Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E01056g5.702ON1771177184810.0
Kwal_55.196975.702ON1760170342700.0
SAKL0E14916g5.702ON1779174229790.0
Ecym_40185.702ON1769172125740.0
TDEL0B021905.702ON1810167122970.0
ZYRO0G06600g5.702ON1820167922530.0
KLLA0A00594g5.702ON1748174821790.0
Suva_11.3315.702ON1898171220740.0
AFR286W5.702ON1758171020250.0
Smik_11.3585.702ON1878170620000.0
YKR095W (MLP1)5.702ON1875171619870.0
NCAS0A032005.702ON1788166419470.0
Skud_11.3345.702ON1885173119150.0
CAGL0G02497g5.702ON1780170717760.0
NDAI0E050405.702ON1973170616730.0
TBLA0E017305.702ON1820123711411e-127
Suva_9.395.702ON1682161811341e-127
Smik_9.205.702ON1682162210841e-121
Skud_9.195.702ON1680158710661e-118
YIL149C (MLP2)5.702ON1679160310311e-114
NCAS0G002305.702ON173516879811e-107
KNAG0C065905.702ON165116338038e-86
KAFR0D022205.702ON167415647832e-83
KAFR0H002105.702ON14549955831e-59
NDAI0F002905.702ON15546085284e-53
Kpol_1043.705.702ON13215124901e-48
TPHA0E002305.702ON12845053469e-32
TPHA0D046105.702ON11835143182e-28
KNAG0L021405.702ON16083212871e-24
Kpol_2001.755.702ON10067781348e-07
KAFR0D025103.393ON426153811.2
KLTH0B08316g2.16ON950204801.5
Skud_4.1964.238ON1792268801.6
Smik_13.5235.14ON1786148782.9
KAFR0G020908.604ON732191747.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E01056g
         (1771 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...  3271   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...  1649   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...  1152   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   996   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   889   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   872   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   843   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   803   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   784   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   775   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   769   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   754   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   742   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   688   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   649   0.0  
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   444   e-127
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   441   e-127
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   422   e-121
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   415   e-118
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   401   e-114
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   382   e-107
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   313   8e-86
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   306   2e-83
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   229   1e-59
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   207   4e-53
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   193   1e-48
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   137   9e-32
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...   127   2e-28
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   115   1e-24
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    56   8e-07
KAFR0D02510 Chr4 (499589..500869) [1281 bp, 426 aa] {ON} Anc_3.3...    36   1.2  
KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some s...    35   1.5  
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    35   1.6  
Smik_13.523 Chr13 (863924..869284) [5361 bp, 1786 aa] {ON} YMR30...    35   2.9  
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    33   7.9  

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score = 3271 bits (8481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1665/1771 (94%), Positives = 1665/1771 (94%)

Query: 1    MANTDELPRLXXXXXXXXXXXFLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSV 60
            MANTDELPRL           FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSV
Sbjct: 1    MANTDELPRLESAEAAETAASFLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSV 60

Query: 61   TVDELRSSSERKLGACKDQVHLLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRV 120
            TVDELRSSSERKLGACKDQVHLLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRV
Sbjct: 61   TVDELRSSSERKLGACKDQVHLLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRV 120

Query: 121  RKEALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRV 180
            RKEALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRV
Sbjct: 121  RKEALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRV 180

Query: 181  SKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXX 240
            SKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAA       
Sbjct: 181  SKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLET 240

Query: 241  XXXXXXASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDL 300
                  ASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDL
Sbjct: 241  LEQELQASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDL 300

Query: 301  LEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQD 360
            LEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQD
Sbjct: 301  LEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQD 360

Query: 361  LVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKV 420
            LVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKV
Sbjct: 361  LVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKV 420

Query: 421  PMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRS 480
            PMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRS
Sbjct: 421  PMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRS 480

Query: 481  DLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDI 540
            DLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDI
Sbjct: 481  DLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDI 540

Query: 541  VELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESR 600
            VELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESR
Sbjct: 541  VELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESR 600

Query: 601  IEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKM 660
            IEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKM
Sbjct: 601  IEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKM 660

Query: 661  LNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDN 720
            LNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDN
Sbjct: 661  LNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDN 720

Query: 721  LLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNX 780
            LLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNN 
Sbjct: 721  LLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNL 780

Query: 781  XXXXXXXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSR 840
                       GERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSR
Sbjct: 781  TILVTQLQTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSR 840

Query: 841  SQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTD 900
            SQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTD
Sbjct: 841  SQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTD 900

Query: 901  DVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFG 960
            DVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFG
Sbjct: 901  DVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFG 960

Query: 961  NMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKE 1020
            NMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKE
Sbjct: 961  NMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKE 1020

Query: 1021 HYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQS 1080
            HYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQS
Sbjct: 1021 HYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQS 1080

Query: 1081 SIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELG 1140
            SIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELG
Sbjct: 1081 SIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELG 1140

Query: 1141 QSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXXXX 1200
            QSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEE       
Sbjct: 1141 QSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQAL 1200

Query: 1201 XXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXX 1260
                 IMADEHNK           RESNITLRSEVQKKTQRCQELEGQIDN         
Sbjct: 1201 SSQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLE 1260

Query: 1261 XXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAEL 1320
                  KRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAEL
Sbjct: 1261 SELASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAEL 1320

Query: 1321 AAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVN 1380
            AAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVN
Sbjct: 1321 AAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVN 1380

Query: 1381 KALQESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVK 1440
            KALQESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVK
Sbjct: 1381 KALQESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVK 1440

Query: 1441 SHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHY 1500
            SH                SLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHY
Sbjct: 1441 SHAEELERRLDEARREVESLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHY 1500

Query: 1501 EELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPT 1560
            EELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPT
Sbjct: 1501 EELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPT 1560

Query: 1561 EEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTR 1620
            EEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTR
Sbjct: 1561 EEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTR 1620

Query: 1621 EMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEK 1680
            EMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEK
Sbjct: 1621 EMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEK 1680

Query: 1681 PVRILEASPLEDALSRNDPNKESLPIKKIXXXXXXXXXXXXXXXXAPNGQQQATKTQLTE 1740
            PVRILEASPLEDALSRNDPNKESLPIKKI                APNGQQQATKTQLTE
Sbjct: 1681 PVRILEASPLEDALSRNDPNKESLPIKKISLPSLTPEPQQSQPEEAPNGQQQATKTQLTE 1740

Query: 1741 GNATQDGLTPTKRAIEVGNESPSKRTKPDQD 1771
            GNATQDGLTPTKRAIEVGNESPSKRTKPDQD
Sbjct: 1741 GNATQDGLTPTKRAIEVGNESPSKRTKPDQD 1771

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score = 1649 bits (4270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 932/1703 (54%), Positives = 1226/1703 (71%), Gaps = 24/1703 (1%)

