAKDQHVNL+I + PNV+RTM+LWGDSNRI
Sbjct: 598 SKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRI 657

Query: 665 VQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQE------SEK 718
           +QIVMNLVSNALKF+PVDG+V V+  LLGEYD  K+ +  ++   + P  E      S+ 
Sbjct: 658 IQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKS 717

Query: 719 ESSTLGPTEKGGIKDVTESASSSNAXXXXXXXXXXXXNGSKAETTSGKLTXXXXXXXXXX 778
             STL  T+   I+    S SS +               S   ++ GK            
Sbjct: 718 SLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIA-----SSDVSSSDGK------------ 760

Query: 779 XXXXXXXXXXXXXXXXXXYRGEAEVSGKDDTNNETQREDSNENQNEDARSIESENASSYD 838
                                E+E     DT+  +  E S      D+ S+ S N SSYD
Sbjct: 761 --------------------DESEADTDTDTDKRSNSEIS------DSLSLVSSNNSSYD 794

Query: 839 DAIFHSRLRK----GNSGENED--GRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFV 892
           DAI H++LRK    GN  ++ D  GR LE  +   IA+EV+DTGPGIEPAL ESVFEPFV
Sbjct: 795 DAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFV 854

Query: 893 QGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKEL 947
           QGDQTLSRQYGGTGLGLSICRQLA MM G+M L+SKVGVGSKFTFTVPLTQT+E+
Sbjct: 855 QGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREV 909

 Score =  249 bits (635), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 134/162 (82%), Gaps = 1/162 (0%)

Query: 1012 DRPFLQSTGTALSTRSVTTT-SVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDG 1070
            DRPFLQSTGTA STRS+TT  S+    K+LVAEDNNVNQEV+KRMLNLEGL D+DLACDG
Sbjct: 979  DRPFLQSTGTATSTRSITTVKSLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDG 1038

Query: 1071 QDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNI 1130
            Q+AFDKVKA  EA   Y +IFMDVQMPRVDGL +T+MIR EL Y+HPIVALTA+ADD NI
Sbjct: 1039 QEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNI 1098

Query: 1131 KECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGK 1172
            K C+D+GMNGFL+KPI+RPK+K +LSE+CP + +     K K
Sbjct: 1099 KVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDFVEKRNSNKAK 1140

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/989 (50%), Positives = 633/989 (64%), Gaps = 91/989 (9%)

Query: 17  LKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKASQID 76
           LKPPF I IR                      GVYFT+++K++R++RLY+A+QLK+SQID
Sbjct: 9   LKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQID 68

Query: 77  QNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYD 136
           Q            S+RD LQ ALT Y+AGN + ENWAD+ + L KFL SSNLFS+A+VYD
Sbjct: 69  QTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYD 128

Query: 137 SSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMS 196
           +SF  VLN +NN +G+ +P+S+L +L PLSTN+ L SSLE  G+LTDPVLN + YLMSMS
Sbjct: 129 ASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMS 188

Query: 197 LPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDN-RELAGY 255
           LPIFANPS+IL+ S+VYGY+TVV+SAEGL+TVFNDTTALE S+V +VS VY+N   L  Y
Sbjct: 189 LPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAY 248

Query: 256 HLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDL 315
             VF P G PS II+  Y + N SFL  A ++ KGGS+KST F YSK VAIGYSPC+   
Sbjct: 249 RFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSF 308

Query: 316 VQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQKATEI 375
           V WVA+++Q ES FL PST+LA+                 FPL+HWAV+PIVRLQKATE+
Sbjct: 309 VNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATEL 368

Query: 376 ITAGRG------------------LRSDNGSTLYSHKRSSTAESFSS--ALHPASIRRSG 415
           I+ GRG                  L S N S   +   +S+ + ++    ++P    +  
Sbjct: 369 ISEGRGLKSTNPDSRSVSRNNSLKLPSRNTSHYRNRSSASSVQQYTGEKQIYPTHSYQHN 428

Query: 416 SVARSSKHKYIPESAKGT-----------------------------LNKNDFEEIQPDG 446
           ++   S  +  P     +                             L+ N+F   Q D 
Sbjct: 429 TIRNMSPQRLSPSPLGLSINRHNHNNDINNNNNNNNNISPDNNLNLPLHGNNF---QSDS 485

Query: 447 IEN-NEDAALQKVHSPTPGSLFSEQR--SARSERYITSTNLIEARVPTYNRLFSDELSEL 503
           + N +      ++   +   +FS+    S +S    TS NLIEARVP Y RLFSDELS+L
Sbjct: 486 VSNLSPRQGTPELRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDL 545

Query: 504 TETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNG 563
           T+TFNTMTD LD+HYALLEDRVRART+QLEAAKIEAE ANEAKTVFIANISHELRTPLNG
Sbjct: 546 TDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNG 605

Query: 564 ILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHE 623
           ILGMTAI+M E D+ K++SSLKLIFRSGELLLHI+TELLTFSKNVLKRT LE+RDF + +
Sbjct: 606 ILGMTAISMEETDISKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITD 665

Query: 624 IALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDG 683
           +ALQ++SIFGK+AKDQ V L+I++ PN +RTMVL+GDSNRI+QIVMNLVSNALKFTPVDG
Sbjct: 666 VALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDG 725

Query: 684 RVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKESSTLGPTEKGGIKDVTESASSSNA 743
           +VNVK  L+GEYDE+ ++   F    V      ++ +  LG +    I+   ES  S  +
Sbjct: 726 KVNVKVKLIGEYDEALSAKNNFKEVYV------KQGTELLGCSNP--IEKTNESIPSPKS 777

Query: 744 XXXXXXXXXXXXNGSKAETTSGKLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRGEAEV 803
                       N + + TTSGK T                               +AE 
Sbjct: 778 -----------ENNNSSSTTSGKDTTNSETSFEDEKSADDLDDEKIATK-------DAEN 819

Query: 804 SGKDDTNNETQREDSNENQNEDARSIESENASSYDDAIFHSRLRKG----NSGENED-GR 858
              DDT N  ++ DS      D  S+ S + SSYDDAIF+S+ +K     +  EN D G 
Sbjct: 820 ENTDDTENLDEQTDS----VCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGV 875

Query: 859 PLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAM 918
            +E P+   I + V+DTGPGI+  LQESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA M
Sbjct: 876 LIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANM 935

Query: 919 MNGSMSLDSKVGVGSKFTFTVPLTQTKEL 947
           M+G+M L S+VGVGS FTFTVPL QT+E+
Sbjct: 936 MHGTMKLKSEVGVGSTFTFTVPLKQTREI 964

 Score =  230 bits (587), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 104/158 (65%), Positives = 130/158 (82%), Gaps = 7/158 (4%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANK-------CKVLVAEDNNVNQEVIKRMLNLEGLDDV 1064
            DRPFLQSTGTA S+R+V   S +NK        K+LVAEDN+VNQEVIKRMLNLEG++ +
Sbjct: 1097 DRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGVNKI 1156

Query: 1065 DLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAY 1124
            DLACDGQ+AFDKVK  +E    Y++IFMDVQMP+VDGL +T+MIR +L Y HPIVALTA+
Sbjct: 1157 DLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTAF 1216

Query: 1125 ADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTY 1162
            ADD NIKEC+++GMNGFL+KPI+RPK++ I+ EYCP +
Sbjct: 1217 ADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGW 1254

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
           similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1155

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/959 (51%), Positives = 625/959 (65%), Gaps = 68/959 (7%)

Query: 14  KRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKAS 73
           + +  PPF + +R                      GVYFT+++KS+RAERL VA+QLK+S
Sbjct: 15  RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74

Query: 74  QIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLAR 133
           Q+DQN           STRD LQ+AL  + AGN++ +NW  A  +L+KFLGSS LFS AR
Sbjct: 75  QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134

Query: 134 VYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLM 193
           VYD+SF  V+N++NN SG+ +PE+VL +LFPLS    L SSL   G++TDPV N T YL+
Sbjct: 135 VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194

Query: 194 SMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYD-NREL 252
           SMSLP+  NPSIIL+T+++ GYITV+ SAE LK V NDT AL+ SSV ++S V+D N  L
Sbjct: 195 SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254

Query: 253 AGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCS 312
            GYH VFPP+G  S      + I N +F+ DAF+  K GS+  T+ +  + +A+GYSP +
Sbjct: 255 TGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPT 314

Query: 313 SDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQKA 372
             LV WVA++TQPE  FL P+ RL +                 FP++HWAVQPIVRLQKA
Sbjct: 315 FKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKA 374

Query: 373 TEIITAGRGLR-------SD-NGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHK 424
           TEIIT+GR L+       SD N +  +S  RS++ ++    L   S+ + G+ +    H 
Sbjct: 375 TEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTK-GTPSNYLNHN 433

Query: 425 Y--IPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSL-FSEQRSA-RSERYIT 480
           Y   P S      + D   +     +           S T GS  FS   S+  SERYI 
Sbjct: 434 YNVFPPS------RTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIK 487

Query: 481 STNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE 540
           STNL+EA VP Y R F DELSELT+TFNTMTDELDRHYALLE+RVRART+QLEAAKI+AE
Sbjct: 488 STNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAE 547

Query: 541 GANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTE 600
            ANEAKTVFIANISHELRTPLNGILGMTAIAMAE DMQKV++SLKLIFRSGELLLHI+TE
Sbjct: 548 SANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTE 607

Query: 601 LLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGD 660
           LLTFSKNVLKRTKLEERDF+V +IALQ++SIFGKLAKDQHV L+I++ PN +RT+VLWGD
Sbjct: 608 LLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGD 667

Query: 661 SNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKE- 719
           SNRI+QIVMNLVSNALKFTPVDG+V+V+  LLGEYD  ++ +  +    VVP  E+  + 
Sbjct: 668 SNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDF 727

Query: 720 SSTLGPTEKGGIKDVTESASSSNAXXXXXXXXXXXXNGSKAETTSGKLTXXXXXXXXXXX 779
              L  T    +   + S S + A            +GS + TT  K             
Sbjct: 728 EFNLTSTTPMRLPFNSSSGSVNTA----------TKDGSTSPTTKTK------------- 764

Query: 780 XXXXXXXXXXXXXXXXXYRGEAEVSGKDDTNNET-----QREDSNENQNEDARSIESENA 834
                             + E+E S + + N+E+      + + NE++ E    + +  +
Sbjct: 765 --------------EGSIQVESETSTEGNDNDESSIVLESKHEENEDEKEKMSILSTSTS 810

Query: 835 SSYDDAIFHSRLRKGNSGENEDG-----RPLEHPRRLAIAMEVQDTGPGIEPALQESVFE 889
           SSYDDAIFHS+ +K  S  + D      R L+ P+   I+MEV+DTG GI+P+LQESVFE
Sbjct: 811 SSYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFE 870

Query: 890 PFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELC 948
           PFVQGDQTLSRQYGGTGLGLSICRQLA MM G+M LDSKVGVGSKF FTVPL QTKE+ 
Sbjct: 871 PFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIV 929

 Score =  218 bits (554), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 126/149 (84%), Gaps = 1/149 (0%)

Query: 1012 DRPFLQSTGTALSTRSVTTT-SVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDG 1070
            DRPFLQSTGTA STRS+++  S   + +VLVAEDNNVNQEVIKRML LEGL D+D+ACDG
Sbjct: 998  DRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDG 1057

Query: 1071 QDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNI 1130
            Q+A++KV+   + G+ Y +IFMDVQMPRVDGL AT+MIRN+L Y  PIVALTAYADD NI
Sbjct: 1058 QEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNI 1117

Query: 1131 KECIDAGMNGFLAKPIRRPKIKEILSEYC 1159
            K C+++GM+GFL KPI+RP +K+I+++YC
Sbjct: 1118 KVCLESGMDGFLPKPIKRPLLKKIIAQYC 1146

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
           YIL147C (REAL)
          Length = 1221

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/967 (51%), Positives = 632/967 (65%), Gaps = 85/967 (8%)

Query: 19  PPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKASQIDQN 78
           PPF I IR                      GVYFTS++K++R++RLY+A+QLK+SQ+DQ 
Sbjct: 13  PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72

Query: 79  XXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYDSS 138
                      ++RD LQ++LT Y+AGN + +NW D+++ + KFL SSNLF +ARVYDSS
Sbjct: 73  LNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132

Query: 139 FQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSLP 198
           F  VLNA+NN +G+L+PE VL  LFPLST++ LPSSLE  G+LTDP++N+T YLMSMSLP
Sbjct: 133 FTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLP 192

Query: 199 IFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNRELA-GYHL 257
           IFANPSIIL+ S+VYGYIT+V+SAEGLK+VFNDTTALE S+V ++S  Y+ +  A GYH 
Sbjct: 193 IFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHF 252

Query: 258 VFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLVQ 317
           VFPPYG    I  + + I N++F+   F+  KGGS+K T+   +K +A+GYSPCS  LV 
Sbjct: 253 VFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLVN 312

Query: 318 WVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQKATEIIT 377
           WVA+++QPES FL P+T+L +                  PL+HWAV+PIVRLQKATE+IT
Sbjct: 313 WVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELIT 372

Query: 378 AGRGLRSDNGSTLYSHKRSSTAESFSSAL-HPASIRR--SGSVARSSKHKY--------- 425
            GRGLR     T+   + SS    FSS    P+S+ +  +G    ++             
Sbjct: 373 EGRGLRPSTPRTV--SRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSANGHGSSGHGSG 430

Query: 426 ----IPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLF-------------S 468
                  S K  +N    E++ P   EN        V     GSL              +
Sbjct: 431 VALSTESSMKSAINLG-HEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLAPNSLRNNDT 489

Query: 469 EQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRAR 528
           ++ S+RS    TS NL EAR+P Y RLFSDELS+LTETFNTMTD LD+HYALLEDRVRAR
Sbjct: 490 DRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRAR 549

Query: 529 TRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIF 588
           T+QLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAI+M E D+ K++++LKLIF
Sbjct: 550 TKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIF 609

Query: 589 RSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISII 648
           RSGELLLHI+TELLTFSKNVL+RTKLE RDF + ++ALQ++SIFGK+AKDQ V L+IS+ 
Sbjct: 610 RSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLF 669

Query: 649 PNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRA 708
           PN++RTMVLWGDSNRI+QIVMNLVSNALKFTPVDG V+V+  LLGEYD+  +    F   
Sbjct: 670 PNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEV 729

Query: 709 AVVPIQESEKESSTLGPTEKGG-IKDVTESASSSNAXXXXXXXXXXXXNGSKAETTSGKL 767
            V                +KG  I DV ES    +               + A  TS + 
Sbjct: 730 HV----------------KKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRD 773

Query: 768 TXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRGEAEVSGKDDTNNETQREDSNENQ---NE 824
                                           + E++ ++   NE   + +N+ +   N+
Sbjct: 774 NSAI----------------------------QEEITKRNTAANENIYKKANDREKSSND 805

Query: 825 DARSIESENASSYDDAIFHSRLRKGNSGENED----GRPLEHPRRLAIAMEVQDTGPGIE 880
           D  SI S   SSYDDAIF+S+  K    ++++    GRP+E+P+   I++EV+DTGPGIE
Sbjct: 806 DVSSIVSTTTSSYDDAIFNSQFNKALDSDSDESGNVGRPIENPKTWVISIEVEDTGPGIE 865

Query: 881 PALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVP 940
           P+LQESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MM+G+M L+S+VGVGSKFTFT+P
Sbjct: 866 PSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLP 925

Query: 941 LTQTKEL 947
           L QTKE+
Sbjct: 926 LHQTKEI 932

 Score =  224 bits (571), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 131/165 (79%), Gaps = 7/165 (4%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANK----CKVLVAEDNNVNQEVIKRMLNLEGLDDVDLA 1067
            DRPFLQSTGTA S+R+V T    +K     K+LV EDN+VNQEVI+RMLNLEG+D+++LA
Sbjct: 1060 DRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELA 1119

Query: 1068 CDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADD 1127
            CDGQ+AFDKVK     G+ Y++IFMDVQMP+VDGL +T+MIR +L Y  PIVALTA+ADD
Sbjct: 1120 CDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADD 1179

Query: 1128 RNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGK 1172
             NIKEC+++GMNGFL+KPI+RPK+  ILSE+C  Y    G+K  K
Sbjct: 1180 SNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAY---QGKKNKK 1221

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1166

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/947 (50%), Positives = 614/947 (64%), Gaps = 81/947 (8%)