Query: 1    MANTDEL--PRLXXXXXXXXXXXFLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRT 58
            MA+T+ L  P             FL ++   L+ V G V   IAAK REFQQLQAENL+ 
Sbjct: 1    MASTNVLSQPEAAQTETEDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKC 60

Query: 59   SVTVDELRSSSERKLGACKDQVHLLLQELESLRGESAQFEKMKLELTSEKQRALNDSETL 118
            SVT+DELRSSS  KLGACKDQ+H LLQE+E++R E+ Q E+ + +  +E+QR++NDS+TL
Sbjct: 61   SVTIDELRSSSSHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTL 120

Query: 119  RVRKEALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESES 178
            R R EALEQQKQ LE++KNDVA+LLNEKI ++++ +QE + L+QE R LRQQ L+LE ++
Sbjct: 121  RARNEALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQA 180

Query: 179  RVSKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXX 238
            RV KSE+L+ KA+ H+LSQ++SL  +N+EWLESQL QKN+EFNAYR  TQS+LA+     
Sbjct: 181  RVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRL 240

Query: 239  XXXXXXXXASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLV 298
                    A+T+T K+LRE N +  ++LE Q + VKKLTD L S KQEFTREMSLK+RLV
Sbjct: 241  ETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLV 300

Query: 299  DLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTV 358
            +LLEGQV +LKS+LE +++     D + +   + + +EL  KTQQLEESE K+QKLEQTV
Sbjct: 301  ELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTV 360

Query: 359  QDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELES 418
            + L+S D+++   S +   P    DLY DI +LK+QVIHE+RQKE LQNQVEAFVVELE+
Sbjct: 361  EQLLSADEKT--ISGSQSLP----DLYADIGILKKQVIHERRQKEFLQNQVEAFVVELEN 414

Query: 419  KVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQ 478
            KVPMLSSFKDRND+LE++LAETAYML+SISKDK+  A DL+RTK+QI D E QIS LT+Q
Sbjct: 415  KVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQ 474

Query: 479  RSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFR 538
            RSDLARQVQYLLIQ +VR DS GPL+ EE AFV++++   +   + D Q +ISERLVEF+
Sbjct: 475  RSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFK 534

Query: 539  DIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELE 598
            +IVELQ+KN+DLL T+RNLA++LE+EE + K +++ +END I EAKEAI+TLQ+H QELE
Sbjct: 535  NIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELE 594

Query: 599  SRIEVLTKERDAYKAIQPSTN----NGNKITEHALANSKGKMSARVDDLERSLVTEREEA 654
            +RI+V+T+ERDAYKAIQ  T+    NG     +A A+    +  R  +LE  L   + EA
Sbjct: 595  TRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIR--ELEELLSAAKREA 652

Query: 655  EKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRY 714
            E N+K+L +E QEL R K++L + +EKE++S+ LAEERLK+S+ SL LTKQENEELNKR 
Sbjct: 653  EANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRG 712

Query: 715  HIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLT 774
             ++++NL KQDT+TQET+S LI+C+S+LATL +ELK+S+AK   L++  +K  E+ EQLT
Sbjct: 713  LVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLT 772

Query: 775  AERNNXXXXXXXXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFI 834
             ERN              ERD LL +++ ++K K+D+LE E SQLRT LS+K  E +DF+
Sbjct: 773  KERNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFM 832

Query: 835  QTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYD 894
             T+DSRS+WYQEKID+LNE LK  TS L S+ Q  ++L+SQ+ LL  +L++ ETK+QSY 
Sbjct: 833  STSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYS 892

Query: 895  VLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNE 954
            VLNQTDDVL QT+ALR ELEK++I L+DA+SQ++E++  Y S +E L+A+T A E  K +
Sbjct: 893  VLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQD 952

Query: 955  HSKDFGNMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQET 1014
            H+ +   +KK+ D L      LK Q++NLN+EL +QK   ++ K+E       ++S +  
Sbjct: 953  HTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTA 1012

Query: 1015 MNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQ 1074
            + SMK+ Y+ +L KLT+DLNQQA +ANKAQENYEQELQRHADVSKTISQLREE+QK+KN+
Sbjct: 1013 LASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNK 1072

Query: 1075 ASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKD 1134
               L++SI +L+K+L+E++  W  QK+EYE Q    +QRIEDL+ QN LL DQ+ L  KD
Sbjct: 1073 VHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISL--KD 1130

Query: 1135 PNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEX 1194
             +S     E + + RELI++L+RE DILQTKLE++KR E+   +KLE  EQELS AK E 
Sbjct: 1131 TDSIPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEI 1190

Query: 1195 XXXXXXXXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXX 1254
                       IM +E++K           RESNITLR+E+Q+K+QR Q+LE  ++    
Sbjct: 1191 RKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQE 1250

Query: 1255 XXXXXXXXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELS 1314
                        +RSV AKD QISLI+EE NRWKQRSQDIL K+ER+DPEEHKKL EELS
Sbjct: 1251 ALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELS 1310

Query: 1315 QAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLR 1374
            QA+AE AA A Q SELEDRFQRLKKQARERLD A+  QN L+ EL +ARE+Q  +E  L 
Sbjct: 1311 QARAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALD 1370

Query: 1375 KEQDVNKALQESLQRV-ESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQ 1433
            KE++  ++LQES++   E+E +  S T+ +L+ ALQKL  A+ +  ++ +  +Q E+ L+
Sbjct: 1371 KEREKTRSLQESIKATEENEIENSSATRDQLQDALQKLEDAQARINEMSTAPSQEEQTLR 1430

Query: 1434 SELEKVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKE 1493
             ELE+ + H                 LEE K       +E+ ++K +L +HSN L+AEKE
Sbjct: 1431 EELERTRQHVKQLEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVKTELIDHSNKLLAEKE 1490

Query: 1494 AEIRSHYEELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILR 1553
            AEI+  YE+ RL++KA  EK L  +      DIE LKK+WEE+YEQ+TIKRIEE+NEILR
Sbjct: 1491 AEIKEKYEKQRLEDKAELEKSLASSESLKSSDIENLKKEWEEEYEQRTIKRIEEANEILR 1550

Query: 1554 KRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEK 1613
            KRIRLPTEEKINKI+E RK EL++EFEAKLQ+R SELA EKP PA+FTEVMKRHKQE+EK
Sbjct: 1551 KRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQEVEK 1610

Query: 1614 LKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTS 1673
            LKAD+ REMDEE+AQ +KKAFDEGKQQASMKSMFLEKKIAK   + +A      P   T+
Sbjct: 1611 LKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLEKKIAK--LEAQAKAAAEKPD-DTT 1667

Query: 1674 KNSP----TEKPVRILEASPLED 1692
             NSP     +KP  I E S  ED
Sbjct: 1668 VNSPDRKQLDKPSPIAEISHQED 1690

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score = 1152 bits (2979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 736/1742 (42%), Positives = 1096/1742 (62%), Gaps = 79/1742 (4%)