Query: 16  KLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKASQI 75
           K + P  + IR                      GVYFT ++K++R+ERLY+A+QLK++QI
Sbjct: 10  KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQI 69

Query: 76  DQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVY 135
           DQN           S+RD LQ AL  Y+AGN T  NW D+   + KFL SS LFS+A +Y
Sbjct: 70  DQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIY 129

Query: 136 DSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSM 195
           D++F  VL+A+NN +GN +PES L +L PLS N  LPSSL+ +G+LT+PVLN T YLMSM
Sbjct: 130 DATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSM 189

Query: 196 SLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYD-NRELAG 254
           SLPIFANPSIIL+TS VYGYIT+V+SA+ LK VF+DTTALE S+V ++S VYD N  L+ 
Sbjct: 190 SLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSS 249

Query: 255 YHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSD 314
           Y+ VF P G+PS I+ +   I N +FL  A +Q KGG+++ T FLY+K VA+GYSPCS  
Sbjct: 250 YNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVV 309

Query: 315 LVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQKATE 374
            V W+A++ Q E+ F+ P+T+L +                 FPL+HWAV+PIVRLQKATE
Sbjct: 310 FVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATE 369

Query: 375 IITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESAKGTL 434
           +IT GRGLR+ +         SS     SS  H  S    GS  RS          + T 
Sbjct: 370 LITEGRGLRASSPGA-----GSSNVSRRSSFFHRPS--NCGSSIRS----------RVTD 412

Query: 435 NKND-FEEIQPDGIENNEDAALQKVHSPTPGSLFS---EQRSARSERYITSTNLIEARVP 490
           N N+   ++  + I++   A    ++     S+ S   E  S +S+   TS NLIEARVP
Sbjct: 413 NHNEKGHDLHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVP 472

Query: 491 TYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFI 550
            Y R FSDELSELT+TFNTMTD LD+HYALLEDRVRARTRQLEAAKI+AE ANEAKTVFI
Sbjct: 473 VYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAANEAKTVFI 532

Query: 551 ANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLK 610
           ANISHELRTPLNGILGMTAI+M E D+ K+++SLKLIFRSGELLLHI+TELLTFSKNVLK
Sbjct: 533 ANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELLTFSKNVLK 592

Query: 611 RTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMN 670
           RTKLE+R+F+V ++ALQ++SIFGK+AKDQ V L+I++ PN++RTMVL+GDSNRI+QIVMN
Sbjct: 593 RTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMN 652

Query: 671 LVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQE----SEKESSTLGPT 726
           LVSNALKFTPVDG+VNV  +LLGEYD  ++ N    +  V+P  E     EK+   +   
Sbjct: 653 LVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPKGNDEKDKGGIEEK 712

Query: 727 EKGGIKDVTESASSSNAXXXXXXXXXXXXNGSKAETTSGKLTXXXXXXXXXXXXXXXXXX 786
           E+  I++     SS+++              S  ETT G                     
Sbjct: 713 ERFSIENTPNDTSSNSSNKH-----------SDTETTPG--------------------- 740

Query: 787 XXXXXXXXXXYRGEAEVSGKDDTNNETQREDSNENQNEDARSI--ESENASSYDDAIFHS 844
                          E    DD        D  E   EDA  +   S + SSY+D +FHS
Sbjct: 741 ----------LNDTDEKQASDDM-------DGGEEDVEDADEVSSFSTSTSSYNDTVFHS 783

Query: 845 RLRK----GNSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSR 900
           + +K     +    E G  ++  ++  I++ V+DTGPGI+ +L ESVFEPFVQGDQ LSR
Sbjct: 784 QFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSR 843

Query: 901 QYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKEL 947
           QYGGTGLGLSICRQLA MMNG+M L SK+GVGS+FTFTVPLTQT+E+
Sbjct: 844 QYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREI 890

 Score =  222 bits (566), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 102/162 (62%), Positives = 134/162 (82%), Gaps = 2/162 (1%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ 1071
            DRPFLQSTGTA S  ++ TTS  NK  +LVAEDN+VNQEVIKRMLNLEG+ +++L CDGQ
Sbjct: 959  DRPFLQSTGTASSNTNLGTTSTINK--ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQ 1016

Query: 1072 DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIK 1131
            +A DKVK   E G+ Y+LIFMDVQMP++DGL +T+MIR +L+YTHPIVALTA+ADD NI+
Sbjct: 1017 EALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIR 1076

Query: 1132 ECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGKT 1173
            EC+DAGM+GFLAKPI+R ++++I+ E+CP     + +K+ K+
Sbjct: 1077 ECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQDKEPKS 1118

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/745 (55%), Positives = 517/745 (69%), Gaps = 36/745 (4%)

Query: 17  LKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKASQID 76
           LKPPF + IR                      GVYFTS++K++R++RLY+A+QLK+SQID
Sbjct: 11  LKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70

Query: 77  QNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYD 136
           QN           S+RD LQ  LT Y+AGN T ENWAD+   + KFL S+NLFS A++YD
Sbjct: 71  QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130

Query: 137 SSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMS 196
           SSF  VL A+NN +G+L+PESVL +L+PL+TN  L SSLE  G+LTDPVLN + Y+MSMS
Sbjct: 131 SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190

Query: 197 LPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNRE-LAGY 255
           LPIFANPSIIL+ SKVYGYIT+V+SAEGLKTVFNDTTALE S+V +VS VY+N   L  Y
Sbjct: 191 LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250

Query: 256 HLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDL 315
           H VF PYG PS +I+  + I N+SFL  A ++ KGGS+K T F Y+K +A+GYSPC+   
Sbjct: 251 HFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310

Query: 316 VQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQKATEI 375
           V W+AI++Q ES FL PST+LA+                 FPL+HWAV+PIVRLQKATE+
Sbjct: 311 VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370

Query: 376 ITAGRGLRSDN-GSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKY----IPESA 430
           ++ GRGL+S   GS   S  RSS+ + +        +R +     SS H +    +  + 
Sbjct: 371 MSEGRGLKSTTPGSKNVS--RSSSIKHY--------VRSNIPSTASSVHNFSGDNLSTTT 420

Query: 431 KGTLNKNDFEEIQ------PDGIENNEDAAL-------QKVHSPTPGSLFSEQR--SARS 475
            G LN+             P   ++N    +       Q+ +S    S F++    S RS
Sbjct: 421 NGHLNQRGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSI---SRFTDHTDLSNRS 477

Query: 476 ERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAA 535
           ++  TS NLIEARVP Y RLFSDELS+LT+TFN MTD LD+HYALLEDRVRART+QLEAA
Sbjct: 478 KKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAA 537

Query: 536 KIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLL 595
           KIEAE ANEAKT+FIANISHELRTPLNGILGMTAI+M E D+ K++SSLKLIFRSGELLL
Sbjct: 538 KIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLL 597

Query: 596 HIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTM 655
           HI+TELLTFSKNVLKRT LE+RDF + ++ALQ++SIFGK+AKDQ V L+I ++PN++RTM
Sbjct: 598 HILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTM 657

Query: 656 VLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQE 715
           +L+GDSNRI+QIVMNLVSNALKFTPVDG+VNV+  L+GEYDE+ +    F +  V    E
Sbjct: 658 ILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTE 717

Query: 716 --SEKESSTLGPTEKGGIKDVTESA 738
               K  + LG  +K   K  TES 
Sbjct: 718 FIETKAKAILGAPKKDDPKTSTESV 742

 Score =  238 bits (607), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 138/165 (83%), Gaps = 2/165 (1%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVA-NKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDG 1070
            DRPFLQSTGTA STR++ T   A  K K+LVAEDN+VNQEVIKRMLNLEG+++++LA DG
Sbjct: 1019 DRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDG 1078

Query: 1071 QDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNI 1130
            QDAF++VKA  E G+ +D+IFMDVQMP+VDGL +T+MIRN+L YT+PIVALTA+ADD NI
Sbjct: 1079 QDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNI 1138

Query: 1131 KECIDAGMNGFLAKPIRRPKIKEILSEYCPTY-FKADGEKKGKTE 1174
            KEC++AGMNGFL+KPI+RPK+K IL EYCP +  K   + K K E
Sbjct: 1139 KECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMKVAEDNKSKNE 1183

 Score =  175 bits (443), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 103/127 (81%), Gaps = 4/127 (3%)

Query: 825 DARSIESENASSYDDAIFHSRLRKGNS-GENEDGR---PLEHPRRLAIAMEVQDTGPGIE 880
           + +SI S + SSYDDA+F+++ +K     E+EDG     L +P+   IA+EVQDTGPGI+
Sbjct: 792 ETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGID 851

Query: 881 PALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVP 940
           P+LQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MMNG+M L S+VGVGS FTFTVP
Sbjct: 852 PSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVP 911

Query: 941 LTQTKEL 947
           L QT+EL
Sbjct: 912 LMQTREL 918

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1200

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/742 (54%), Positives = 514/742 (69%), Gaps = 28/742 (3%)

Query: 18  KPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKASQIDQ 77
           KPP+ + IR                      GVYFTS++K++R++RLY+A+QLK+SQIDQ
Sbjct: 11  KPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70

Query: 78  NXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYDS 137
           N           ++RD LQ  L  Y+AGN +  NW D+ + L+KFLGSSNLFS+ARVYDS
Sbjct: 71  NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130

Query: 138 SFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSL 197
           SF  VLN +NN++G+L+PE VLTQL PLSTNV LPSSLE  G++T+PV N + YLMSMSL
Sbjct: 131 SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190

Query: 198 PIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDN-RELAGYH 256
           PIFANPSIIL+ S+VYGY+TVV+SAEGL +VFNDTTALE S V +VS VY N  +L  Y 
Sbjct: 191 PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYR 250

Query: 257 LVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLV 316
            VFPP+G  S I+++ + + N++FL  A +Q KGG++KST   Y   +A+GYSP +S+L 
Sbjct: 251 FVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLA 310

Query: 317 QWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQKATEII 376
            WVAI+ Q ES F+ P+T+LA+                 FPL+HWAV+PIVRLQKATE+I
Sbjct: 311 NWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELI 370

Query: 377 TAGRGLRSD---NGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESAKGT 433
           T  RGLR     +GS   S  R  ++   S  LHP S     +   + K +  P S + T
Sbjct: 371 TESRGLRPTTPTSGSRANSILRDKSS-LISFPLHPVSTNNINNNNSNEKAQ--PPSDQDT 427

Query: 434 LNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFS-----------EQRSARSERYITST 482
              N    I    I        ++ HSP    +FS           E+ S  S+ Y T+ 
Sbjct: 428 NTNNSSSSIAVSNI--------REEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAV 479

Query: 483 NLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGA 542
           NLI+ARVP+Y  LF DELS+LTETFNTMTD LD+HYALLE+RVRART+QLEAAKIEAE A
Sbjct: 480 NLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETA 539

Query: 543 NEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELL 602
           NEAKTVFIANISHELRTPLNGILGMTAI+M E D+ K+++SLKLIFRSGELLLHI+TELL
Sbjct: 540 NEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILTELL 599

Query: 603 TFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSN 662
           TFSKNVLKRTKLE+R+F + ++ALQ++SIFGK+AKDQHV L+I + PN++R+MVL+GDSN
Sbjct: 600 TFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSN 659

Query: 663 RIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKESST 722
           RI+QIVMNLVSNALKFTPVDG+V+V+  +LG YDE+ +     ++  V P  E    + +
Sbjct: 660 RIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPS 719

Query: 723 LGPTEKGGIKD--VTESASSSN 742
           L    +G  KD   +++AS +N
Sbjct: 720 LNVKSEGQGKDKFTSDTASKNN 741

 Score =  213 bits (542), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 125/174 (71%), Gaps = 26/174 (14%)

Query: 1012 DRPFLQSTGTALSTRSV-------------------------TTTSVANKC-KVLVAEDN 1045
            DRPFLQSTGTA STRS+                           TS  N   K+LVAEDN
Sbjct: 1014 DRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDN 1073

Query: 1046 NVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSAT 1105
            +VNQEVIKRML LEG+ D+DLACDGQDAFDKVK   + G  Y+LIFMDVQMP+VDGL++T
Sbjct: 1074 HVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTST 1133

Query: 1106 RMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYC 1159
            +MIR++L    PIVALTA+ADD NIKEC+DAGM+GFL+KPI+R K+K IL E+C
Sbjct: 1134 KMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFC 1187

 Score =  179 bits (454), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 106/144 (73%), Gaps = 5/144 (3%)

Query: 809 TNNETQREDSNENQNEDARSIESENASSYDDAIFHSRLRKGNSGENED-----GRPLEHP 863
           T +   +E   +N  ED  S+ S   SSYDDAIF+S+ +K  +  +ED     G  LE P
Sbjct: 753 TTDRVAQESDEDNMYEDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETP 812

Query: 864 RRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSM 923
           +   I+ EV+D+GPGI+  LQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM G M
Sbjct: 813 KTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKM 872

Query: 924 SLDSKVGVGSKFTFTVPLTQTKEL 947
            L+SKVGVGSKFTFT+PLTQT+E+
Sbjct: 873 LLESKVGVGSKFTFTLPLTQTREI 896

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar
           to uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/699 (57%), Positives = 490/699 (70%), Gaps = 31/699 (4%)

Query: 14  KRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKAS 73
           +R LKPPF I IR                      GVYFTS++K++R++RLY+A+QLK+S
Sbjct: 11  RRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 70

Query: 74  QIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLAR 133
           Q+DQN           ++RD LQNAL  Y+AGN T ENW ++   + KFL SSNLF L+R
Sbjct: 71  QLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSR 130

Query: 134 VYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLM 193
           VYD  F+ VLN +NN +G+ VPES+  QLFPLST+V LPSSL   GMLTDPVLN T YLM
Sbjct: 131 VYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLM 190

Query: 194 SMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDN-REL 252
           SMSLPIFANPSII S  KVYGYITVV+SAEGL++VFNDTTALE S+V +VS  Y N  ++
Sbjct: 191 SMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKI 250

Query: 253 AGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCS 312
             Y  VFPPYG+   I+++ + + + SFL  AFKQ+KGGSIK T F Y+K VAIGY PCS
Sbjct: 251 DSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCS 310

Query: 313 SDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQKA 372
            + V WVA+++Q ES FL PST+L +                 FPL+ WAV+PIVRLQKA
Sbjct: 311 FNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKA 370

Query: 373 TEIITAGRGLR-------SDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKY 425
           TE+I  GRGLR       S +GS   S K+     +F S L  +      +   +S   Y
Sbjct: 371 TELIAEGRGLRPAGAGSGSRSGSRTSSMKKDINDLNFISRLSLSEKNHRPAYDSASDSNY 430

Query: 426 IPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTNLI 485
              +  G+L+ +D +  Q     ++ D +  +    T                 TSTNL 
Sbjct: 431 ---ATDGSLS-HDLQTSQASNRPSDNDRSSSRSRFLT-----------------TSTNLN 469

Query: 486 EARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEA 545
           EAR+P Y RLFSDELS+LT TFN MTD LD+HYALLEDRVRART+QLEAAKI+AE ANEA
Sbjct: 470 EARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEA 529

Query: 546 KTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFS 605
           KTVFIANISHELRTPLNGILGMTAI+M E D+ K+++SLKLIFRSGELLLHI+TELLTFS
Sbjct: 530 KTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFS 589

Query: 606 KNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIV 665
           KNVLKRT LE+R+F + ++ALQ++SIFGK+AKDQHV L+IS+ PNV+RTMVLWGDSNRI+
Sbjct: 590 KNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRII 649

Query: 666 QIVMNLVSNALKFTPVDGRVNVKFTLLGEYDE--SKASN 702
           QIVMNLVSNALKFTPVDG+VNV+  LLGEYDE  +KA N
Sbjct: 650 QIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADN 688

 Score =  232 bits (591), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 134/162 (82%), Gaps = 1/162 (0%)

Query: 1012 DRPFLQSTGTALSTRSVTTTS-VANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDG 1070
            DRPFLQSTGTA S+R+V T + V  + K+LVAEDN+VNQEVIKRMLNLEG++++DLACDG
Sbjct: 994  DRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDG 1053

Query: 1071 QDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNI 1130
            QDAFDKV++  E    YD+IFMD+QMP+VDGL +T+MIR +L+Y   IVALTA+ADD NI
Sbjct: 1054 QDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNI 1113

Query: 1131 KECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGK 1172
            KECI+AGMNGFL+KPI+RPK+K IL EYCP + +    K+ K
Sbjct: 1114 KECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEMKKSKENK 1155

 Score =  154 bits (388), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 74/116 (63%), Positives = 88/116 (75%), Gaps = 10/116 (8%)

Query: 837 YDDAIFHSRLRK-------GNSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFE 889
           YD+A+F+++ +K        N G    G  L   +    A+EV+DTGPGI+P L ESVFE
Sbjct: 769 YDNALFNTQFKKTPDLYEDSNDGL---GTELADQKTWVFAIEVEDTGPGIDPKLHESVFE 825

Query: 890 PFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTK 945
           PFVQGDQTLSRQYGGTGLGLSICRQLA MM+G+M L+SKVGVGSKFTFTVPL QT+
Sbjct: 826 PFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTR 881

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
           SLN1Histidine kinase osmosensor that regulates a MAP
           kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1220

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/723 (56%), Positives = 510/723 (70%), Gaps = 41/723 (5%)

Query: 9   LGAYAKRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVAS 68
            G  +K +L PPF I IR                      GVYFTS++K++R++RLY+A+
Sbjct: 3   FGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 69  QLKASQIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNL 128
           QLK+SQIDQ            ++RD LQ++LT Y+AGN + +NW D+++ + KFL SSNL
Sbjct: 63  QLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNL 122

Query: 129 FSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLND 188
           F +A+VYDSSF  VLNA+NN +G+L+PE VL  LFPLST+  LPSSLE  G+LTDPVLN 
Sbjct: 123 FYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNS 182

Query: 189 TGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYD 248
           T YLMSMSLPIFANPSIIL+ S+VYGYIT+++SAEGLK+VFNDTTALE S++ ++S VY+
Sbjct: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYN 242

Query: 249 NR-ELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIG 307
           ++ + +GYH VFPPYG  SD+  K ++I ND+F+  AF+  KGGS+K T+ L ++  A+G
Sbjct: 243 SQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALG 302

Query: 308 YSPCSSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIV 367
           YSPCS +LV WVAI++QPES FL P+T+LA+                  PL+HWAVQPIV
Sbjct: 303 YSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362

Query: 368 RLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALH-PASIRR-----SGSV---- 417
           RLQKATE+IT GRGLR     T+   + SS    FSS    P+S+ +     +GS     
Sbjct: 363 RLQKATELITEGRGLRPSTPRTI--SRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVS 420

Query: 418 --------------ARSSKHKYI---------PESAKGTLNKNDFEEIQPDGIENNEDAA 454
                         A SS    I         PE      N +   +I  DG  N++   
Sbjct: 421 GHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHD--- 477

Query: 455 LQKVHSPTPGSLFSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDEL 514
           L   HS       +++ S RS    TS NL EAR+P Y RLFSDELS+LTETFNTMTD L
Sbjct: 478 LLGPHSLRHND--TDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDAL 535

Query: 515 DRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAE 574
           D+HYALLE+RVRART+QLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAI+M E
Sbjct: 536 DQHYALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEE 595

Query: 575 NDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGK 634
            D+ K+++SLKLIFRSGELLLHI+TELLTFSKNVL+RTKLE+RDF + ++ALQ++SIFGK
Sbjct: 596 TDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGK 655

Query: 635 LAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGE 694
           +AKDQ V L+IS+ PN++RTMVLWGDSNRI+QIVMNLVSNALKFTPVDG V+V+  LLGE
Sbjct: 656 VAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGE 715

Query: 695 YDE 697
           YD+
Sbjct: 716 YDK 718

 Score =  226 bits (575), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 133/165 (80%), Gaps = 7/165 (4%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANK----CKVLVAEDNNVNQEVIKRMLNLEGLDDVDLA 1067
            DRPFLQSTGTA S+R++ T    +K     K+LV EDN+VNQEVIKRMLNLEG+++++LA
Sbjct: 1059 DRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELA 1118

Query: 1068 CDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADD 1127
            CDGQ+AFDKVK     G+ Y++IFMDVQMP+VDGL +T+MIR +L YT PIVALTA+ADD
Sbjct: 1119 CDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADD 1178

Query: 1128 RNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGK 1172
             NIKEC+++GMNGFL+KPI+RPK+K IL+E+C  Y    G+K  K
Sbjct: 1179 SNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAY---QGKKNNK 1220

 Score =  179 bits (455), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 119/155 (76%), Gaps = 7/155 (4%)

Query: 800 EAEVSGKDDTNNETQREDSNENQ---NEDARSIESENASSYDDAIFHSRLRKGNSGENED 856
           + E++ ++   NE+  +  N+ +   N+D  SI S   SSYD+AIF+S+  K    ++E+
Sbjct: 778 QEEITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEE 837

Query: 857 G----RPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSIC 912
           G    RP+E+P+   I++EV+DTGPGI+P+LQESVF PFVQGDQTLSRQYGGTGLGLSIC
Sbjct: 838 GGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSIC 897

Query: 913 RQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKEL 947
           RQLA MM+G+M L+SKVGVGSKFTFT+PL QTKE+
Sbjct: 898 RQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEI 932

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1187

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/728 (54%), Positives = 497/728 (68%), Gaps = 34/728 (4%)

Query: 3   RLKKFDLGAYAKRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAE 62
           RLK+      A    KPP+ ISIR                      GVYFTSS+K++RA 
Sbjct: 14  RLKRL-----AHLNTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRAN 68

Query: 63  RLYVASQLKASQIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKF 122
           RLY+A+QLK+SQIDQ            STRD LQ++L  ++AGN ++ NW    + L+KF
Sbjct: 69  RLYIAAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKF 128

Query: 123 LGSSNLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLT 182
           L SS+ FS  +VYD +F  VL+ +NN +GN +   VL +LFPLSTN+ L SSLE  G+LT
Sbjct: 129 LSSSDYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILT 188

Query: 183 DPVLNDTGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVIL 242
           DPVLN T YLMSMSLP+FANPSIILSTS+VYGYIT++++A+GL +VFNDTTA+E S+V +
Sbjct: 189 DPVLNGTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAI 248

Query: 243 VSTVYDNR-ELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYS 301
           VS VY+N+ EL  YHL  PPYG  + + D  + + N SFL  A KQ KGGSIK THFLY+
Sbjct: 249 VSAVYNNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYN 308

Query: 302 KAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHW 361
           KAVA+GYSPCS +L  WV++++Q ES F  PST+L +                  PL+++
Sbjct: 309 KAVAVGYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYF 368

Query: 362 AVQPIVRLQKATEIITAGRGLR-------------------SDNGSTLYSHKRSSTAESF 402
           AV+PIVRL+KATEIIT GRGLR                   S   S + S K ++T  S 
Sbjct: 369 AVKPIVRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGNSN 428

Query: 403 SSALHPASIRRSGSVARSSKHKYIPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPT 462
           S   + AS+     V  S        S    +  N  +E+        + A+   V++ T
Sbjct: 429 SLNENSASLSSHPMVLTSENVLVTNHSGLSRIPVNMNQELL-------DRASASTVNTLT 481

Query: 463 PGSLFSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLE 522
             S  +++ S RS+  IT TNL EARVP   +LF DELS+LTETFNTMTD LD HY LLE
Sbjct: 482 IDS--NDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLE 539

Query: 523 DRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKS 582
           DRVRART+QLEAAKI+AE ANEAKTVFIANISHELRTPLNGILGMTAI+M E D+ K++S
Sbjct: 540 DRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRS 599

Query: 583 SLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVN 642
           SLKLIFRSGELLLHI+TELLTFSKNVL+RTKLE+R+F + ++ALQ++SIFGK+AKDQHV 
Sbjct: 600 SLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVR 659

Query: 643 LTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASN 702
           L+I + PN++RTMVL+GDSNRI+Q+VMNLVSNALKFTPVDG+V VK  LLGEYDE  + N
Sbjct: 660 LSIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKN 719

Query: 703 GCFDRAAV 710
             F++  V
Sbjct: 720 SKFEKVYV 727

 Score =  244 bits (624), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 137/166 (82%), Gaps = 4/166 (2%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANKC-KVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDG 1070
            DRPFLQSTGTA+S+ +V T +   K   VLVAEDN+VNQEVIKRML+LEG+ ++DLACDG
Sbjct: 1017 DRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDG 1076

Query: 1071 QDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNI 1130
            QDAFD VK+  E G+FYD+IFMDVQMP+VDGLSAT+MIRN+L Y HPIVALTA+ADD NI
Sbjct: 1077 QDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNI 1136

Query: 1131 KECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGKTEGQ 1176
            KEC+DAGM+GFL+KPI+RP++K IL EYCP   K D   +  + G+
Sbjct: 1137 KECLDAGMDGFLSKPIKRPQLKTILLEYCP---KVDSMGRATSTGE 1179

 Score =  159 bits (403), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 103/140 (73%), Gaps = 5/140 (3%)

Query: 810 NNETQREDSNENQNEDARSIESENASSYDDAIFHSRLRKG-NSGENEDG---RPLEHPRR 865
           N   QR  SNE+   D  SI S + SSYDDAIF+S+ +K  +  E+EDG     L   + 
Sbjct: 789 NTSQQRTSSNEDY-VDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKT 847

Query: 866 LAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSL 925
               +EV DTGPGI+ +LQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MMNG+M+L
Sbjct: 848 WVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTL 907

Query: 926 DSKVGVGSKFTFTVPLTQTK 945
           +S VG GSKF FTVPLTQT+
Sbjct: 908 ESTVGSGSKFIFTVPLTQTR 927

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
           YIL147C (REAL)
          Length = 1230

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/735 (54%), Positives = 509/735 (69%), Gaps = 47/735 (6%)

Query: 13  AKRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKA 72
           +K +  PPF I IR                      GVYFTS++K++R++RLY+A+QLK+
Sbjct: 7   SKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKS 66

Query: 73  SQIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLA 132
           SQIDQ            ++RD LQ++LT ++AGN + +NW D+++ + KFL SSNLF +A
Sbjct: 67  SQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVA 126

Query: 133 RVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYL 192
           +VYDSSF  VLNA+NN +G+L+PE VL  LFPLST+  LPSSLE  G+LTDPV+N+T YL
Sbjct: 127 KVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYL 186

Query: 193 MSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNR-E 251
           MSMSLPIFANPSIIL+ S+VYGYIT+++SAEGLK+VFNDTTALE S+V ++S +Y+N+ +
Sbjct: 187 MSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGK 246

Query: 252 LAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPC 311
            +GYH +FPPYG  S +    ++I N++F+  AF+  KGGS+K T+    K +A+GYSPC
Sbjct: 247 ASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPC 306

Query: 312 SSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQK 371
           S  LV WVA+++QPES FL P+T+LA+                  PL+HWAVQPIVRLQK
Sbjct: 307 SFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366

Query: 372 ATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALH-PASIRR-----SGSVARSS---- 421
           ATE+IT GRGLR     T+   + SS    F S    P+S+ +     SGS   +S    
Sbjct: 367 ATELITEGRGLRPSTPRTV--SRASSFKRGFGSGFTVPSSLLQFNTGESGSTISASGHGG 424

Query: 422 ----------------------KHKYIP-ESAKGTLNKNDFEEIQPDGIENNEDAALQKV 458
                                   K +P E  K   N N   ++  DG  N++  A    
Sbjct: 425 SGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA---- 480

Query: 459 HSPTPGSLF---SEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELD 515
               P SL    +++ S RS    TS NL EAR+P Y RLFSDELS+LTETFNTMTD LD
Sbjct: 481 ----PNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALD 536

Query: 516 RHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEN 575
           +HYALLEDRVRART+QLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAI+M E 
Sbjct: 537 QHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEET 596

Query: 576 DMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKL 635
           D+ K+++SLKLIFRSGELLLHI+TELLTFSKNVL+RTKLE+RDF + ++ALQ++SIFGK+
Sbjct: 597 DVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKV 656

Query: 636 AKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEY 695
           AKDQ V L+IS+ PN++RTMVLWGDSNRI+QIVMNLVSNALKFTPVDG V+V+  LLGEY
Sbjct: 657 AKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEY 716

Query: 696 DESKASNGCFDRAAV 710
           D+  +    F    V
Sbjct: 717 DKDLSEKKQFKEVHV 731

 Score =  225 bits (573), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 106/171 (61%), Positives = 134/171 (78%), Gaps = 8/171 (4%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANK----CKVLVAEDNNVNQEVIKRMLNLEGLDDVDLA 1067
            DRPFLQSTGTA S+R+V T    +K     K+LV EDN+VNQEVIKRMLNLEG+++++LA
Sbjct: 1060 DRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELA 1119

Query: 1068 CDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADD 1127
            CDGQ+AFDKVK     G  Y++IFMDVQMP+VDGL +T+MIR +L Y  PIVALTA+ADD
Sbjct: 1120 CDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADD 1179

Query: 1128 RNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTY----FKADGEKKGKTE 1174
             NIKEC+++GMNGFL+KPI+RPK+K IL+E+C  Y      ++  KK KTE
Sbjct: 1180 SNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKITSEEPKKAKTE 1230

 Score =  177 bits (449), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/116 (70%), Positives = 98/116 (84%), Gaps = 6/116 (5%)

Query: 837 YDDAIFHSRLRKGNSGENED-----GRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPF 891
           YDDAIF+S+  K   G +ED     G+P+E+P+   I++EV+DTGPGI+P+LQESVF PF
Sbjct: 818 YDDAIFNSQFNKA-PGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPF 876

Query: 892 VQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKEL 947
           VQGDQTLSRQYGGTGLGLSICRQLA MMNG+M L+SKVGVGSKFTFT+PL QTKE+
Sbjct: 877 VQGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEI 932

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
           YIL147C (REAL)
          Length = 1219

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/729 (55%), Positives = 508/729 (69%), Gaps = 47/729 (6%)

Query: 19  PPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKASQIDQN 78
           PPF ISIR                      GVYFTS++K++R++RLY+A+QLK+SQIDQ 
Sbjct: 13  PPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72

Query: 79  XXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYDSS 138
                      ++RD LQN+LT Y+AGN +++NW D+V+ + KFL SSNLF +A+VYDSS
Sbjct: 73  LNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAKVYDSS 132

Query: 139 FQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSLP 198
           F  VLNA+NN +G+L+P+ +  +LFPLST+++LPSSLE  G+LTDP+LN T YLMSMSLP
Sbjct: 133 FTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLMSMSLP 192

Query: 199 IFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNRELA-GYHL 257
           IFANPSIIL+ S+VYGYIT+++SAEGLK+VFNDTTALE S+V ++S VY+N+  A  YH 
Sbjct: 193 IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKAYAYHF 252

Query: 258 VFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLVQ 317
           VFPPYG  S I    + I N++F+  AFK  KGGS+K T+    K +A+GYSPCS  LV 
Sbjct: 253 VFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCSFQLVN 312

Query: 318 WVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQKATEIIT 377
           WVA+++QPES FL PST+LA+                  PL+HWAVQPIVRLQKATE+IT
Sbjct: 313 WVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELIT 372

Query: 378 AGRGLRSDNGSTLYSHKRSSTAESFSSALH-PASIRR-----SGSVARSSKH-------- 423
            GRGLR     T+   + SS    FSS    P+S+ +     +GS   +S H        
Sbjct: 373 EGRGLRPSTPRTV--SRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTSASGHGCSGRGSA 430

Query: 424 ------------------KYIP-ESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPG 464
                             K  P E  K T N ++  +I  DG  N++  A        P 
Sbjct: 431 AVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLA--------PN 482

Query: 465 SL---FSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALL 521
           +L    +++ S+RS    TS NL EAR+P Y RLFSDELS+LTETFNTMTD LD+HYALL
Sbjct: 483 ALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALL 542

Query: 522 EDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVK 581
           EDRVRART+QLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAI+M E D+ K++
Sbjct: 543 EDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIR 602

Query: 582 SSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHV 641
           +SLKLIFRSGELLLHI+TELLTFSKNVL+RTKLE+RDF + ++ALQ++SIFGK+AKDQ V
Sbjct: 603 NSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRV 662

Query: 642 NLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKAS 701
            L+IS+ PN +RTMVLWGDSNRI+QIVMNLVSNALKFTPVDG V V+  LLGEYD+  + 
Sbjct: 663 RLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSE 722

Query: 702 NGCFDRAAV 710
              F    V
Sbjct: 723 KKQFKEVHV 731

 Score =  228 bits (582), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 133/163 (81%), Gaps = 7/163 (4%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANK----CKVLVAEDNNVNQEVIKRMLNLEGLDDVDLA 1067
            DRPFLQSTGTA S R++ T S ++K     K+LV EDN+VNQEVIKRMLNLEG+++++LA
Sbjct: 1060 DRPFLQSTGTATSNRNIPTVSNSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENIELA 1119