Query: 3    NTDELPRLXXXXXXXXXXXFLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTV 62
            N+   P +           FL ++++++  +D  VV  ++ KA +F QL+A+NL+ SVT+
Sbjct: 5    NSPTTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTL 64

Query: 63   DELRSSSERKLGACKDQVHLLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRK 122
            DEL+SSSER+  A K Q+  + +  ESLR E   FE  K +L  EK  A  +   L+ + 
Sbjct: 65   DELKSSSERRSEAFKLQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQL 124

Query: 123  EALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSK 182
              L+QQ +   SSK DV +LLNEKI +L + + EA  L+Q  + LR+Q L+LE+E +  K
Sbjct: 125  TELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFK 184

Query: 183  SEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXX 242
            S DL+ KAE+ RL+QE++L +SN++WLE +L  K+ EF +YR    S+L           
Sbjct: 185  SNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIR 244

Query: 243  XXXXASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLE 302
                    ++++L+     ++  L+ ++  +K L D+ + EKQEFTREM+LK+RL+DLLE
Sbjct: 245  SELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLE 304

Query: 303  GQVQSLKSDLELRSTAGEGDDGSFSNPLNA----LSEELAQKTQQLEESEFKVQKLEQTV 358
             Q++S K++LE    +      S S+ ++A    + EEL +  ++LE SE K  KLE+TV
Sbjct: 305  KQIESFKTELE----SARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETV 360

Query: 359  QDLVSTDKE----SRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVV 414
             +L+STD E    +  K S     + V  L+GDI LLK+++I E+RQKE LQ QVEAFV+
Sbjct: 361  DELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVL 420

Query: 415  ELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISE 474
            ELE KVP+L+SFK+R +MLE++L++ A MLE+ SKDKE    +L   K++I D+E QI  
Sbjct: 421  ELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHS 480

Query: 475  LTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERL 534
            L RQRSDLA QVQ+LLIQ SVR+DS GPLT EE  F+++I+   +  +E+D Q++ISERL
Sbjct: 481  LVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERL 540

Query: 535  VEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHA 594
            V F  +VELQ KN +LL +IRNLADKLE+EE++SK +SK VE++ ++EAKEAI+TLQE+ 
Sbjct: 541  VRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYN 600

Query: 595  QELESRIEVLTKERDAYKAIQ--------PSTNNGNKITEHALANSKGKMSARVDDLERS 646
            + LES++E++ KERDA+K +         PS  N ++     LA  K      + +LE  
Sbjct: 601  KSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEK------IKELENH 654

Query: 647  LVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQE 706
            L +  EE+ KN+K+LN EI  L R +   ++ +EKER+S+ LAE+R K+   +L++TK E
Sbjct: 655  LSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKME 714

Query: 707  NEELNKRYHIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKN 766
            N+EL KR+H +Q+N+LKQD+KTQ+T+  LI C+S+L+ L+S+L +S ++ + L S Q+  
Sbjct: 715  NDELRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENL 774

Query: 767  TESIEQLTAERNNXXXXXXXXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRK 826
             +  E L+ ERNN             ER+ LL ET+K+++ K + LE E S    +L  K
Sbjct: 775  KKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAK 834

Query: 827  DEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEV 886
             +E +D+I T DS+ +WYQEK D LNE L     +L S+    + LE + + L  +L+E 
Sbjct: 835  SKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEES 894

Query: 887  ETKAQSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITN 946
            E + Q+++ LN ++ V +QTE LR ELEK++IKL DAYSQ+E+++S   S+EE+ +AI +
Sbjct: 895  EARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKD 954

Query: 947  AFERFKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLV 1006
            A E+ K E+++    + K+ D    QV  LK QISNLNNEL HQK QF+S+ ++    L 
Sbjct: 955  ALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLE 1014

Query: 1007 SLQSTQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLRE 1066
             L++ Q  +++MK  YEQ++ K+ +DLNQQ ++AN AQ+NYEQELQ+HADVSK IS LR 
Sbjct: 1015 DLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRA 1074

Query: 1067 ESQKYKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLD 1126
            E+QKYK++   L+++ E  +K L++S+  W  Q  +YE +LR  +QRIEDL  Q+ +L D
Sbjct: 1075 EAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYD 1134

Query: 1127 QLDLEAKD-PNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQ 1185
            Q+D  +K  P S         + R L+TSLRRE+DIL+TKLEVS R E V  +KL+ IE 
Sbjct: 1135 QIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIES 1194

Query: 1186 ELSFAKEEXXXXXXXXXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQEL 1245
            +L  ++ E                +  +           RESNITLR+E QK  +R +EL
Sbjct: 1195 DLEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSREL 1254

Query: 1246 EGQIDNXXXXXXXXXXXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEE 1305
            + ++D                + SVR KD QISL +EE  RWKQRSQDIL K+ERIDPEE
Sbjct: 1255 KAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEE 1314

Query: 1306 HKKLGEELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREA 1365
            H+KL +++S+ + E+ +K+D+N EL+ RF+RLK+QA E+L+AAK  Q+ L+ +L   +  
Sbjct: 1315 HQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKAT 1374

Query: 1366 QSNMELQLRKEQDVNKALQESLQRVESEAKAD-STTQPELESALQKLSQAEKKAQDIESD 1424
            +  +E  L  +++  K L+  +  +E    ++ +  Q +LE++  KL + E K + + S 
Sbjct: 1375 KEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSS 1434

Query: 1425 RAQIEKALQSELEKVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSE----------- 1473
             A +EK L   +E + +                  LE+ K  +  D S+           
Sbjct: 1435 SALLEKELNERIESLMN----------KIKLLEEDLEKAKTESPNDGSQSSELVENTSKI 1484

Query: 1474 LEKMKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATY----EKELEENGK----HTPVD 1525
            +E +K + EE    +I++KE+E+R  +EE    EKA+     E+EL E         PV+
Sbjct: 1485 VENLKIEFEEEKAKMISDKESELREQFEE----EKASILEAKEQELREQLATQKLDPPVN 1540

Query: 1526 IETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQK 1585
            I+ +KK+WEE+YEQKT +RI ESNE L+KRIRLPTEEKINKIVE ++ ELE EFEA +QK
Sbjct: 1541 IDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQK 1600

Query: 1586 RASEL-ANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMK 1644
            +A E+  ++    ++ TEV+++HKQ++E LK ++ ++ DE++AQ++K+AF+EGKQQASMK
Sbjct: 1601 KAEEIAKSKSASNSNSTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMK 1660

Query: 1645 SMFLEKKIAKLEAQVKASGTEAVP-----SAPTSKNSPTEKPVR-----------ILEAS 1688
            S FLEKKIAKLE Q+KA  + A+P     SA  +++ PT + V+           IL   
Sbjct: 1661 STFLEKKIAKLETQIKAHDS-AIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGK 1719