Query: 1068 CDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADD 1127
            CDGQDAFDKVK     G+ Y++IFMDVQMP+VDGL +T+MIR +L YT PIVALTA+ADD
Sbjct: 1120 CDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADD 1179

Query: 1128 RNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKK 1170
             NIKEC+++GMNGFL+KPI+RPK+K IL E+C  Y    G+KK
Sbjct: 1180 SNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAY---QGKKK 1219

 Score =  179 bits (455), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 120/155 (77%), Gaps = 7/155 (4%)

Query: 800 EAEVSGKDDTNNET---QREDSNENQNEDARSIESENASSYDDAIFHSRLRKGNSGENED 856
           + E++ ++   NE    +  D  ++ N+D  SI S + SSYDDAIF+S+  K    ++++
Sbjct: 778 QEEITKRNTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKALGSDDDE 837

Query: 857 G----RPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSIC 912
           G    +P+E+P+  AI++EV+DTGPGI+P+LQESVF PFVQGDQTLSRQYGGTGLGLSIC
Sbjct: 838 GGDLGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSIC 897

Query: 913 RQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKEL 947
           RQLA MM+G+M L+SKVGVGSKFTFT+PL QTKE+
Sbjct: 898 RQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEI 932

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1095

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/749 (53%), Positives = 512/749 (68%), Gaps = 41/749 (5%)

Query: 9   LGAYAKRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVAS 68
           LG  AK K  PPF ISIR                      GVYFTS++KS+R+ERLYVA+
Sbjct: 3   LGTIAKEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAA 62

Query: 69  QLKASQIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNL 128
           QLK+SQIDQN           S++  LQ +L  Y++GN T  NW D+ + L KFL SS L
Sbjct: 63  QLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSAL 122

Query: 129 FSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLND 188
           FS+ARVYD+ FQ VLNA+NN +G+++ + VL +L PLS+N++LP+SLE +GMLTDPVLN 
Sbjct: 123 FSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNG 182

Query: 189 TGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYD 248
           T YLMSMSLPI+ANPSIIL+ S+VYGY+T+++SA+ LK+V++D TALE SSV +VS +Y 
Sbjct: 183 TSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYK 242

Query: 249 -NRELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIG 307
            ++ L  Y  VF PYG    I+D+ + I N+SFL  A +Q K GS + T   Y++  A+G
Sbjct: 243 KDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVG 302

Query: 308 YSPCSSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIV 367
           YSPCS   V WVAII+Q E+ F+ PSTRL +                 FPL+HWAVQPIV
Sbjct: 303 YSPCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIV 362

Query: 368 RLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIP 427
           RLQKATEIIT GRGLRS             T  S S + + + IRR  S + S +   + 
Sbjct: 363 RLQKATEIITEGRGLRS------------GTPGSSSVSRNSSFIRRRFSGSSSVRSPSLA 410

Query: 428 ESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTNLIEA 487
           +  KG + +   E         N D A+  ++S       +E  S R+ +Y+TS+NL+EA
Sbjct: 411 DE-KGAVGRASTEG------SFNYDQAVPSLNSN------AEISSDRTRKYMTSSNLVEA 457

Query: 488 RVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKT 547
           RVP Y   FSDE SELT+TFNTMT+ LD+HYALLEDRVRART+QLEAAK+EAE ANEAKT
Sbjct: 458 RVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKT 517

Query: 548 VFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKN 607
           VFIANISHELRTPLNGILGMTAI+M E D+ K++SSLKLIFRSGELLLHI+TELLTFSKN
Sbjct: 518 VFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKN 577

Query: 608 VLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQI 667
           VL+RTKLE+RDF++ ++A+Q++SIFGK+AKDQ V  +I++ PN +R MVL+GDSNRI+QI
Sbjct: 578 VLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQI 637

Query: 668 VMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVV-------------PIQ 714
           VMNLVSNALKFTPVDG+V+V+  LLGEYD+ ++ N  F    V+             P++
Sbjct: 638 VMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVK 697

Query: 715 ESEKESSTLGPTEKGGIKDVTESASSSNA 743
           + EK+       EK   K   E AS+S++
Sbjct: 698 QFEKQEDL--EKEKISEKHNEEEASTSDS 724

 Score =  228 bits (582), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 104/149 (69%), Positives = 128/149 (85%), Gaps = 1/149 (0%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANKC-KVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDG 1070
            DRPFLQSTGTA S+++VT  S  NK  ++LVAEDN+VNQEVIKRML LEG+D +DLA DG
Sbjct: 937  DRPFLQSTGTASSSKNVTVVSNVNKSYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADG 996

Query: 1071 QDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNI 1130
            QDAFDKVKA  E G+ Y+LIFMDVQMP+VDGL AT+MIR +L Y +PIVALTA+ADD NI
Sbjct: 997  QDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNI 1056

Query: 1131 KECIDAGMNGFLAKPIRRPKIKEILSEYC 1159
            + C++AGMNGFL+KPI+RPK+K I+++YC
Sbjct: 1057 RVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085

 Score =  196 bits (498), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 116/149 (77%), Gaps = 1/149 (0%)

Query: 800 EAEVSGKDDTNNETQREDSNENQNEDARSIESENASSYDDAIFHSRLRKGNSGE-NEDGR 858
           EA  S  + TN + +  DS  +  +D  S+ S + SSYDD IFH++ +K  S   +E+G 
Sbjct: 718 EASTSDSEKTNLDDKTPDSKRSDADDQVSLISISTSSYDDTIFHTQFKKHTSSSGDENGH 777

Query: 859 PLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAM 918
            LEHP+  AI++EV+DTGPGI+P+L ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA M
Sbjct: 778 LLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATM 837

Query: 919 MNGSMSLDSKVGVGSKFTFTVPLTQTKEL 947
           MNG+M LDSK+GVGSKFTFT+PLTQT+E+
Sbjct: 838 MNGTMKLDSKLGVGSKFTFTLPLTQTREI 866

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1127

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/704 (53%), Positives = 478/704 (67%), Gaps = 38/704 (5%)

Query: 14  KRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKAS 73
           K+  KPP+ ISIR                      GVYFT+++K+++  RLY+A+QLKAS
Sbjct: 6   KKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKAS 65

Query: 74  QIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLAR 133
           QIDQ            S+ + LQN+L  Y AGN ++ NW ++   L+KFL SS+LFS+AR
Sbjct: 66  QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125

Query: 134 VYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLM 193
           +YD++F  ++NA+NNASGN VPESV+ +LF LS N+SLPSSLE  G+ TDPVLN + +LM
Sbjct: 126 LYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLM 185

Query: 194 SMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYD-NREL 252
           SMSLPIFANPSIILS S++YGY++V++SAEGLK+VFNDTTALE+S V ++S  Y     L
Sbjct: 186 SMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNL 245

Query: 253 AGYHLVFP-PYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPC 311
             ++ +F   Y       D  Y I ND+F+ +     KGG++K T+     A A+GYS C
Sbjct: 246 EYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSC 305

Query: 312 SSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQK 371
           S  LV W+AI+ QPE+ F   +T+L R                 FPLSHWAVQP++RLQK
Sbjct: 306 SFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQK 365

Query: 372 ATEIITAGRGLR----------SDNGS-----TLYSHKRSSTAESFSSALHPASIRRSGS 416
           ATE I  GRGLR          S N S     +L +H RSS         +   +  SGS
Sbjct: 366 ATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLG------FNANKLSDSGS 419

Query: 417 VARSSKHKYIPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSE 476
           +  ++       S   T +           I  N +++    HS + G    +  S+ S+
Sbjct: 420 ITANNFKNNTSSSNSITSSH----------IYGNNNSS----HS-SMGINPDDDLSSSSQ 464

Query: 477 RYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAK 536
           +Y TS NLIEARVP Y RL  DELSELT+TFNTMTD LD+HY LLE+RVRART+QLEAAK
Sbjct: 465 KYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAK 524

Query: 537 IEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLH 596
           I+AE ANEAKTVFIANISHELRTPLNGILGMTAI+M E+D+ K++ +LKLIFRSGELLLH
Sbjct: 525 IQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLH 584

Query: 597 IMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMV 656
           I+TELLTFSKNVL+RTKLE+RDF + E+ALQ++SIFGKLAKDQHV L+I ++PN+LR+ V
Sbjct: 585 ILTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYV 644

Query: 657 LWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKA 700
           LWGDSNRI+Q+VMNLVSNALKFTPVDG V+V+  LLGEYDE ++
Sbjct: 645 LWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERS 688

 Score =  199 bits (506), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 122/164 (74%), Gaps = 13/164 (7%)

Query: 1012 DRPFLQSTGTALSTRSVTT----------TSVANKCK---VLVAEDNNVNQEVIKRMLNL 1058
            +RPFLQSTGTA ST++V T            V NK     +LVAEDN+VNQEVIKRML L
Sbjct: 963  NRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKL 1022

Query: 1059 EGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPI 1118
            EG++++DLA DGQDAFDK K  +E    YD+IFMDVQMPR+DGL+AT+MIR EL+YT PI
Sbjct: 1023 EGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPI 1082

Query: 1119 VALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTY 1162
            VAL+A+  + N+KEC+D GMN FL+KPI+RP +K IL +Y   +
Sbjct: 1083 VALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDF 1126

 Score =  152 bits (383), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/123 (58%), Positives = 93/123 (75%), Gaps = 3/123 (2%)

Query: 828 SIESENASSYDDAIFHSRLRKG---NSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQ 884
           S+ + ++ SYDD     +L K    +  EN+ G  L+  +   I++EV+DTG GI+P LQ
Sbjct: 766 SLVTTSSKSYDDTALMKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQ 825

Query: 885 ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQT 944
           ESVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+ MMNG+M L+S+VGVGSKF FT+PL QT
Sbjct: 826 ESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQT 885

Query: 945 KEL 947
           +E+
Sbjct: 886 REI 888

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
           (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/700 (53%), Positives = 482/700 (68%), Gaps = 22/700 (3%)

Query: 14  KRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKAS 73
           ++  KPP+ I+IR                      GVYFT ++K +R+ RL +A++LK+S
Sbjct: 6   RKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSS 65

Query: 74  QIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLAR 133
           QIDQ            ++RD LQNAL  Y AGN T ENW ++   + KFL SS+LF +AR
Sbjct: 66  QIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVAR 125

Query: 134 VYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLM 193
           +YD +F+ V+NA+NN +G+L+P  VL++LFPLSTN SLPSSL   G+LTDPVLN + YLM
Sbjct: 126 LYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLM 185

Query: 194 SMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVY-DNREL 252
           SMSLPI  NPSIILS+S+VYGYIT+V+SA+GLK V+ + TALE+S+V ++S +Y D  ++
Sbjct: 186 SMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKV 245

Query: 253 AGYHLVFPPYGMP-SDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPC 311
            G+H VF       S +I+  Y I N ++L  A  + K GSIK T + +++ +AIGYSPC
Sbjct: 246 DGFHFVFEVENDDFSTLIE--YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPC 303

Query: 312 SSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQK 371
           S  L  WVA++TQPE+ FL PST+L +                 FPLSHWAV+PIVRLQK
Sbjct: 304 SFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQK 363

Query: 372 ATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESAK 431
           ATE+I+ GRGL+    S   +   SST++++  ++  + +R S  + +S ++     +  
Sbjct: 364 ATELISQGRGLKP--TSNFSNGDSSSTSDNWRESVE-SHVRASLGIFKSLRN-----NGS 415

Query: 432 GTLNKND-FEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTNLIEARVP 490
             L  ND   EI     +NN      K       S F        +RY TS NL++ARVP
Sbjct: 416 NELQSNDDMNEINERSSKNNSTGDNIKSSDNDSSSSF--------QRYTTS-NLVQARVP 466

Query: 491 TYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFI 550
            Y R   DELSELT+TFN MT+ LD+HY LLEDRVRART+QLEAAKIEAE ANEAKTVFI
Sbjct: 467 VYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTVFI 526

Query: 551 ANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLK 610
           ANISHELRTPLNGILGMTAI+M E+D  K+K +LKLIFRSGELLLHI+TELLTFSKNVLK
Sbjct: 527 ANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNVLK 586

Query: 611 RTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMN 670
           RT LE+RDF + EIALQ++SIFGK+A+DQHV L I ++PN +R+MVLWGDSNRI+QIVMN
Sbjct: 587 RTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMN 646

Query: 671 LVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAV 710
           LVSNALKFTP+DG+V+V+  LLGEYDE ++ N  +    +
Sbjct: 647 LVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYI 686

 Score =  226 bits (575), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 130/156 (83%), Gaps = 6/156 (3%)

Query: 1012 DRPFLQSTGTALSTRSVTT------TSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVD 1065
            DRPFLQSTGTA S++ + T      T++    ++LVAEDN+VNQEVIKRMLNLE +D++D
Sbjct: 953  DRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNID 1012

Query: 1066 LACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYA 1125
            LACDGQDAFDKVK+  +  ++YD+IFMDVQMP+VDGL +T+MIR +L+Y HPIVALTA+A
Sbjct: 1013 LACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFA 1072

Query: 1126 DDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPT 1161
            +D NIKEC+DAGM+GFL KPI+RPK+K+IL EY  T
Sbjct: 1073 NDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYIDT 1108

 Score =  161 bits (407), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/134 (58%), Positives = 96/134 (71%), Gaps = 5/134 (3%)

Query: 819 NENQNEDAR--SIESENASSYDDAIFHSRLRKG---NSGENEDGRPLEHPRRLAIAMEVQ 873
           NE+ N D    S+ + +  SYDDA    + +K    +  E   G  L  P+   I++EV+
Sbjct: 748 NEDTNNDIEILSMTTSSTRSYDDAALQRQFKKTPDLDDKEETLGVELSEPKTWVISVEVE 807

Query: 874 DTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGS 933
           DTGPGIEP LQE+VFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM+G+M L+S VGVGS
Sbjct: 808 DTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGS 867

Query: 934 KFTFTVPLTQTKEL 947
           KF FTVPL QT+E+
Sbjct: 868 KFIFTVPLKQTREI 881

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/708 (47%), Positives = 459/708 (64%), Gaps = 44/708 (6%)

Query: 19  PPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKASQIDQN 78
           PP+ +++R                      GVYFT+++KS+RAE+L++A+QLK+SQ+DQ+
Sbjct: 12  PPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71

Query: 79  XXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYDSS 138
                         DVL +AL +Y +GN TTENW ++++++  FL SS++FS A +YD++
Sbjct: 72  LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131

Query: 139 FQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSLP 198
           F ++ N SNN +G  +P+ ++ QL PLS++  LP+S+   G LTDPVLN + YLMS+SLP
Sbjct: 132 FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191

Query: 199 IFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNRELA--GYH 256
           IF NPSIILS S+VYGY+T++  A  +  VFNDTTALE+S+V ++S  Y N      GYH
Sbjct: 192 IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251

Query: 257 LVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLV 316
            VFPPYG  + +ID  Y + N+SFL DAF +   GS+ ST F YS  VA+GYS C+  L 
Sbjct: 252 FVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLA 311

Query: 317 QWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQKATEII 376
            WVA+++QPES F   + +L +                 F +S++ V+PI++L++ATE+I
Sbjct: 312 NWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELI 371

Query: 377 TAGRGLRS--DNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESAKGTL 434
           + GRGLR   +N S   S   +ST                 ++  S    Y  E  K   
Sbjct: 372 SRGRGLRPYYENLSDRTSQDNTST---------------RTTIDLSDLDGYTNEKEKSL- 415

Query: 435 NKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQR-----SARSERYI-TSTNLI--- 485
                    P   E+    +L  + S    S+F+  R     S+RS     TSTN I   
Sbjct: 416 ---------PTCTEDERSKSLSNIASK---SIFTTLRKILGFSSRSGMLSPTSTNFIVNN 463

Query: 486 ---EARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGA 542
                RVP ++   +DEL+EL ETFN M D LD H  LLE+RV+ART++LEAAKI AE  
Sbjct: 464 DTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEAT 523

Query: 543 NEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELL 602
           NEAKTVFIANISHELRTPLNGILGMTAIA+ E+D +K++ SLKLI+RSGELLLHI+TELL
Sbjct: 524 NEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELL 583

Query: 603 TFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSN 662
           TFSKNVL++TKLE+  F +H+IALQ++SIFGK+AKDQ VN +I I PN++RTMV +GDSN
Sbjct: 584 TFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSN 643