Query: 1689 PL 1690
            PL
Sbjct: 1720 PL 1721

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  996 bits (2574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/1721 (38%), Positives = 1036/1721 (60%), Gaps = 78/1721 (4%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            FL ++  ++  +D  +V     KA EF +++A+N+R S+++D L+ + E+K+   K+QV 
Sbjct: 21   FLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFKEQVE 80

Query: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALE---SSKND 138
             LL ++ S + E  Q E  KL+L +EK +     E L++R + +E+ KQ +E   S+K D
Sbjct: 81   KLLSDVASRQQEKQQTEDEKLKLMNEKAQL--SMEVLKLRSQ-VEEAKQGMEIIASAKQD 137

Query: 139  VARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQE 198
            V +LL EKIS+L++ K+E+D L+  N+ LR+ ++DLE   +  KS++L+ K+E+ RL QE
Sbjct: 138  VTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLHQE 197

Query: 199  LSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLREH 258
            L+L +SN++WL  +L  KN + N++R  T S+L                +   N +L+  
Sbjct: 198  LNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAK 257

Query: 259  NARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTA 318
             A ++N L+ +L   KKL D LN+EK+EFTREMSLK+RL+DLLE QV S+KSDLE  +  
Sbjct: 258  TAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLE--NAY 315

Query: 319  GEGDDGSFSNP-LNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLK------ 371
               +    S P  + L +EL    + LE ++ +  KLE TV +L+S + ++ +       
Sbjct: 316  QSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSNV 375

Query: 372  --SSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDR 429
              +S     ++V  L GDI +LK+Q++ E+RQKE LQNQVE+FVVELE K+P+L+SFK+R
Sbjct: 376  SDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSFKER 435

Query: 430  NDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYL 489
             DMLE +L +   +LES +K ++   ++L + K +I+++E Q+  L  QRSDLA QVQYL
Sbjct: 436  TDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYL 495

Query: 490  LIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSD 549
            L+Q SVR D+ GPLT +E+ FV+RI+   D + + DTQ +ISERLV+F+ ++ELQSKN++
Sbjct: 496  LMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQSKNAE 555

Query: 550  LLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERD 609
            LL TIR LADKLE EE++S+ R K+VE   ++EAKEAI++LQEH Q LE ++++++KERD
Sbjct: 556  LLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKERD 615

Query: 610  AYKAIQPSTNNGNKITEHALANS--KGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQE 667
            A+K      N+ NK  + A +++    K+   + +LE+ L    E+++ N+K+LN EI+ 
Sbjct: 616  AFKL----ANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIKLLNDEIKA 671

Query: 668  LLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTK 727
            L + K+++ + +E+ER+SK LAEERLK+ Q +L LTK+EN EL+KR   +Q  LLKQD K
Sbjct: 672  LYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEK 731

Query: 728  TQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXXX 787
            TQ T+  +I  +S+L+ L S+L    ++ + L   + +     E LT E           
Sbjct: 732  TQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKILVSQL 791

Query: 788  XXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEK 847
                 ERD LL E + +Y++ ++ LE +  + R  L R+  E+ +   ++ S+ +W+Q K
Sbjct: 792  QTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQYKWFQAK 851

Query: 848  IDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTE 907
            +DSLNE L      L+ +  +   L+   K L  +L+E E + QSY VL   DD+  + E
Sbjct: 852  VDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITDKIE 911

Query: 908  ALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKED 967
             LR  LEK+ I L DAYSQIE+++S  K +E++   I+ A E  +  + K+   ++++  
Sbjct: 912  TLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQERK 971

Query: 968  ELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLG 1027
             L  Q+  L  QI +LN+EL HQK Q  SEK+EL  +L  LQ +Q +++ +K  YE+++ 
Sbjct: 972  SLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEEKIS 1031

Query: 1028 KLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEK 1087
            KL +DL QQA++AN+AQ+NYEQELQ+HADV+KTIS LREESQKYK++    + S  + + 
Sbjct: 1032 KLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASEAKS 1091

Query: 1088 TLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDL--EAKDPNSELGQSEPQ 1145
             L+ ++  W  Q  + E+QL    QR E+L  QN LL DQ++L  +A   +SE   S   
Sbjct: 1092 ALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATSSDSEAAASMSA 1151

Query: 1146 EKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXXXXXXXXX 1205
            E  RELI +LRRERDIL+TKL+VS R E +  ++L   + EL   + E            
Sbjct: 1152 ES-RELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQATAPDSI 1210

Query: 1206 IMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXXXXXXX 1265
               +   +           RESN+TLR+E +K  ++ Q  + +I                
Sbjct: 1211 FARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLESQLKS 1270

Query: 1266 XKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKAD 1325
               ++  +D QISL+ EE++RWKQRSQDIL K+ERIDP EH+KL +E+++ K EL  K+ 
Sbjct: 1271 LTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTELKNELEKKSL 1330

Query: 1326 QNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQE 1385
            +N E ++RF++L+KQA ERLD  KA +  +  E      A++ +E +L   Q ++K  + 
Sbjct: 1331 ENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELA--QTLDKVSEL 1388

Query: 1386 SLQRV----ESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSEL----E 1437
              +      E   +ADS  + ELE       +A +   DI+++ A  EK L++++    E
Sbjct: 1389 ESKLSSSANEKNGEADSLKE-ELEELRANFIEANEAVADIKAEAASSEKDLKNQIQELTE 1447

Query: 1438 KVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSEL----EKMKRDLEEHSNTLIAEKE 1493
            K+K+                    E++     DS +     E MK+  EE    LI EK+
Sbjct: 1448 KIKTLESEIEHS------------ELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKD 1495

Query: 1494 AEIRSHYEELR-------LKEKATYEKELEENGKHTP-VDIETLKKQWEEDYEQKTIKRI 1545
             E+R   EE++        +E +  +  L E+  + P +D ETLK + E +YE+KT++RI
Sbjct: 1496 EELRMKLEEIQKQYEEERERELSELKASLVESTPNAPLIDEETLKSKLEAEYEKKTLERI 1555

Query: 1546 EESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFT---- 1601
             E+ E L+KRIRLP+EE+IN+++E R+  L+QEFE +++ RA EL  E P+  SF     
Sbjct: 1556 REAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPE--SFVGDTA 1613

Query: 1602 EVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQV-K 1660
            +++K H++EM+KL+A    + DE++A VRKKAF+EGKQQ  MK   LE KIAKLE Q  K
Sbjct: 1614 KLIKEHQEEMDKLEA----KFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNK 1669

Query: 1661 ASGTEAVPS-APTSKN---SP-TEKPVRILEASPLEDALSR 1696
             +   +VPS  P   N   SP   +P+ I + SP + A  +
Sbjct: 1670 INLNNSVPSKIPIDNNNNSSPQGAQPIAI-KPSPFQVAFGK 1709

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1671 (37%), Positives = 978/1671 (58%), Gaps = 48/1671 (2%)

Query: 22   FLGIESNELLAVDGGVVVN--IAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQ 79
            FLGI  +EL  V    V++  +  K +EF  LQ+ NLR   TVDEL++    K+ + K +
Sbjct: 23   FLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDSLKKE 82

Query: 80   VHLLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDV 139
               L++E ++ +    + E+   +LT EK  AL   E ++   +   +QK  L+S+K +V
Sbjct: 83   TERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNKQEV 142

Query: 140  ARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQEL 199
             +LL EKISEL + K E+ +L+ +N+ LRQQ ++ ++E +  K   L  K+EL  + Q++
Sbjct: 143  VKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQV 202

Query: 200  SLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLREHN 259
             +   ++EWLE ++  K  +   YR    ++L                   + + L + N
Sbjct: 203  GMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKN 262

Query: 260  ARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLEL---RS 316
              I+ DL+ +L  +KKL+D LN+EKQEF+REMSLK++L+DL + Q+QS K +L L   + 
Sbjct: 263  QEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELRLTEEKH 322

Query: 317  TAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHE 376
             + E D+   +     + ++LAQ  QQLEES  +  +L+  V +++   +E  L S+A+ 
Sbjct: 323  NSTEADNLQSTQQARFM-DDLAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDLDSTAN- 380

Query: 377  YPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQ 436
               S+  LYGDI +LK+Q+I E+ QKE+LQ Q+E+FVVELE KVP+++S K+R+  LE++
Sbjct: 381  --VSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKE 438

Query: 437  LAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVR 496
            L++ A +LE  S +KE    +L     +I   EI    L RQRSDLARQVQ+LL   +++
Sbjct: 439  LSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQ 498

Query: 497  SDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRN 556
            +DS+GPLT +E+AF+++I+E  + S E D+Q +I+ERLVEF+DI  LQ +N++LL+T R 
Sbjct: 499  NDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTART 558

Query: 557  LADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKAI-- 614
            LAD+LE EE+ S +R  ++E   I EAKEAIITLQE   E+ES++  + KERDAYKAI  
Sbjct: 559  LADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILS 618

Query: 615  QPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTK 674
            Q S +  N      + +S+      +  LE  L T   E  KN ++LN EI+ L + KT+
Sbjct: 619  QTSQSFDNLGDADRMKDSQENQEL-IKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQ 677

Query: 675  LAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLSC 734
            L I  EKER+S+ LAE+RLK+ Q +L++TK EN EL +R H +Q  L KQ+ +  ET++ 
Sbjct: 678  LTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNK 737

Query: 735  LIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXXXXXXXGER 794
             I CQSKL+ LE+   +  A+   L S        I++++ ERN+             ER
Sbjct: 738  YISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQSER 797

Query: 795  DKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNET 854
            + LL E++ S+K  +  LEV+ S+L+T++S KD E         ++++W+QEKID ++  
Sbjct: 798  ENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSD 857

Query: 855  LKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELE 914
               +  +L ++  T   LE +   L+ +++E +++  SY  LN   +       LR +LE
Sbjct: 858  AGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGETTQGQLRKDLE 917

Query: 915  KSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDELVGQVE 974
            K+ I+L+ AYSQ EE +    +AEE L  ++N FE        +      ++ +L   V 
Sbjct: 918  KTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVS 977

Query: 975  ALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDLN 1034
             LK  I  LNNE   QK + + EKNE+  +LVSL+S++ ++  +K+ Y+Q+L +L +DL 
Sbjct: 978  NLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLE 1037

Query: 1035 QQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDESDG 1094
            QQ A+AN AQ+NYE+ELQ+HA+VSK ISQLR E Q  +++   L++S +Q ++ L+  + 
Sbjct: 1038 QQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEK 1097

Query: 1095 KWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKVRELITS 1154
             W NQK E +A +  L +++++++ QN LL  Q++L +K       +  P     EL+ S
Sbjct: 1098 SWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGSS--ELLIS 1155

Query: 1155 LRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXXXXXXXXXIMADEHNKX 1214
            LRRERDIL+TKL VSKR E +  +K  A+E EL+ A+++             +A +H   
Sbjct: 1156 LRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAKQHEDI 1215

Query: 1215 XXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXXXXXXXXKRSVRAKD 1274
                      RESN+TLR+ V    ++  +L+ ++++               ++S+  KD
Sbjct: 1216 MEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKD 1275

Query: 1275 SQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELEDRF 1334
             +I L+ +E +RWK+RS DIL + E+IDPEE++KL EE+S  K EL AK+ +N++L DRF
Sbjct: 1276 QRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRF 1335

Query: 1335 QRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVESEA 1394
             RLKKQA E+L+A+K  Q NLS E+ + +  ++ ME  L++ Q     L++ L   +SE+
Sbjct: 1336 TRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSES 1395

Query: 1395 KADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHXXXXXXXXXXXX 1454
              +   + EL+ AL++  + E K  +       +   L  E+  +K              
Sbjct: 1396 ANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQ------VRIFKE 1449

Query: 1455 XXXXSLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATYEKE 1514
                S  E  QG    S+ +E MK+  EE     I EK  E    +EE    EKA     
Sbjct: 1450 KENDSTLEGSQGL---SNVVESMKKAFEEEKIKFIQEKTEEYNKKFEE----EKAKLSS- 1501

Query: 1515 LEENGKHT-PV---DIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVET 1570
              ENG    PV   D+ +LKKQWEE+YE  + +RI+E+ E L+KRIR+PTEE+I K+++ 
Sbjct: 1502 --ENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDK 1559

Query: 1571 RKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEK-LKADLTREMDEEMAQV 1629
            RK+ELE+EF+ +L++      N +P+     E     ++E++K L+++   +  E +A  
Sbjct: 1560 RKTELEEEFQRRLKEN-----NLQPEGGDAKE-----REELKKQLESEFEAKYKEILAST 1609

Query: 1630 RKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVP--SAPTSKNSPT 1678
            +KKAF+EGKQQA+MKS  LE+KI+KLE+Q+ +S     P  +A TS   PT
Sbjct: 1610 KKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNN-PTPEKAAATSVGLPT 1659

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1679 (36%), Positives = 991/1679 (59%), Gaps = 57/1679 (3%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            F G+  ++L+ +DGG++  +  K  +F +L+++NLR +VT+DE+++ S ++    K+++ 
Sbjct: 29   FYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLKNEIE 88

Query: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVAR 141
             L+++ +S+R E +Q ++   + + +KQ+  N+ E+L+ +   L+Q+++ L+  K +V  
Sbjct: 89   NLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKREVVA 148

Query: 142  LLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSL 201
            +L EKI EL SF+ E+   + +++RLRQQ L+LE+  +  KS++L+ ++E+  ++Q L++
Sbjct: 149  VLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQRLTI 208