Query: 663 RIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAV 710
           RI+Q++MNLVSNALKFTP+DG V+V+  LLGEYDE K+S   +D+  +
Sbjct: 644 RIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYI 691

 Score =  159 bits (403), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 95/121 (78%)

Query: 1038 KVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMP 1097
            KVL+ EDN VNQEVIKR+L LE +  ++ A DGQ+A D VK +      +D+IFMD+QMP
Sbjct: 941  KVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMP 1000

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             VDG +ATR+IRNEL+Y +PIVALTA+ADD N KEC ++GMN FLAKPI+R ++KEI+ E
Sbjct: 1001 NVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKE 1060

Query: 1158 Y 1158
            +
Sbjct: 1061 F 1061

 Score =  157 bits (398), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 100/143 (69%)

Query: 805 GKDDTNNETQREDSNENQNEDARSIESENASSYDDAIFHSRLRKGNSGENEDGRPLEHPR 864
           G    ++   + D N+N   + +S +S  +   ++ I  S     N G+   G P+  P+
Sbjct: 718 GSSSIHDYCSKTDENDNIKTEIKSDDSTISDYSEENIMGSYYENKNPGQELLGVPIPKPK 777

Query: 865 RLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMS 924
           +  I+++V+DTGPGI P LQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA++M+G+M 
Sbjct: 778 KWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTME 837

Query: 925 LDSKVGVGSKFTFTVPLTQTKEL 947
           LDS  G+GSKFTFTVPL Q +++
Sbjct: 838 LDSTTGLGSKFTFTVPLLQERKI 860

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/685 (49%), Positives = 439/685 (64%), Gaps = 28/685 (4%)

Query: 18  KPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKASQIDQ 77
           K P+ + +R                      GVYFT +++ +R ++LY+A++LK+SQIDQ
Sbjct: 11  KAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQIDQ 70

Query: 78  NXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYDS 137
                       + RD +++ALT Y AGN + ENWA     L  FL SS +F    +YDS
Sbjct: 71  TINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDS 130

Query: 138 SFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSL 197
            F  +LN +NN + + +P+ VL+ L PLS   SLPS L   G+LTDPVLND+ YLMSMSL
Sbjct: 131 QFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSL 190

Query: 198 PIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNRELAG-YH 256
           PI ANPS+ LS S+V+GY+TVV+SAE ++ V NDTTALE S V ++S+   N      YH
Sbjct: 191 PIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYH 250

Query: 257 LVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLV 316
            VFPP+G   DI++  Y + N +FL DAF   +GGSI  +  LYSKAVAIGY PCS  L 
Sbjct: 251 FVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLA 310

Query: 317 QWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQKATEII 376
            WV  ++QPE  F+  S +L +                 FPLS W+VQPIVRLQKATE+I
Sbjct: 311 NWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVI 370

Query: 377 TAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESAKGTLNK 436
           +        +G+ ++    SS++ S  S+   +   R  S   SS + Y           
Sbjct: 371 S------KRDGNEVHRSNSSSSSRSTFSSNRRSKDGRHNS---SSYNLY----------- 410

Query: 437 NDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTNLIEARVPTYNRLF 496
            D E+    G  N    +L K +        ++  S+ S   +   NL + +VP   R  
Sbjct: 411 EDVEKYTEIGKANKSTESLSKEN-------ITDYSSSNSSAIVMRKNLADFQVPASRRFV 463

Query: 497 SDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHE 556
            DELSELTET+  MTD LD H  LLE RV+ RT+QLEAAKIEAE ANEAKTVFIAN++HE
Sbjct: 464 KDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHE 523

Query: 557 LRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEE 616
           LRTPLNGILGMTAIAM E DM++++SSLKLI+RSGELLLHI+TELLTFSKNVLK+TKLE+
Sbjct: 524 LRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEK 583

Query: 617 RDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNAL 676
             F V ++ALQ+ESIFGK++KDQHV L+I I+PN LR+MVLWGD NRI+Q++MNLVSNAL
Sbjct: 584 THFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNAL 643

Query: 677 KFTPVDGRVNVKFTLLGEYDESKAS 701
           KFTPVDG++ V   LLGEYD+ +++
Sbjct: 644 KFTPVDGKITVNIKLLGEYDKDRSA 668

 Score =  169 bits (427), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 70/123 (56%), Positives = 98/123 (79%)

Query: 1038 KVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMP 1097
            K+L+ EDN VNQ V+ RML LEG+++  +ACDGQ+A +K+K     G++Y L+ MD+QMP
Sbjct: 918  KLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMP 977

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
            +VDG++AT++IR EL Y  PIVALTA+ADD NI+ C  +GM+GFLAKPI+R ++K IL+E
Sbjct: 978  KVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTE 1037

Query: 1158 YCP 1160
            +CP
Sbjct: 1038 FCP 1040

 Score =  165 bits (417), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 74/124 (59%), Positives = 101/124 (81%), Gaps = 3/124 (2%)

Query: 827 RSIESENASSYDDAIFHSRLRKGNSGENED---GRPLEHPRRLAIAMEVQDTGPGIEPAL 883
           +S+ S+   S ++ I+ ++ + G++ ++ D   G PL+  R+  I++EV+DTGPGIEP+L
Sbjct: 710 KSVASDTERSTNNTIYSNKFKNGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSL 769

Query: 884 QESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQ 943
           Q+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +M+G+M L+S+VGVGSKF FTVPL Q
Sbjct: 770 QKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQ 829

Query: 944 TKEL 947
           T+E+
Sbjct: 830 TREI 833

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
           similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/692 (50%), Positives = 458/692 (66%), Gaps = 19/692 (2%)

Query: 14  KRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKAS 73
           K   +PP+   +                       GVYFT+++KS+RA+RL VA+QL ++
Sbjct: 20  KHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSA 79

Query: 74  QIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLAR 133
           QI+Q            S+RD +QNAL  Y  GNT++ N  +A   L KFL SSN      
Sbjct: 80  QINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTH 139

Query: 134 VYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLM 193
           +YDS+F +VL+ S N++GN++ + +L  L PLS+N  LPSS+   GML++PV N + + M
Sbjct: 140 LYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFM 199

Query: 194 SMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYD-NREL 252
           SMSLP+ A  SI+   S   GYIT+V+SA+ + +V     AL  S+V +++ VYD N  L
Sbjct: 200 SMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNIL 259

Query: 253 AGYHLVFPP--YGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSP 310
             Y ++FPP    +P  +++  + I N+SFL +AF     GS+  T+  Y   VA+GY+ 
Sbjct: 260 NSYQVLFPPSIVQVPR-LLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAA 318

Query: 311 CSSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVRLQ 370
           CS  LV WVA++ Q E+ FL PST+L +                 F +++WAV+PIVRLQ
Sbjct: 319 CSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQ 378

Query: 371 KATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESA 430
           KATE+I AGRGLRS   S+  S + +S   S S      ++R    + ++    Y P   
Sbjct: 379 KATELIAAGRGLRSYRHSSRSSSRTTSINRSNSKGSPSPTLREGDGLRKTPPSPYTP--- 435

Query: 431 KGTLNKNDFEEIQPDGI--ENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTNLIEAR 488
                 +   E  P GI  E + D A + +    P S  SE    R + + TS N IE R
Sbjct: 436 -----MHSHVEPNPSGIGREYSVDIA-RAIGIEVPSSHPSE----RVDAFTTSANWIETR 485

Query: 489 VPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTV 548
           VP Y RLFSDELSELT+TFN+MTDELDRHYALLEDRVRART+QLEAAKI+AE ANEAKT+
Sbjct: 486 VPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTM 545

Query: 549 FIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNV 608
           FIANISHELRTPLNGILGMTAIAMAENDM+KV++SLKLIFRSGELLLHI+TELLTFSKN+
Sbjct: 546 FIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELLTFSKNI 605

Query: 609 LKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIV 668
           LKR KLE+R+F++ ++ALQV+SIFGKLAKDQ+V  +I ++PN++R MVLWGDSNRI+QIV
Sbjct: 606 LKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIV 665

Query: 669 MNLVSNALKFTPVDGRVNVKFTLLGEYDESKA 700
           MNLVSNALKFTPVDG+V+++  LLGEYDE ++
Sbjct: 666 MNLVSNALKFTPVDGKVSLRIKLLGEYDEEES 697

 Score =  212 bits (539), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 99/155 (63%), Positives = 126/155 (81%), Gaps = 1/155 (0%)

Query: 1012 DRPFLQSTGTALSTRSVTTT-SVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDG 1070
            DRPFLQSTGTA STRS+ T  S+ +  KVLVAEDNNVNQEVIKRML LEG+ D++LACDG
Sbjct: 952  DRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDG 1011

Query: 1071 QDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNI 1130
            ++A +KV         Y+++FMDVQMP++DGL ATR IR EL+YT+PIVALTA+ADD NI
Sbjct: 1012 EEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNI 1071

Query: 1131 KECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKA 1165
            K C+++GM+GFL+KPI+R K+++IL EYCP   K+
Sbjct: 1072 KVCLESGMDGFLSKPIKREKLRKILLEYCPVLNKS 1106

 Score =  165 bits (417), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/144 (59%), Positives = 103/144 (71%), Gaps = 7/144 (4%)

Query: 807 DDTNNETQREDSNENQNEDARSIESENASSYDDAIFHSRLRKGNSGENEDGRPL------ 860
           DDT  ET +E + +    D  S+ S   SSYDDAIFHSR +K  +  + D   L      
Sbjct: 738 DDTI-ETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS 796

Query: 861 EHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMN 920
           E  +   I++EV+DTGPGI+P+LQESVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ MM 
Sbjct: 797 EKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMK 856

Query: 921 GSMSLDSKVGVGSKFTFTVPLTQT 944
           G+M L S+VGVGSKF FTVPL QT
Sbjct: 857 GTMKLHSEVGVGSKFIFTVPLRQT 880

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/745 (46%), Positives = 449/745 (60%), Gaps = 56/745 (7%)

Query: 9   LGAYAKR--KLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYV 66
           LG   KR   LKPPF   +R                      GVYFTS+++++RA+RL+V
Sbjct: 3   LGYLRKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHV 62

Query: 67  ASQLKASQIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSS 126
           A++L +SQ+DQ+           ST+D +QNAL+ Y AGN + ENW +A   L  FL  S
Sbjct: 63  AARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERS 122

Query: 127 NLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTN-VSLPSSLEVKGMLTDPV 185
             F +A +YD  +Q+VL+  NN +   + E  L +L PL  +      +L+V+ + T P 
Sbjct: 123 KTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQ-VETLP- 180

Query: 186 LNDTGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSV-ILVS 244
            N T  LMSM+LP+ A  S I+    V G++T+V+SA+ + T  NDT+ L +S V IL  
Sbjct: 181 YNKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPI-TAVNDTSVLGESMVSILTG 237

Query: 245 TVYDNRELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYS--- 301
              D   L  Y  VFPP      + +  Y I N SFL DAF       + ST   Y    
Sbjct: 238 IPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGA 297

Query: 302 -----KAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXF 356
                K VA+GYS C    + WVA+++Q ES FL P+ +L +                 F
Sbjct: 298 LGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTF 357

Query: 357 PLSHWAVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGS 416
            L+ WAV+PIVRLQKATE I AGRGLR+      Y+H   S++++        SI RS S
Sbjct: 358 ILASWAVKPIVRLQKATEFIAAGRGLRT------YNHSGRSSSQN-------TSIDRSNS 404

Query: 417 VARSSKHKYIPESAKGTLNKNDFEE---IQPDGIEN------------NEDAALQKVHSP 461
             R S H         +L +  FE+   + P   EN            + +  L  +   
Sbjct: 405 --RGSDH---------SLPRELFEKKHHVSPFVTENHAANSGSCSSMSDHERYLHHIARY 453

Query: 462 TPGSLFSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALL 521
             G   +   S   +   ++TN I+ RVP Y RLF+DELSELT+TFNTMTDELDR Y +L
Sbjct: 454 HDGETSTNILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVL 513

Query: 522 EDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVK 581
           EDRVRART+QLEAAKI+AE ANEAKTVFIANI HELRTPLNGILGMTAIAMAE D +K++
Sbjct: 514 EDRVRARTKQLEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQ 573

Query: 582 SSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHV 641
           +SLKLIFRSGELLLHI+TELLTFSKNVLKRTKLEER F++ +IALQV+SIFGKLAKDQHV
Sbjct: 574 NSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHV 633

Query: 642 NLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKAS 701
            L+I ++PN +RTMVLWGDSNRI+QIVMNLVSNALKFTPVDG+V+V+  L+GEYD +++ 
Sbjct: 634 KLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSE 693

Query: 702 NGCFDRAAVVPIQESEKESSTLGPT 726
              F    ++P  E    S    PT
Sbjct: 694 ACNFSEVYILPGTEVTNSSVNNIPT 718

 Score =  216 bits (550), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 124/148 (83%), Gaps = 1/148 (0%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVA-NKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDG 1070
            DRPFLQSTGTA STRSV T S A +  ++LVAEDNNVNQEVIKRML+LEG  ++DLACDG
Sbjct: 950  DRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDG 1009

Query: 1071 QDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNI 1130
            +DA+ KV A  E G+ YDLIFMDVQMPR+DGL  T+++R +L Y +PIVALTA+ADD NI
Sbjct: 1010 EDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNI 1069

Query: 1131 KECIDAGMNGFLAKPIRRPKIKEILSEY 1158
            KEC+++GMN FLAKPI+RP +K+IL E+
Sbjct: 1070 KECLESGMNSFLAKPIKRPMLKKILLEH 1097

 Score =  178 bits (452), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 91/145 (62%), Positives = 106/145 (73%), Gaps = 8/145 (5%)

Query: 807 DDTNNETQREDSNENQNEDARSIESENASSYDDAIFHSRLRK-------GNSGENEDGRP 859
           DDT  E +++DS    + DA SI S  A+SYDDA+ H++L+K        +S  N     
Sbjct: 734 DDTP-ERKKKDSETVDDADAISISSSVATSYDDAVLHAQLKKIPTFIDLEDSDNNVTMSK 792

Query: 860 LEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMM 919
           LE PR   I +EVQDTGPGIEP+L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MM
Sbjct: 793 LEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMM 852

Query: 920 NGSMSLDSKVGVGSKFTFTVPLTQT 944
            G+M L+SKVG GSKFTFTVPL QT
Sbjct: 853 KGTMKLESKVGSGSKFTFTVPLQQT 877

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  529 bits (1363), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 303/717 (42%), Positives = 434/717 (60%), Gaps = 16/717 (2%)

Query: 14  KRKLKPPFLISIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSMRAERLYVASQLKAS 73
           K+ +KPP+  S+R                      GVYFT+ +K +   RLY+ASQLK+S
Sbjct: 14  KQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQLKSS 73

Query: 74  QIDQNXXXXXXXXXXXSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLAR 133
           QIDQ            ++R+ +Q  +     G        ++ + LDKF+G+S+LF    
Sbjct: 74  QIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTM 133

Query: 134 VYDSSFQDVLNASNNASGNLVPESVLTQLFPLS-TNVSLPSSLEVKGMLTDPVLNDTGYL 192
           +YD + + ++N++NN SG+ V  S+L++L PLS TN ++P  +   G+LTDP+LN T YL
Sbjct: 134 IYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNSTKYL 193

Query: 193 MSMSLPI---FANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDN 249
           MSMSLPI   ++  + I + S +YGY+TVV+SAE LK+VFNDT  L DS+  L+S +Y N
Sbjct: 194 MSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTN 253

Query: 250 RELAGY-HLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGY 308
             L  Y H VFPP+ +   IID+R TI N +F   AF ++K GS K    +  K  AIGY
Sbjct: 254 DTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNYAIGY 313

Query: 309 SPCSSDLVQWVAIITQPESKFLYPSTRLARXXXXXXXXXXXXXXXXXFPLSHWAVQPIVR 368
           +P +  L +WVA++  P+ +F   S +L +                  PLS+WAVQPIVR
Sbjct: 314 APTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVR 373

Query: 369 LQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPE 428
           LQ+A+E+IT  RGLR+ N  +        T +S     + + +  S    ++S      E
Sbjct: 374 LQRASELITKRRGLRNLNDDSFDDSNDDHTYDSNDDHTYESKLISSTPTLKNSDSNIHDE 433