Query: 202  CRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLREHNAR 261
             + NS+WLE ++  K  +  + R     +L                    N+ +   N  
Sbjct: 209  LQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEE 268

Query: 262  ITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEG 321
            +T  L+ +L  +K L+D+L  EKQEF  EMS+K++L+DLLE QV+SL+ +L   + + + 
Sbjct: 269  LTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGEL---NASLDK 325

Query: 322  DD------GSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAH 375
            D+      G  +     L +EL    +  EESE +  +LE  VQ+L+  D      ++  
Sbjct: 326  DNVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQELIPGDDSQDDINNTS 385

Query: 376  EYPA--SVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDML 433
             + +  +      D+ +LK+++I E+ QKE LQ QVE+F+VELE K+P+++SFK+R  ML
Sbjct: 386  SFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSML 445

Query: 434  EEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQA 493
            E++L + A +L+  S +KE    +      ++ D E  I  LTRQR+DLA QVQ+LL+  
Sbjct: 446  EKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNI 505

Query: 494  SVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRT 553
            SV+ DS G L+ EE++F++RI+   D + E D+Q+VISERLVEF +I  LQ KN +LL+T
Sbjct: 506  SVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLKT 565

Query: 554  IRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKA 613
            +R LA+KLESEE+    + +T END I+EAKEAI++LQ++   LES++E+LTKE DA+KA
Sbjct: 566  VRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAFKA 625

Query: 614  IQPSTNNGNKITEHALAN-SKGKMSARVDD-----LERSLVTEREEAEKNMKMLNSEIQE 667
            I   + NG+       AN ++G  +   D+     LE  L +   E+ +N KMLN+EI E
Sbjct: 626  I--CSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIHE 683

Query: 668  LLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTK 727
            L R KT+++IE+EKER+SK L EERLK+ Q +L+LT+ EN++L KR   +Q    +QD++
Sbjct: 684  LYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSR 743

Query: 728  TQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXXX 787
            T ET++ LI C SKLA LE+++ +   + E L S ++ + E+  +L+ ERN+        
Sbjct: 744  TAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQL 803

Query: 788  XXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEK 847
                 ER+K L E + +YKE +D+LE E +  R +L  K +E  D   +  ++ QWYQ+K
Sbjct: 804  QTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDK 863

Query: 848  IDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTE 907
            +DS+    + +  +L+++     DLES+ + LE +++E E + QSY VL+ ++   +   
Sbjct: 864  LDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVETSPES 923

Query: 908  ALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKED 967
            +LR ELEK+KI L D Y++I+++++   + EE+LS +T  +   K E       ++ ++ 
Sbjct: 924  SLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGKQELQLQVETLQNEKS 983

Query: 968  ELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLG 1027
            +L   V  L   ++ L   L    K  ++EKN L+ ++ +L++  +  + +KE Y+ Q+ 
Sbjct: 984  QLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQIL 1043

Query: 1028 KLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEK 1087
            KL +DL QQA+FAN+AQ NYE+ELQ+ ++VSKTIS+LRE+SQK +   + L++S EQ+ +
Sbjct: 1044 KLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQ 1103

Query: 1088 TLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEK 1147
             L++++  W  QKEEYE QL +  Q +EDL+ QN LL DQ++L +KD NS+    E  E 
Sbjct: 1104 VLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKD-NSDGVNGETAE- 1161

Query: 1148 VRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXXXXXXXXXIM 1207
            VRE++T+LRRERDIL TKL VS+R E      L ++E EL   K +             +
Sbjct: 1162 VREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSEL 1221

Query: 1208 ADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXXXXXXXXK 1267
              +H K           RESNITLR+  +++ ++ +EL+ +++                 
Sbjct: 1222 IGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQLRERILPLESELNTLH 1281

Query: 1268 RSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQN 1327
             SV  KD Q++L  EE NRWK+RSQ+IL K +RIDPE+HK+L E++S  + +L     +N
Sbjct: 1282 TSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKEN 1341

Query: 1328 SELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESL 1387
             EL+DRF RLKKQA E+L+++K  Q  LS +L + REA+S +E +   E+     LQE L
Sbjct: 1342 KELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERL 1401

Query: 1388 QRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELE--KVKSHXXX 1445
                ++ +   + Q EL  AL+   + E+          +I K L  E++  K++ H   
Sbjct: 1402 NAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLK 1461

Query: 1446 XXXXXXXXXXXXXSLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEELRL 1505
                          L  V          +E M+R  EE     + EK  E++        
Sbjct: 1462 EQSAATAKGEISEDLSNV----------VESMRRSFEEEKINFLKEKTEELKK------- 1504

Query: 1506 KEKATYEKELEENG---KHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEE 1562
                  +  L+ NG   +  PV+ E +K+QWE + E+  +KRI E+ E L+KRIRLPTEE
Sbjct: 1505 --LEEEKHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTEE 1562

Query: 1563 KINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREM 1622
            +I ++VE +K+ LE+ ++ KL++  S L +     +         K+++EK   DL  + 
Sbjct: 1563 RIKQVVEKKKAALEELYKKKLEESKSSLESSDGNNSDL-------KKQLEK---DLQEKF 1612

Query: 1623 DEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEKP 1681
            + E+  V+KKAF+EGKQQA+MKS  LE+KI+KLE+Q+   G    P   +S+ S   KP
Sbjct: 1613 EAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLH--GKVDSPDKSSSETSSVPKP 1669

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/1748 (34%), Positives = 979/1748 (56%), Gaps = 124/1748 (7%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            FL ++   +  ++  V+  I  K  + ++ ++ENLR + T+D+L+S SE KL + K  + 
Sbjct: 13   FLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKIHIS 72

Query: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQ-------QKQALES 134
             L + LE  + E   FE+       EK+R +  +  +  R   LEQ       QK+  ++
Sbjct: 73   QLAKALEDGKDERLHFEE-------EKRRLIEGNSQVTKRIIELEQEIEVERQQKELADA 125

Query: 135  SKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHR 194
            SK D+A  LNEKI ELSS K + ++    N+ LRQ+ ++ E+E +  ++ +L+ K+E+ R
Sbjct: 126  SKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEILR 185

Query: 195  LSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKS 254
            + QE++L R N++WL +QL  K  + N +R +T S+L                +  +N+ 
Sbjct: 186  MEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQK 245

Query: 255  LREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLEL 314
            L++    +   LE +L   K++ D  N  KQE T+EMSLK+R++D LE  ++SLK   E+
Sbjct: 246  LKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKK--EM 303

Query: 315  RSTAGEGDDGSFSNP-LNALSEELAQKTQQLEESEFKVQKLEQTVQDLVST----DKESR 369
             +T    D   F+    + L EEL     +L+ SE    KL++T+ +L S     D E  
Sbjct: 304  DATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSEVG 363

Query: 370  LKSSAHEYPASVTD-LYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKD 428
              +++ E   SV   LYGD+ +LK+Q++ EKRQK+ L+ QVEAFVVELE K+P+L+SFK+
Sbjct: 364  NTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKE 423

Query: 429  RNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQY 488
            R++MLE +L E   +LES  KD++  +  L   KA +  +E QI+ L++QR DLA Q+QY
Sbjct: 424  RSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQY 483

Query: 489  LLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNS 548
            LL+  S++S+  GPL+ EE+ FV+ +    +++   DTQ +I++RLVEFR +VELQ KNS
Sbjct: 484  LLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNS 543

Query: 549  DLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKER 608
            +LL TIRNLAD+LE  E ++K + + +E++ +REAKE I+TL +HAQ LE+++ +L+KER
Sbjct: 544  ELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKER 603

Query: 609  DAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQEL 668
            DAYKA+  + ++G   T  A+         +V DLE  L    +EAE N K  +SE   L
Sbjct: 604  DAYKALSVNASSGTN-TPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSENSNL 662

Query: 669  LRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKT 728
             ++  ++++  E E+TS+ LAE+RL + Q +L+L+K++ EEL KR   +QD L KQD +T
Sbjct: 663  RKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQDKRT 722

Query: 729  QETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXXXX 788
            QET+  LI+ +S L++++SEL    ++ + ++  QK+     E+ + E            
Sbjct: 723  QETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIAQLQ 782

Query: 789  XXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKI 848
                ER+ LL ET+ SYKEK+  LE+E S    +L   ++         + +  W+QEKI
Sbjct: 783  TLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQEKI 842

Query: 849  DSLNETLKVVTSQLESQAQTTRDLESQKKLLE-------GRLKEVETKAQSYDVLNQTDD 901
            D L       TS+   Q  T  + E+Q + ++        +LKE E +AQSY +L+  DD
Sbjct: 843  DKL-------TSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDD 895

Query: 902  VLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGN 961
                 E LR ELEK  ++L D+YSQIE H++  + + ++++ ++ AFE  + E  K    
Sbjct: 896  AQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIIT 955

Query: 962  MKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEH 1021
            ++ + ++L   V  L  Q+ +LNNE+ HQK ++ +E+N    ++  LQ  +E+++  K  
Sbjct: 956  LENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKAD 1015

Query: 1022 YEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSS 1081
            YE+++  + +DL  Q  +AN++Q +YE ELQ+HADVSKTI+ LR E+Q YK+    L++ 
Sbjct: 1016 YEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQ 1075

Query: 1082 IEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQ 1141
             +   + L  S+  W  QK EYE +L  L QR+++L+ QN LL DQ++L        L +
Sbjct: 1076 SQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIEL--------LNK 1127

Query: 1142 SEPQEKVR---ELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXX 1198
            +E ++      +L+ SLRRERD+L+TKLEV+   +TV  ++L+  + E+     +     
Sbjct: 1128 TEDRDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVK 1187

Query: 1199 XXXXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXX 1258
                    + ++              RESN+TLRSE     + C  L+ Q+         
Sbjct: 1188 NSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAP 1247

Query: 1259 XXXXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKA 1318
                    +  ++ K+ ++    EE  RWK RSQDIL K+ERIDPEEH KL EE++  K 
Sbjct: 1248 LQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKN 1307

Query: 1319 ELAAKAD-------QNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMEL 1371
            EL    D       +  + E +FQR++ QAR+RL+A+K  + +LS E+ Q  EA+S +E 
Sbjct: 1308 ELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEA 1367

Query: 1372 QLRKEQDVNKALQESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKA 1431
             L K +   K L+E LQ V  EA+   T +    S L KL       +D+ S + Q+E A
Sbjct: 1368 DLGKCKTACKELEERLQVVTQEAE---TKEQTFNSQLSKLQ------EDLHSIQVQMENA 1418

Query: 1432 LQSEL------EKVKSHXXXXXXXXXX-------XXXXXXSLEEVKQGAFTDSSE--LEK 1476
             ++E       EK+KS                         + E       + ++  ++ 
Sbjct: 1419 SKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDN 1478

Query: 1477 MKRDLEEHSNTLIAEKEAEIRSHY------------EELRLKEKATYEKELEENGKHT-- 1522
            +K + E     LI +KE E+RS +            EELR + +   ++  EE  K T  
Sbjct: 1479 LKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSREEELRKQFEEREKRIREECEKTTVQ 1538

Query: 1523 -P------VDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSEL 1575
             P      +DI+ LK +WE++YE++T+++I+ + E L+KRIRLPT++KI+KIVE RK+ L
Sbjct: 1539 SPSQPTLDIDIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVL 1598

Query: 1576 EQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFD 1635
            E+ FE K+ ++A +LA E    A     +++H+ E+  LK  + ++ + ++A++++K+F+
Sbjct: 1599 EESFEEKVNEKAQKLAGEIGNDAI---TLEKHRAELNALKDSMRKQFEADLAEIKQKSFE 1655

Query: 1636 EGKQQASMKSMFLEKKIAKLE-------------------AQVKASGTEAVPSAP--TSK 1674
            EGKQQ S+K  FLE KI  LE                    Q    G+ +  ++P  TS+
Sbjct: 1656 EGKQQVSLKLKFLESKIRNLEQQKSTIKPVENDTSNMSAAFQAPVFGSHSTFTSPFSTSE 1715

Query: 1675 NSPTEKPV 1682
             SP ++P+
Sbjct: 1716 ISPNKRPI 1723

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1712 (34%), Positives = 965/1712 (56%), Gaps = 113/1712 (6%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            F      ++ ++D  +V ++  K  +F +L++EN++ +VT+DEL+++S +K+ + K ++ 
Sbjct: 27   FFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKTEME 86

Query: 82   LLLQELESLRGE----SAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKN 137
             +L++ + +R E    S++FE ++     EK    N+ E+++ +   L ++K+ ++SS+ 
Sbjct: 87   DVLRQNDEIRKERNDTSSKFESVQ----REKTHLSNELESIKRKLSDLSEEKKEIQSSQQ 142

Query: 138  DVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQ 197
               ++L+E++ EL   K  ++    E ++LR   L+LE++ +   S DL  K++L R +Q
Sbjct: 143  RTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQ 202

Query: 198  ELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLRE 257
            EL+L +SN +WLE +L  KN ++ +YR  T + ++                   N  LR+
Sbjct: 203  ELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLRQ 262

Query: 258  HNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRST 317
             N  ++ DL+ +L  +K L+D+ NSEK++F+ E++LK+RL+DLLE Q+ ++K +L     
Sbjct: 263  KNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRE 322

Query: 318  AGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKES-RLKS---- 372
            +   D  S                Q + E+E  ++ L+ T   LV  + E  RL S    
Sbjct: 323  SNYSDVNS------------DDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEE 370