Query: 429 SAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTNLIEAR 488
            +  T         + D      ++     ++         +R+     +++ +   E +
Sbjct: 434 KSGRT---------RGDANSGTLNSNNTITNNTNNKDFNRLRRNVSVSTHVSLSEFDEIQ 484

Query: 489 VPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTV 548
           VP Y +LF DEL+ELT+TFN M++ LD HYALLE RV  RT+QLEAAK++AE ANEAKTV
Sbjct: 485 VPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAANEAKTV 544

Query: 549 FIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNV 608
           FIANISHELRTPLNGILGMT+ ++ END++K+K  LKLIFRSGELLL+I+TELLTFSKNV
Sbjct: 545 FIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLTFSKNV 604

Query: 609 LKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIP-NVLRTMVLWGDSNRIVQI 667
           L +TKLE R+F + EI  Q+++IF KL + Q V L I ++P   L++++ +GDSNRI+Q+
Sbjct: 605 LNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSNRILQV 664

Query: 668 VMNLVSNALKFTP-VDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKESSTL 723
           +MNL+SNA+KFTP V+G+V V   LLGEYDE ++    + +  + P  +   ES  L
Sbjct: 665 LMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGEL 721

 Score =  157 bits (398), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/126 (59%), Positives = 96/126 (76%)

Query: 1033 VANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFM 1092
            + +K KVLVAEDN VNQEVIKRML LE + D++LA DG +AF+KVK    + K YD+IFM
Sbjct: 1011 IPSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFM 1070

Query: 1093 DVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIK 1152
            D+QMP++DGL +T  IR EL Y   IVALTA+AD+ NIKEC DAGM+GF+ KPI+R  + 
Sbjct: 1071 DIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALH 1130

Query: 1153 EILSEY 1158
             +L E+
Sbjct: 1131 TLLEEF 1136

 Score =  129 bits (323), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 79/110 (71%), Gaps = 3/110 (2%)

Query: 837 YDDAIFHSRLRKGNSGENEDGRPLEH---PRRLAIAMEVQDTGPGIEPALQESVFEPFVQ 893
           YD+ +F+  +++   G+  D + LE     ++  I  EV D GPGI+  L +SVF+PFVQ
Sbjct: 798 YDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQ 857

Query: 894 GDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQ 943
           GDQTLSRQYGGTGLGLSIC+QL  MM G++ L+S++G GSKF +T+PL Q
Sbjct: 858 GDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQ 907

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
           YIL147C
          Length = 1214

 Score =  313 bits (802), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 178/258 (68%), Positives = 216/258 (83%), Gaps = 1/258 (0%)

Query: 466 LFSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRV 525
            FS  +S+ +     ST ++E +VP Y RLF DELSELT+TFNTM+D LD+HYALLE+RV
Sbjct: 457 FFSSHKSSNTPPPPMST-ILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERV 515

Query: 526 RARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLK 585
           RART+QLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAI+M E+D+  +KSSLK
Sbjct: 516 RARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLK 575

Query: 586 LIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTI 645
           LIFRSGELLLHI+TELLTFSKNVL+RTKLEERDF + ++ALQ++SIFGK+AKDQHV L+I
Sbjct: 576 LIFRSGELLLHILTELLTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSI 635

Query: 646 SIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCF 705
            +IPN +RT+VLWGDSNRI+QIVMNLVSNALKFTP+DG+V+V+ +LLGEYD+ K+    +
Sbjct: 636 YLIPNEIRTLVLWGDSNRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADY 695

Query: 706 DRAAVVPIQESEKESSTL 723
               V    E E+  S +
Sbjct: 696 KEVFVKTGTEPEENYSKI 713

 Score =  191 bits (485), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 127/204 (62%), Gaps = 53/204 (25%)

Query: 1012 DRPFLQSTGTALST----------RSVTTTSVAN-------------------------- 1035
            DRPFLQSTGTA ST           S T  +V N                          
Sbjct: 997  DRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNN 1056

Query: 1036 ------------KCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVK----- 1078
                          ++LV EDN+VNQEVIKRML LE L ++DLACDG++A+ KVK     
Sbjct: 1057 SSIIIDEEEEDEGIRILVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSI 1116

Query: 1079 ARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGM 1138
            +  +   +YDLIFMDVQMPR+DGL +T++IR+EL YT PIVALTA+AD+ NIKEC+D GM
Sbjct: 1117 SNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGM 1176

Query: 1139 NGFLAKPIRRPKIKEILSEYCPTY 1162
            +GFL+KPI+RPK+K+IL+E+CP Y
Sbjct: 1177 DGFLSKPIKRPKLKDILNEFCPGY 1200

 Score =  164 bits (416), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 91/115 (79%), Gaps = 4/115 (3%)

Query: 837 YDDAIFHSRLRKGNSGENED----GRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFV 892
           YD+ +F+ + +K    ++ D    G  ++ P+   I +EV+DTGPGI PALQESVFEPFV
Sbjct: 782 YDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPALQESVFEPFV 841

Query: 893 QGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKEL 947
           QGDQ LSRQYGGTGLGLSICRQLA MMNG+M L+SKVG GSKFTFTVPLTQT+E+
Sbjct: 842 QGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQTREI 896

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 72/129 (55%), Gaps = 9/129 (6%)

Query: 1031 TSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDL 1089
            TS+     VL+ ED++V  ++  + L   G   V++  DG  A + V+      KF YDL
Sbjct: 312  TSLRPGFHVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVE------KFQYDL 364

Query: 1090 IFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRP 1149
            + MD+ MP +DG +AT +IR+  + T PI+A+T   +D+++   +  GMN  LAKP  + 
Sbjct: 365  VLMDIVMPNLDGATATSVIRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKD 423

Query: 1150 KIKEILSEY 1158
             +  +L  Y
Sbjct: 424  DLHSMLVRY 432

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 69/121 (57%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED++V  ++  + L   G   V++  DG  A + V+      KF YDL+ MD+ MP
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVE------KFQYDLVLMDIVMP 383

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT +IR+  + T PI+A+T   +D+++   +  GMN  LAKP  +  +  +L  
Sbjct: 384  NLDGATATSVIRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIR 442

Query: 1158 Y 1158
            Y
Sbjct: 443  Y 443

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 68.2 bits (165), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 76/140 (54%), Gaps = 10/140 (7%)

Query: 1018 STGTALSTRSVTTTSVANK-CKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDK 1076
            S+ ++ +T+ V    V  K   VL+ ED++V+ ++  + L   G       C  Q   D 
Sbjct: 385  SSNSSSTTKEVDQNIVLRKGFHVLLVEDDSVSIQLCSKFLRKYG-------CTVQVVTDG 437

Query: 1077 VKARNEAGKF-YDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECID 1135
            + A +   KF YDL+ MD+ MP +DG +AT ++R+  + T PI+A+T   +D+++   + 
Sbjct: 438  LSAISNLEKFRYDLVLMDIVMPNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLITYLQ 496

Query: 1136 AGMNGFLAKPIRRPKIKEIL 1155
             GMN  LAKP  R  +  IL
Sbjct: 497  HGMNDILAKPFTRNDLHSIL 516

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 68/121 (56%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED+ ++ ++  + L   G   V++  DG  A   ++      KF YDL+ MD+ MP
Sbjct: 355  VLLVEDDAISIQLCSKFLRKYGCT-VEVVTDGLSAISTLE------KFRYDLVLMDIVMP 407

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT +IR+  + T PI+A+T   +D+++   +  GMN  LAKP  R  +  +L  
Sbjct: 408  NLDGATATSIIRSFDNQT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLIR 466

Query: 1158 Y 1158
            Y
Sbjct: 467  Y 467

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 67/121 (55%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED+ V+  +  + L   G   V++  DG  A   ++      KF YDL+ MD+ MP
Sbjct: 383  VLLVEDDAVSIRLCSKFLRKYGCT-VEVVTDGLSAISTLE------KFRYDLVLMDIVMP 435

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT +IRN  + T PI+A+T   +D+++   +  GMN  LAKP  +  +  +L  
Sbjct: 436  NLDGATATSIIRNFDNQT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIR 494

Query: 1158 Y 1158
            Y
Sbjct: 495  Y 495

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 68/121 (56%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED+ V  ++  + L   G   V++  DG  A   ++      KF YDL+ MD+ MP
Sbjct: 336  VLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLSAISTLE------KFRYDLVLMDIVMP 388

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT ++R+  ++T PI+A+T   +D+++   +  GMN  LAKP  +  +  +L  
Sbjct: 389  NLDGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIR 447

Query: 1158 Y 1158
            Y
Sbjct: 448  Y 448

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 66/121 (54%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED++V+ ++  + L   G       C  Q   D + A +   KF +DL+ MD+ MP
Sbjct: 384  VLLVEDDDVSIQLCSKFLRKYG-------CTVQVVTDGLAAISILEKFRFDLVLMDIVMP 436

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT +IRN  + T PI+A+T   + +++   +  GMN  LAKP  R  +  IL  
Sbjct: 437  NLDGATATSIIRNFDNRT-PIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSILIR 495

Query: 1158 Y 1158
            Y
Sbjct: 496  Y 496

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 7/120 (5%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPR 1098
            VL+ ED+ V  ++  + L   G   V +  DG  A   ++        +DL+ MD+ MP 
Sbjct: 418  VLLVEDDEVCIQLCSKFLRKYGCT-VRVVTDGLTAISVLENHR-----FDLVLMDIVMPN 471

Query: 1099 VDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
            +DG +AT ++RN  +YT PI+A+T   +D+++   +  GMN  LAKP  +  +  +L  Y
Sbjct: 472  LDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLVRY 530

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1029 TTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-Y 1087
            TT ++     VL+ ED+ V+ ++  + L   G       C  Q   D + A +   KF Y
Sbjct: 371  TTVTLRKGFHVLLVEDDAVSIQLCSKFLRKYG-------CTVQVVTDGLSAISTLEKFRY 423

Query: 1088 DLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIR 1147
            DL+ MD+ MP +DG +AT ++R+  + T PI+A+T    ++++   +  GMN  LAKP  
Sbjct: 424  DLVLMDIVMPNLDGATATSIVRSFDNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFT 482

Query: 1148 RPKIKEILSEY 1158
            R  +  IL  Y
Sbjct: 483  RDDLHSILIRY 493

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPR 1098
            VL+ ED+ ++ ++  + L   G   V +  DG  A   ++        YDL+ MD+ MP 
Sbjct: 405  VLLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSAITTLE-----NSRYDLVLMDIVMPN 458

Query: 1099 VDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
            +DG +AT +IR+  + T PI+A+T   DD ++   +  GMN  LAKP  R  +  +L  Y
Sbjct: 459  LDGATATSIIRSFDNQT-PIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSMLIRY 517

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 69/121 (57%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED++V  ++  + L   G   V++  DG  A   ++      KF YDL+ MD+ MP
Sbjct: 309  VLLVEDDSVCIQLCSKFLLKYGCS-VEVVTDGLSAISTLE------KFRYDLVLMDIVMP 361

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT ++R+  + T PI+A+T   +D+++   ++ GMN  LAKP  +  +  +L  
Sbjct: 362  NLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLIR 420

Query: 1158 Y 1158
            Y
Sbjct: 421  Y 421

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 67/120 (55%), Gaps = 7/120 (5%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPR 1098
            VL+ ED++V  ++  + L   G   V++  DG  A   ++ +      +DL+ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAISTLEKQR-----FDLVLMDIVMPN 384

Query: 1099 VDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
            +DG +AT ++R+  + T PI+A+T   DD+++   +  GMN  LAKP  +  +  +L  Y
Sbjct: 385  LDGATATSIVRSFDNET-PIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 77/170 (45%), Gaps = 29/170 (17%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ 1071
            D PFL+S     +T S+T   V  K  VLV EDN +NQ ++   L    +    +A +G 
Sbjct: 394  DSPFLRSAMETFTTESITRDKVFPKISVLVVEDNMINQTILSSFLRKHKI-SYKVAKNGI 452

Query: 1072 DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR-----NELSYTHP--------- 1117
            +A D+ K   E G    LI MD++MP + G+ A + IR     N +    P         
Sbjct: 453  EAVDRWK---EGG--MHLILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPAK 507

Query: 1118 ---------IVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
                     IVALTA     +  E + AG N +L KP+    +   ++E+
Sbjct: 508  RSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPVNLDWLTRKITEW 557

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 66/121 (54%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED+ V+ ++  + L       +   C  Q   D + A +   K+ +DL+ MD+ MP
Sbjct: 352  VLLVEDDEVSIQLCSKFL-------IKYGCTVQVVTDGLAAISTLEKYRFDLVLMDIVMP 404

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT +IRN  + T PI+A+T   + +++   +  GMN  LAKP  R  +  +L+ 
Sbjct: 405  NLDGATATSIIRNFDNET-PIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSMLTR 463

Query: 1158 Y 1158
            Y
Sbjct: 464  Y 464

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 65/121 (53%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED+ V+ ++  + L   G       C  Q   D + A +   KF YDL+ MD+ MP
Sbjct: 380  VLLVEDDAVSIQLCSKFLRKYG-------CTVQVVTDGLSAISTLEKFRYDLVLMDIVMP 432

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT ++R+  + T PI+A+T    ++++   +  GMN  LAKP  R  +  IL  
Sbjct: 433  NLDGATATSIVRSFDNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIR 491

Query: 1158 Y 1158
            Y
Sbjct: 492  Y 492

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED+ V  ++  + L   G   V++  DG  A   ++      KF YDL+ MD+ MP
Sbjct: 378  VLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLE------KFRYDLVLMDIVMP 430

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT ++R+   +T PI+A+T   +D+++   +  GMN  LAKP  +  +  +L  
Sbjct: 431  NLDGATATSIVRSFDIHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIR 489

Query: 1158 Y 1158
            Y
Sbjct: 490  Y 490

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 65/121 (53%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED+ V+ ++  + L   G       C  Q   D + A +   KF YDL+ MD+ MP
Sbjct: 381  VLLVEDDVVSIQLCSKFLRKYG-------CTVQVVTDGLSAISTLEKFRYDLVLMDIVMP 433

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT ++R+  + T PI+A+T    ++++   +  GMN  LAKP  R  +  IL  
Sbjct: 434  NLDGATATSIVRSFDNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIR 492

Query: 1158 Y 1158
            Y
Sbjct: 493  Y 493

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 63/117 (53%), Gaps = 7/117 (5%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPR 1098
            VL+ ED+ V+ ++  + L   G   V++  DG  A   ++A       YDL+ MD+ MP 
Sbjct: 426  VLLVEDDAVSIQLCSKFLRKSGCT-VEVVTDGLAAISILEAFR-----YDLVLMDIVMPN 479

Query: 1099 VDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEIL 1155
            +DG +AT +IRN      PI+A+T   +D+++   +  GM   LAKP  R  +  +L
Sbjct: 480  LDGATATSIIRN-FDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSML 535

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 68/121 (56%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED+++  ++  + L   G   V++  DG  A   ++      KF YDL+ MD+ MP
Sbjct: 307  VLLVEDDSICIQLCSKFLMKYGCT-VEVVTDGLSAISTLE------KFRYDLVLMDIVMP 359

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT ++R+  + T PI+A+T   +D+++   +  GMN  LAKP  +  +  +L  
Sbjct: 360  NLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIR 418

Query: 1158 Y 1158
            Y
Sbjct: 419  Y 419

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 67/121 (55%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED+++  ++  + L       +  AC  +   D + A +   KF +DL+ MD+ MP
Sbjct: 304  VLLVEDDSICIQLCSKFL-------MKYACTVEVVTDGLSAISTLEKFRFDLVLMDIVMP 356

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT ++R+  + T PI+A+T   +D+++   +  GMN  LAKP  +  +  +L  
Sbjct: 357  NLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIR 415

Query: 1158 Y 1158
            Y
Sbjct: 416  Y 416

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (53%), Gaps = 9/121 (7%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF-YDLIFMDVQMP 1097
            VL+ ED+ V+ ++  + L   G       C  Q   D + A +   K+ YDL+ MD+ MP
Sbjct: 379  VLLVEDDAVSIQLCSKFLRKYG-------CTVQVVSDGLSAISTLEKYRYDLVLMDIVMP 431

Query: 1098 RVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSE 1157
             +DG +AT ++R+  + T PI+A+T    ++++   +  GMN  LAKP  R  +  IL  
Sbjct: 432  NLDGATATSIVRSFDNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIR 490

Query: 1158 Y 1158
            Y
Sbjct: 491  Y 491

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 77/167 (46%), Gaps = 28/167 (16%)

Query: 1014 PFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDA 1073
            PF+ S   +++T S+T   V  K  VLV EDN +NQ ++   L    +    +A +G +A
Sbjct: 383  PFILSAMESVTTESITRDKVFPKISVLVVEDNMINQAILSSFLRKHKI-HYKVAKNGVEA 441

Query: 1074 FDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR-----NELSYTHP----------- 1117
             D+ K   E G    LI MD++MP + G+ A + IR     N +    P           
Sbjct: 442  VDRWK---EGG--MHLILMDLEMPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLT 496

Query: 1118 ------IVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
                  IVALTA     +  E + AG N +L KP+    +   ++E+
Sbjct: 497  CKAPVIIVALTASNSQTDKTEALLAGCNDYLTKPVNLDWLTRKITEW 543

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 74/141 (52%), Gaps = 13/141 (9%)

Query: 1025 TRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAG 1084
            T + T+ +V  K  VL+ EDN +NQ ++   L    +    +A +G++A D  K   E G
Sbjct: 505  TNTSTSANVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK---EGG 560

Query: 1085 KFYDLIFMDVQMPRVDGLSATRMIRN-----ELSYTHP--IVALTAYADDRNIKECIDAG 1137
                LIFMD+Q+P + G+ A + IR+       S   P  IVALTA     + ++ + +G
Sbjct: 561  --LHLIFMDLQLPVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISG 618

Query: 1138 MNGFLAKPIRRPKIKEILSEY 1158
             N +L KP+    + + ++E+
Sbjct: 619  CNDYLTKPVNLHWLSKKITEW 639

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 70/143 (48%), Gaps = 26/143 (18%)

Query: 1036 KCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQ 1095
            K  VL+ EDN +NQ +++  L    +    +A +GQ+A D+ K   E G   DLIFMD+Q
Sbjct: 500  KITVLIVEDNVINQAILRSFLKKHKIS-YKVAKNGQEAVDRWK---EGG--IDLIFMDLQ 553

Query: 1096 MPRVDGLSATRMIR-----NELSYTHP---------------IVALTAYADDRNIKECID 1135
            +P   G+ A + IR     N  S T P               IVA TA     + +E + 
Sbjct: 554  LPVFSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALL 613

Query: 1136 AGMNGFLAKPIRRPKIKEILSEY 1158
            +G N +L KP+    + + ++E+
Sbjct: 614  SGCNDYLTKPVNLHWLSKKINEW 636

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 85/188 (45%), Gaps = 41/188 (21%)

Query: 1017 QSTGTALSTR--SVTTTS--VANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQD 1072
            Q   TAL T    +TTTS  V  K  VL+ EDN +NQ ++   L    +    +A +G++
Sbjct: 439  QQNITALDTLPFKLTTTSEKVFPKINVLIVEDNVINQAILGSFLRKNKIS-YKIAKNGKE 497

Query: 1073 AFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNEL-------------------- 1112
            A DK K  N       LIFMD+Q+P + G+ A + IR EL                    
Sbjct: 498  AVDKWKEGN-----LHLIFMDLQLPVLSGIEAAKKIR-ELEKERGIANQSERVSTPGSLS 551

Query: 1113 ------SYTHP--IVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY-C-PTY 1162
                  S   P  IVALTA     + +E + +G N +L KP+    + + ++E+ C    
Sbjct: 552  SINMNGSTNSPVIIVALTASNSQEDKREALISGCNDYLTKPVNLLWLSKKITEWGCMQAL 611

Query: 1163 FKADGEKK 1170
               DG KK
Sbjct: 612  IDFDGWKK 619

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 88/191 (46%), Gaps = 37/191 (19%)

Query: 1014 PFLQSTGTALSTRSVTTTS--VANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ 1071
            PF  S+         TTTS  V  K  VL+ EDN +NQ ++   L    +    LA +GQ
Sbjct: 461  PFAVSSPPDPLPNLFTTTSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQ 519

Query: 1072 DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRN-----------ELSYTHP--- 1117
            +A +  K   E G    LIFMD+Q+P + G+ A + IR+            L+ ++P   
Sbjct: 520  EAVNIWK---EGG--LHLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHE 574

Query: 1118 -------------IVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY-C-PTY 1162
                         IVALTA     + ++ + +G N +L KP+    + + ++E+ C    
Sbjct: 575  KLPCKKFSQAPVIIVALTASNSQMDKRKALVSGCNDYLTKPVNLHWLSKKITEWGCMQAL 634

Query: 1163 FKADGEKKGKT 1173
               DG K+G++
Sbjct: 635  IDFDGWKQGES 645

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 72/152 (47%), Gaps = 27/152 (17%)

Query: 1028 VTTTS--VANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGK 1085
            +TTTS  V  K  VL+ EDN +NQ ++   L    +    +A +G++A D  K   E G 
Sbjct: 534  ITTTSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK---EGG- 588

Query: 1086 FYDLIFMDVQMPRVDGLSATRMIR-------------------NELSYTHPIVALTAYAD 1126
               LIFMD+Q+P + G+ A R IR                   N+      IVALTA   
Sbjct: 589  -LHLIFMDLQLPVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNS 647

Query: 1127 DRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
              + +  + +G N +L KP+    + + ++E+
Sbjct: 648  QDDKRNALISGCNDYLTKPVNLHWLSKKITEW 679

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 79/174 (45%), Gaps = 36/174 (20%)

Query: 1029 TTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYD 1088
            T   V  K  VL+ EDN +NQ ++   L    +   ++A +G +A +K +     G  + 
Sbjct: 541  TRDKVFPKINVLIVEDNIINQAILVSFLKRHRIS-YEIAKNGAEAVEKWRQ----GGIH- 594

Query: 1089 LIFMDVQMPRVDGLSATRMIR-----NELSYTHP-----------------------IVA 1120
            LI MD+Q+P + GL AT+ IR     N ++  H                        IVA
Sbjct: 595  LILMDLQLPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVA 654

Query: 1121 LTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY-C-PTYFKADGEKKGK 1172
            LTA++   + +E + AG N +L KP+    +   ++E+ C       DG  KG+
Sbjct: 655  LTAFSSHADRREALVAGCNDYLTKPVNLDWLSSKITEWGCMQALIDFDGWTKGE 708

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 88/170 (51%), Gaps = 14/170 (8%)

Query: 1013 RPF-LQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ 1071
            RP  + ++G  L++ + TT  V  K  VL+ EDN +NQ ++   L    +    +A +G+
Sbjct: 450  RPLRISTSGFTLTSATTTTEKVFPKINVLIVEDNVINQAILGGFLRKHKI-SYKVAKNGK 508

Query: 1072 DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRN---ELSYTHP--IVALTAYAD 1126
            +A +  K     G  + LIFMD+Q+P + G+ A + IR+   E     P  IVALTA   
Sbjct: 509  EAVEMWK----NGGLH-LIFMDLQLPVLSGIDAAKQIRDFEKERPSCAPVIIVALTASNS 563

Query: 1127 DRNIKECIDAGMNGFLAKPIRRPKIKEILSEY-C-PTYFKADGEKKGKTE 1174
              + +  + +G N +L KP+    + + ++E+ C       D  K+G+++
Sbjct: 564  AEDKRNALVSGCNDYLTKPVNLHWLSKKITEWGCMQALIDFDSWKQGQSK 613

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 70/159 (44%), Gaps = 34/159 (21%)

Query: 1027 SVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKF 1086
            S T+  V  K  VL+ EDN +NQ ++   L    +    +A +GQ+A D  +   E G  
Sbjct: 555  SATSDKVFPKINVLIVEDNVINQTILSSFLRKHKIF-YKVAKNGQEAIDVWR---EGG-- 608

Query: 1087 YDLIFMDVQMPRVDGLSATRMIRNELSYTHPI---------------------------V 1119
              LIFMD+Q+P + G+ A + IR EL   H I                           V
Sbjct: 609  IHLIFMDLQLPVLSGIDAAKKIR-ELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIV 667

Query: 1120 ALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
            A TA     + KE + +G N +L KP+    +   ++E+
Sbjct: 668  AFTASKSQSDKKEALISGCNDYLTKPVNLHWLSNKINEW 706

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 79/174 (45%), Gaps = 35/174 (20%)

Query: 1014 PFLQSTGTALSTRSVTTTS--VANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ 1071
            PF  S+         TTTS  V  K  VL+ EDN +NQ ++   L    +    LA +GQ
Sbjct: 479  PFAVSSPPDPLPNLFTTTSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQ 537

Query: 1072 DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRN-----------ELSYTHP--- 1117
            +A +  K   E G    LIFMD+Q+P + G+ A + IR+            L+ +H    
Sbjct: 538  EAVNIWK---EGG--LHLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLE 592

Query: 1118 -------------IVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
                         IVALTA     + ++ + +G N +L KP+    + + ++E+
Sbjct: 593  KGTSKRFSQAPVIIVALTASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEW 646

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 79/171 (46%), Gaps = 36/171 (21%)

Query: 1033 VANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFM 1092
            V  K  VL+ EDN +NQ ++   L    +   ++A +G +A +K +     G  + LI M
Sbjct: 505  VFPKINVLIVEDNIINQAILSSFLRKHKIS-YEIAKNGVEAVEKWRK----GGIH-LILM 558

Query: 1093 DVQMPRVDGLSATRMIRN-----------------------ELS---YTHP--IVALTAY 1124
            D+Q+P + G+ A + IRN                       EL+   +  P  IVALTA+
Sbjct: 559  DLQLPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAF 618

Query: 1125 ADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY-C-PTYFKADGEKKGKT 1173
            +   +  E + AG N +L KP+    +   ++E+ C       DG  KG++
Sbjct: 619  SSHADRNEALVAGCNDYLTKPVNLDWLSNKITEWGCMQALIDFDGWTKGES 669

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 76/164 (46%), Gaps = 29/164 (17%)

Query: 1018 STGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKV 1077
            S  T LS  + T+  V  K  VL+ EDN +NQ ++   L    +    +A +G++A D  
Sbjct: 651  SHDTLLSGITTTSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIW 709

Query: 1078 KARNEAGKFYDLIFMDVQMPRVDGLSATRMIR------------NELSY---------TH 1116
            K   E G    LIFMD+Q+P + G+ A R IR            N L             
Sbjct: 710  K---EGG--LHLIFMDLQLPVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQA 764

Query: 1117 P--IVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
            P  IVALTA     + ++ + +G N +L KP+    + + ++E+
Sbjct: 765  PVIIVALTASNSLDDKRKALLSGCNDYLTKPVNLHWLSKKITEW 808

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 78/174 (44%), Gaps = 35/174 (20%)

Query: 1014 PFLQSTGTALSTRSVTTTS--VANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ 1071
            PF  S+         TTTS  V  K  VL+ EDN +NQ ++   L    +    LA +GQ
Sbjct: 468  PFTVSSPPDPLPNLFTTTSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQ 526

Query: 1072 DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRN-----------ELSYTHP--- 1117
            +A   V    E G    LIFMD+Q+P + G+ A + IR+            L+ +H    
Sbjct: 527  EA---VNIWKEGG--LHLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFD 581

Query: 1118 -------------IVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
                         IVALTA     + ++ + +G N +L KP+    + + ++E+
Sbjct: 582  KGTSKKFSQAPVIIVALTASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEW 635

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 75/174 (43%), Gaps = 35/174 (20%)

Query: 1014 PFLQSTGTALSTRSVTTTS--VANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ 1071
            PF  S+         TTTS  V  K  VL+ EDN +NQ ++   L    +    LA +GQ
Sbjct: 478  PFTVSSPPDPLPNLFTTTSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQ 536

Query: 1072 DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR--------------NELSYTHP 1117
            +A   V    E G    LIFMD+Q+P + G+ A + IR              N   Y   
Sbjct: 537  EA---VNIWKEGG--LHLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFE 591

Query: 1118 -------------IVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
                         IVALTA     + ++ + +G N +L KP+    + + ++E+
Sbjct: 592  KSASKRFSQAPVIIVALTASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEW 645

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 69/161 (42%), Gaps = 36/161 (22%)

Query: 1028 VTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFY 1087
            +T   V  K  VL+ EDN +NQ ++   L    +    +A +G++A DK K   E G   
Sbjct: 502  ITGEKVFPKINVLIVEDNVINQTILASFLRKHKIS-YKVAKNGREAVDKWK---EGG--L 555

Query: 1088 DLIFMDVQMPRVDGLSATRMIR------------------------------NELSYTHP 1117
             LIFMD+Q+P + G+ A + IR                              N       
Sbjct: 556  HLIFMDLQLPVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVI 615

Query: 1118 IVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
            IVA TA     + +E + +G N +L KP+    + + ++E+
Sbjct: 616  IVAFTASNSLTDKREALISGCNDYLTKPVNLHWLSKKITEW 656

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 51/98 (52%), Gaps = 7/98 (7%)

Query: 1013 RPFLQSTGTALSTR-SVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQ 1071
            RP  + T  +L  + ++    V  +  VL+ EDN +NQ ++   L   G+    +A DG 
Sbjct: 369  RPLSRRTTPSLDKQGNLPKYKVFPRINVLIVEDNAINQAILALFLRKNGIS-YKVAKDGV 427

Query: 1072 DAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR 1109
            +A +K K  +       LI MD+Q+P + GL AT+ IR
Sbjct: 428  EAIEKWKEGDSH-----LILMDLQLPLLSGLEATKKIR 460

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 49/95 (51%), Gaps = 6/95 (6%)

Query: 1016 LQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFD 1075
            L S  T       T  +V  K  VL+ EDN +NQ ++   L    +    +A +G++A D
Sbjct: 441  LPSPDTTKKNTKNTRENVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGREAVD 499

Query: 1076 KVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRN 1110
            K K     G  + LI +D+Q+P + G+ AT+ IRN
Sbjct: 500  KWKQ----GGIH-LILLDLQLPILSGIEATKEIRN 529

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 68/148 (45%), Gaps = 34/148 (22%)

Query: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPR 1098
            VL+ EDN +NQ ++   L    +    +A +G++A +K K   E G    LIFMD+Q+P 
Sbjct: 473  VLIVEDNVINQTILASFLRKHKIS-YRIAKNGREAVEKWK---EGG--IHLIFMDLQLPV 526

Query: 1099 VDGLSATRM-----------IRNEL----------SYTHPI-------VALTAYADDRNI 1130
            + G+ A +            IRN +          S   P+       VA TA     + 
Sbjct: 527  MSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLTDK 586

Query: 1131 KECIDAGMNGFLAKPIRRPKIKEILSEY 1158
            +E + +G N +L KP+    + + ++E+
Sbjct: 587  REALVSGCNDYLTKPVNLHWLSKKITEW 614

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 70/160 (43%), Gaps = 36/160 (22%)

Query: 1029 TTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYD 1088
            T+ ++  +  +L+ EDN +NQ ++   L    +    +A +G++A DK K   E G    
Sbjct: 557  TSENIFPRINILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWK---EGG--IH 610

Query: 1089 LIFMDVQMPRVDGLSATRMIRN----------------------------ELSYTHP--I 1118
            LIFMD+Q+P + G  A + IR                             + S   P  I
Sbjct: 611  LIFMDLQLPVLSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVII 670

Query: 1119 VALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158
            VA TA     + +  + AG N +L KP+    + + ++E+
Sbjct: 671  VAFTASNSLADKRAALIAGCNDYLTKPVNLHWLSKKITEW 710

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 54/110 (49%), Gaps = 6/110 (5%)

Query: 1052 IKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR-- 1109
            I R    E L+ +  +       +++  R   G  +DLI   +++P++  +   ++IR  
Sbjct: 1449 IHRYRVAEDLESIGCSVVSAGNGEELVRRATTGVKFDLIITAMKLPKLGAIDIAKLIRHT 1508

Query: 1110 NELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYC 1159
            N ++ T PIVALT Y  D    +  D      L KP+   ++++++S+Y 
Sbjct: 1509 NSVNCTTPIVALTVYYHDAKESKVFD----DVLEKPVSVEQLRKLVSKYA 1554

>SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1588

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 56/110 (50%), Gaps = 6/110 (5%)

Query: 1052 IKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR-- 1109
            I R   ++ L+ +  +  G  A D++  R  AG  +DLI   +++P++  +   +++R  
Sbjct: 1450 IHRYRLVKDLESLGCSVVGVGAGDELVRRATAGVKFDLIITALKLPKLGAVDIAKLLRHT 1509

Query: 1110 NELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYC 1159
            N  +   PIVA+TAY  +    +  D      L KP+   +I+ ++++Y 
Sbjct: 1510 NSANCNTPIVAVTAYYGEAESTQVFD----DVLEKPVGIEQIRCLIAKYA 1555

>Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON}
            YFL033C (REAL)
          Length = 1753

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (55%), Gaps = 8/99 (8%)

Query: 1073 AFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNI 1130
            A D++ +R  +G  +DLI   +++P++  +   ++++  N ++ T PIV++T Y      
Sbjct: 1649 AGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQTNGVNSTTPIVSITNY-----F 1703

Query: 1131 KECIDA-GMNGFLAKPIRRPKIKEILSEYCPTYFKADGE 1168
            +E I +   +  L KP+   ++K ++++Y     + DGE
Sbjct: 1704 QEAIASKAFDDVLEKPVNLDELKRLVAKYALKKSQEDGE 1742

>ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL033C (RIM15)
          Length = 1569

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 65/134 (48%), Gaps = 18/134 (13%)

Query: 1030 TTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDL 1089
            T+ V     VL+ E   +++  + R L   G   V +        D++  R  +G  +DL
Sbjct: 1431 TSEVGYNMDVLLCEPIPIHRYRLTRDLESLGCSVVAVGTG-----DEIVRRATSGVRFDL 1485

Query: 1090 IFMDVQMPRVDGLSATRMIRN--ELSYTHPIVALTAYADDRNIKECIDAGMNGF---LAK 1144
            I   +++P++  +  TR++R    ++ T PIVA+T            DAG + F   L +
Sbjct: 1486 IITTLKLPKIGAVDITRLLRQTTSINCTTPIVAVTVNYH--------DAGTHIFDDVLER 1537

Query: 1145 PIRRPKIKEILSEY 1158
            PI   ++++++S+Y
Sbjct: 1538 PIGTEQLRKLVSKY 1551

>ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1604

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 66/136 (48%), Gaps = 13/136 (9%)

Query: 1026 RSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGK 1085
            +S  T  V     VLV E  ++++  + R L     +D+  A     A D++  R  +G 
Sbjct: 1462 KSSNTEDVRYYMDVLVCEPISIHRYRVTREL-----EDLGCAVIAVGAGDELIGRATSGI 1516

Query: 1086 FYDLIFMDVQMPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNIKECIDAGM-NGFL 1142
             +DLI   +++P++       +++  N  + T P+VALT Y      +E +   + N  L
Sbjct: 1517 KFDLIMTALKLPKLGAADIVSLLKYTNGTNSTTPVVALTNY-----YQEAVSLNLFNDVL 1571

Query: 1143 AKPIRRPKIKEILSEY 1158
             KP+    +++I+++Y
Sbjct: 1572 EKPVLADSLRKIVAKY 1587

>NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {ON}
            Anc_8.34
          Length = 1707

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 73/147 (49%), Gaps = 22/147 (14%)

Query: 1017 QSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQ-EVIKRMLNLEGLDDVDLACDGQDAFD 1075
            QS+GT        T  +     +L+ E   +++  +IK   +LE L    +A  G D   
Sbjct: 1557 QSSGTG-------TEKIGCNMDILLCEPIPIHRYRIIK---DLESLGCTVIAASGAD--- 1603

Query: 1076 KVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNIKEC 1133
            ++ +R +A   +DLI   +++P V      R+++  N  +   PIVALT+Y      +E 
Sbjct: 1604 ELVSRADAEITFDLIITTLKLPNVSSTELIRLLKFTNGTNSATPIVALTSY-----YEEA 1658

Query: 1134 IDAGMNGF-LAKPIRRPKIKEILSEYC 1159
            +++ +  + L KP++   I+ ++S+Y 
Sbjct: 1659 MNSNVFDYVLEKPLQMKDIRNLISKYA 1685

>KLTH0E08052g Chr5 (739063..742779) [3717 bp, 1238 aa] {ON} similar
           to uniprot|P38929 Saccharomyces cerevisiae YGL006W PMC1
           May be involved in depleting cytosol of Ca2 ions
           putative vacuolar Ca2 ATPase
          Length = 1238

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 58/131 (44%), Gaps = 16/131 (12%)

Query: 366 IVRLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKH-- 423
           +VR+ +A E + +G  + SD   TL +  R +  + F    H      +  V     H  
Sbjct: 412 LVRVLRACETMGSGTAVCSDKTGTL-TENRMTVVKGFLGTTHFDETEETSEVVEPEDHII 470

Query: 424 -KYIPESAKG------TLNKNDFEEIQPD-GIENNEDAALQKVHSPTPGSLFSEQRSARS 475
            K  P++ K       TLN   FE    D G+E+NE+      H P   +LF   R+ R 
Sbjct: 471 SKDCPQATKKDLLVNITLNSTAFENKDDDEGMESNENP----FHKPRK-TLFPWSRNNRK 525

Query: 476 ERYITSTNLIE 486
           ER+ T+  LIE
Sbjct: 526 ERHTTANELIE 536

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 46/110 (41%), Gaps = 28/110 (25%)

Query: 845 RLRKGNSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFE-------------PF 891
           ++ KGN GE              +++ V+D G GI P  +  + +             P 
Sbjct: 291 QITKGNCGE-------------TLSIRVRDHGGGIPPEREPFILDYAYTSEVNKHEGDPA 337

Query: 892 VQGDQTLSR--QYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTV 939
            Q +Q  +   +  G G GL +CR  A +  GS+S+ S  G+G+     +
Sbjct: 338 TQVNQVNADVPRVAGLGFGLPLCRMYAELFGGSLSIQSLWGLGTDVYIII 387

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 52/90 (57%), Gaps = 8/90 (8%)

Query: 1073 AFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNI 1130
            A D++ +R  +G  +DLI   +++P++  +   +++R  N  + T PIVA+T Y      
Sbjct: 1654 AGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLRQTNGANSTTPIVAITNY-----F 1708

Query: 1131 KECIDAGM-NGFLAKPIRRPKIKEILSEYC 1159
            +E I + + +  L KP+   ++K+++++Y 
Sbjct: 1709 QEAITSKVFDDVLEKPVNLDELKKLVAKYA 1738

>TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1602

 Score = 39.7 bits (91), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 51/89 (57%), Gaps = 8/89 (8%)

Query: 1073 AFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNI 1130
            A D++ +R  +G  +DLI   +++P++  +   R+++  N ++ T P+VA+T Y      
Sbjct: 1499 AGDELVSRATSGVKFDLIITALKLPKLGAVDIVRLLKHTNSINATTPVVAVTNY-----Y 1553

Query: 1131 KECIDAGM-NGFLAKPIRRPKIKEILSEY 1158
            +E +   + +  L KP+   ++++I ++Y
Sbjct: 1554 QEAVSGNVFDDVLEKPVAYDQLRKIAAKY 1582

>Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556)
            [4554 bp, 1517 aa] {ON}
            (101912..102910,102960..102968,103011..106556) [4554 nt,
            1518 aa]
          Length = 1517

 Score = 39.7 bits (91), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 55/113 (48%), Gaps = 12/113 (10%)

Query: 1052 IKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR-- 1109
            I R     GL+ +        A D++  R  +G  +DLI   +++P++  +   ++++  
Sbjct: 1394 IHRYCTTSGLESLGCTVVAVGAGDELVRRATSGVKFDLIITALRIPKLGAVDIVKLLKHT 1453

Query: 1110 NELSYTHPIVALTAY---ADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYC 1159
            N ++ T PIVA T Y   A + N+        +  L KPI    +++++S+Y 
Sbjct: 1454 NGINSTTPIVAATCYFEEASNTNV-------FSDVLEKPISIQTLRKLISKYA 1499

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 39.7 bits (91), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 49/89 (55%), Gaps = 6/89 (6%)

Query: 1073 AFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNI 1130
            A D++ +R  +G  +DLI   +++P++  +   ++++  N  + T PIVA+T Y  +   
Sbjct: 1666 AGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQTNGANSTTPIVAITNYFQEAAT 1725

Query: 1131 KECIDAGMNGFLAKPIRRPKIKEILSEYC 1159
                D      L KP++  ++K+++++Y 
Sbjct: 1726 SRVFD----DVLEKPVKLDELKKLVAKYA 1750

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 38.9 bits (89), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 52/90 (57%), Gaps = 8/90 (8%)

Query: 1073 AFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNI 1130
            A D++ +R  +G  +DLI   +++P++  +   ++++  N  + T PIVA+T Y      
Sbjct: 1656 AGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQTNGANSTTPIVAITNY-----F 1710

Query: 1131 KECIDAGM-NGFLAKPIRRPKIKEILSEYC 1159
            +E I + + +  L KP+   ++K+++++Y 
Sbjct: 1711 QEAITSKVFDDVLEKPVNLDELKKLVAKYA 1740

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033c RIM15
            protein kinase involved in expression of meiotic genes
          Length = 1682

 Score = 38.9 bits (89), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query: 1026 RSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGK 1085
            +S     V  +  +LV E   +++  + R L   G   V +      A D++ +R  +G 
Sbjct: 1531 KSSGVNDVGYRMDILVCEPIPIHRYRVTRDLESVGCTVVSVG-----AGDELVSRANSGV 1585

Query: 1086 FYDLIFMDVQMPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNIKECIDAGM-NGFL 1142
             +DLI   +++P++  +   ++I+  N ++   PI+A+T +       E I A + +  L
Sbjct: 1586 KFDLIVTALKLPKLGAIDIVKLIKHTNGINSRTPIIAITNF-----YHEAISAKVFDDVL 1640

Query: 1143 AKPIRRPKIKEILSEYC 1159
             KPI   +I+ ++++Y 
Sbjct: 1641 EKPIMLDEIRHLVAKYA 1657

>TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1536

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 65/126 (51%), Gaps = 13/126 (10%)

Query: 1036 KCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQ 1095
            K  +L+ E   +++  I + L   G   V +A     A D++ +R  +G  +DLI   ++
Sbjct: 1403 KLDILLCEPIPIHRYYITKDLETLGCTVVSVA-----AGDELISRATSGIKFDLIITALK 1457

Query: 1096 MPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNIKECIDAGM-NGFLAKPIRRPKIK 1152
            +P++  +   ++++  N ++   P+VA+T+Y       E  +A + +    KPI    +K
Sbjct: 1458 LPKLGAVDIVKLLKHTNGINSFTPVVAVTSY-----YHEATNANIFSDVFEKPITLDVLK 1512

Query: 1153 EILSEY 1158
            +++S+Y
Sbjct: 1513 KLVSKY 1518

>TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8.34
            YFL033C
          Length = 1972

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 46/89 (51%), Gaps = 6/89 (6%)

Query: 1073 AFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNI 1130
            A D++ +R      +DLI   +++P++D +   ++I+  N ++   PI+A T Y  +   
Sbjct: 1870 AGDELVSRANGVIKFDLIITALKLPKIDAVDIVKLIKQTNGINSLTPIIAATNYTQE--A 1927

Query: 1131 KECIDAGMNGFLAKPIRRPKIKEILSEYC 1159
            + C     N  + KPI+   ++ ++S Y 
Sbjct: 1928 ETC--HVFNDIMEKPIQLDILRRVVSRYA 1954

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 15/81 (18%)

Query: 868 IAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 912
           + + ++D G GI P +++ +FE      Q  ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 913 RQLAAMMNGSMSLDSKVGVGS 933
           +    M +GS+ + S  G G+
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGT 397

>Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} similar to
            Ashbya gossypii ACR218W
          Length = 1694

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 62/134 (46%), Gaps = 18/134 (13%)

Query: 1031 TSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLI 1090
            + V     VL+ E   +++  + R L L G   V +        D++  R  +G  +DLI
Sbjct: 1556 SDVGYNMDVLLCEPIPIHRYRLARDLELLGCSVVAVGTG-----DEIVRRATSGVRFDLI 1610

Query: 1091 FMDVQMPRVDGLSATRMIRN--ELSYTHPIVALTAYADDRNIKECIDAGMNGF---LAKP 1145
               +++P++  +   R++R+   ++   PIVA+             D G N F   L +P
Sbjct: 1611 ITTLKLPKIGAIDIARLLRHTTSINCNTPIVAVAVNYH--------DVGSNIFDDVLERP 1662

Query: 1146 IRRPKIKEILSEYC 1159
            I   ++++++S+Y 
Sbjct: 1663 IGVEQLRKMVSKYA 1676

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 42/109 (38%), Gaps = 22/109 (20%)

Query: 847 RKGNSGENEDGRPLEHPRRLAIA-------MEVQDTGPGIEPALQESVFEPFVQGDQTLS 899
           R    G   D    E P  + I        + ++D G GI P +++ +F+       T +
Sbjct: 291 RAHIEGSTSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDA 350

Query: 900 RQYG---------------GTGLGLSICRQLAAMMNGSMSLDSKVGVGS 933
           +  G               G G GL +C+    M NG++ + S  G G+
Sbjct: 351 KDSGMSAYVIPGADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGT 399

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 64/130 (49%), Gaps = 11/130 (8%)

Query: 1031 TSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLI 1090
            + +A    VLV E   +++  + R L   G   V ++       D++  R  +   +DLI
Sbjct: 1383 SDIAYNMDVLVCEPIPIHRFKLTRDLESLGCSVVSVSMG-----DEMVRRATSDVKFDLI 1437

Query: 1091 FMDVQMPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRR 1148
            F  +++P++  +   +++R  N ++ T  I+A+TAY  +   + C     +  L +P+  
Sbjct: 1438 FTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QAC---AFDEVLERPVSV 1493

Query: 1149 PKIKEILSEY 1158
             +++ +L +Y
Sbjct: 1494 QQLRSLLLKY 1503

>TBLA0B09320 Chr2 complement(2213166..2215337) [2172 bp, 723 aa]
           {ON} Anc_2.419 YNL008C
          Length = 723

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 577 MQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLA 636
           +  + SSLKL F S  L  H +  LLT + +    T LEE DFT+ E+++Q  SI   L 
Sbjct: 156 IHNLDSSLKLTFVSIALS-HFIETLLTVTSH---STPLEESDFTIFELSVQFYSITNGLL 211

Query: 637 KDQH 640
            D +
Sbjct: 212 LDSN 215

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 1064 VDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTA 1123
            VD+  D     +K+       K YDL+ +D  +  ++      M+ + + Y  PI+ +T+
Sbjct: 518  VDIMQDWPKTKEKI-----LNKCYDLVIIDAHVKFLNVPILESML-SSIQYHPPIILMTS 571

Query: 1124 YADDRNIKECIDAGMNGFLAKPIRRPKIKEIL 1155
              +D+ +   +  G+N  L KP    K+ + L
Sbjct: 572  SLNDQQLIFYLQHGINSILEKPFHSHKLLKFL 603

>NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1311

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%)

Query: 1012 DRPFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKR 1054
            DRP L   GT+LSTRSV  +S  N    +       NQE+  R
Sbjct: 547  DRPLLSKIGTSLSTRSVLQSSKLNSNSNISLNPTTQNQEITDR 589

>KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8.34
            YFL033C
          Length = 1450

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 1087 YDLIFMDVQMPRVDGLSATRMIR--NELSYTHPIVALTAYADDRNIKECIDAGMNGFLAK 1144
            +DLI   +++P V      ++++  N ++   PIVA T Y  D    +  D      + K
Sbjct: 1358 FDLIVTTLRLPNVYATDIIKLVKRANCVNSDTPIVAATNYYQDAVNTKFFD----DVVEK 1413

Query: 1145 PIRRPKIKEILSEYC 1159
            P+ R K+++++S+Y 
Sbjct: 1414 PLSREKLRKLVSKYA 1428

>KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {ON}
           Anc_7.222 YIL042C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 409

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 35/94 (37%), Gaps = 19/94 (20%)

Query: 863 PRRLAIAMEVQDTGPGIEPALQESVFE-----------------PFVQGDQTLSRQYGGT 905
           P    + + V D G GI P ++  +F+                     G+    +   G 
Sbjct: 308 PHETELTLRVSDRGGGIPPGVESHIFDYSYTTTTEAADTDTATAQMHAGEAV--KSVAGM 365

Query: 906 GLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTV 939
           G GL +CR    + +G + + S  G G+    T+
Sbjct: 366 GFGLPLCRTYLELFDGKIDVQSLWGHGTDVYLTM 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,751,588
Number of extensions: 4281650
Number of successful extensions: 18960
Number of sequences better than 10.0: 147
Number of HSP's gapped: 19346
Number of HSP's successfully gapped: 198
Length of query: 1177
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1056
Effective length of database: 39,606,813
Effective search space: 41824794528
Effective search space used: 41824794528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)