Query: 373  SAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDM 432
            +  E     +   GD  LLK+Q+I EKR KEHLQNQ+E+F+VELE KVP+++SFK+R D 
Sbjct: 371  AGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDT 430

Query: 433  LEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQ 492
            LE +L   A +LE  S +K +   +L+    ++ +++ +I  L++QR DL RQ+QYLL+ 
Sbjct: 431  LENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVT 490

Query: 493  ASVRSDSKGPLTTEEIAFVRRILEQGD-LSLERDTQKVISERLVEFRDIVELQSKNSDLL 551
             SV +DSKGPL  EEI F++ IL+  D  + E D+QK+++ERLVEFRDI++LQ KNS+LL
Sbjct: 491  NSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEKNSELL 550

Query: 552  RTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAY 611
            R  RNLADKLES E +SK   K +EN+ I EAKEAI+TLQ    +LES+I  L KER+ +
Sbjct: 551  RVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEKEREKF 610

Query: 612  K--AIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELL 669
            K   +   T+  N + +  L  +K ++ ++  DL+  +     E+ +NM +LN E+Q+L 
Sbjct: 611  KNWTMDQETSPNNSVIQQ-LTETKRELESQTQDLQARISQVTRESTENMSLLNKELQDLY 669

Query: 670  RQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQ 729
              K+ L+IE+ +E++S+ LAEER K+   +L L K EN++L KR   +Q+ + KQD+KTQ
Sbjct: 670  DSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQ 729

Query: 730  ETLSCLIECQSKLATLESELKS----SVAKIESLSSCQKKNTESIEQLTAERNNXXXXXX 785
            ETL+  + C+SKL+ +E+EL +       KIE     +K   + + +L++E+ +      
Sbjct: 730  ETLNDYVSCKSKLSAIETELSNLKLERTLKIE----LEKNLKQELSELSSEKTSLHIMVT 785

Query: 786  XXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQ 845
                   ER+ LL ET+KS + K+DAL+   ++L+T+  RKD+      + NDS+ +WYQ
Sbjct: 786  QLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQ 845

Query: 846  EKIDSLNETLKVVTSQL-ESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLA 904
             KI++L +  + V S L E Q +  R  + + K LE  ++E + +  +Y+VL+++     
Sbjct: 846  NKIETLRKDHESVMSSLNEKQIEVER-FQYEIKSLEKEIEENKIRLHTYNVLDES----I 900

Query: 905  QTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKK 964
              ++LR ELEKSKI L DAYSQI+E++  Y++ +++L  +++  +      S    N+  
Sbjct: 901  NDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960

Query: 965  KEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQ 1024
            ++  L  +V  L+ Q+SNLNNEL  Q +  + EK E + ++  LQ+  + + ++K  YE 
Sbjct: 961  EKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTEYES 1020

Query: 1025 QLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQ 1084
            +L K+ +DL+QQ  +AN AQ NYEQELQ+HADVSKTIS+LRE+   YK Q   L  +  Q
Sbjct: 1021 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQ 1080

Query: 1085 LEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEP 1144
             EK L E++  W +QKE    QL   N RIEDL+ QN LL DQ++L     N        
Sbjct: 1081 FEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSG 1140

Query: 1145 QEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXXXXXXXX 1204
                 +++ +LRRERDIL TK+ V++R   +  +K+  I+ EL  A+ +           
Sbjct: 1141 SVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR 1200

Query: 1205 XIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXXXXXX 1264
              +  +H++           RESN TLR+E+     + +EL+ +++              
Sbjct: 1201 SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260

Query: 1265 XXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKA 1324
              K S++ K+ +I L  EE +RWK+RSQDI+ K +++   +++KL  E+   KA+L  K 
Sbjct: 1261 ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT 1320

Query: 1325 DQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQ 1384
             Q ++ E++F RL++QA+E+L A+K  Q++   +L + ++A      +L  E+ +N A  
Sbjct: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDA------KLALEKSLNNA-N 1373

Query: 1385 ESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHXX 1444
              +Q +E    A++  Q         LS  +K  +D E +  ++E  L+   E   S+  
Sbjct: 1374 ARIQELEDAKVAENRNQ---------LSMIKKLQEDTEENSKELETKLE---ENAISYDS 1421

Query: 1445 XXXXXXXXXXXXXXSLEE---------VKQGAFTD--SSELEKMKRDLEEHSNTLIAEKE 1493
                           LE+            G   D  S  +E MKR  EE     I EK 
Sbjct: 1422 TVKKLNEEIGILKEELEKQRQIQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKT 1481

Query: 1494 AEIRSHYEELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILR 1553
             E+       +++E    ++  E   K + ++I+ +KKQWE ++ ++  K+I E+ E L+
Sbjct: 1482 REVNQ-----KIREFQEAQEAEETGLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALK 1536

Query: 1554 KRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQE--- 1610
            KRIRLPTEEKI+KI+E +K +LE+EF+ K+++R   ++        F + ++   QE   
Sbjct: 1537 KRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLKSISQSGKMEDIFQKQLESRIQEKQK 1596

Query: 1611 ---------------------------MEKLKAD----LTREMDEEMAQVRKKAFDEGKQ 1639
                                        +KL+AD    L  E + E+  ++KK+F+EGKQ
Sbjct: 1597 ELENEYNKKLQEKLRELPSSDIISSDDKDKLRADIEAQLREEFNHELQTIKKKSFEEGKQ 1656

Query: 1640 QASMKSMFLEKKIAKLEAQVKASGTEAVPSAP 1671
            QA MK+  LE+K+AK+E+Q+ +   ++V S P
Sbjct: 1657 QAMMKTTLLERKLAKMESQL-SETKQSVDSPP 1687

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1710 (34%), Positives = 974/1710 (56%), Gaps = 68/1710 (3%)

Query: 23   LGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVHL 82
            LG+E  ++  +   +V  +  + + F+QL+AEN R  V++    S       AC+  V  
Sbjct: 25   LGLEQGQVQQLGEQLVRTLWGREQAFRQLEAENTRLKVSIGAAES-------ACEHGVEA 77

Query: 83   LLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRK--EALEQQKQALESSKNDVA 140
            L +  + L  E+   ++ + E  S   RA   S   RV++  E  E++  A +S++ D+A
Sbjct: 78   LRERQQQLAAEAGAQQRGQGEAGSAG-RAGGPSVPERVQQQLEETERRVAAGDSARRDLA 136

Query: 141  RLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELS 200
            RLL EKIS+L + +QE + ++  N+ LR+  ++LE   +  +S+ L+ +AE+ RL QEL+
Sbjct: 137  RLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELA 196

Query: 201  LCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLREHNA 260
            L RSN+EW   QL +KN + N+YR  T  ++ +                    +LR  N 
Sbjct: 197  LVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNG 256

Query: 261  RITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGE 320
             ++  L+  L   K+LTD+L+SEKQEF REM+LK+RL++LL GQV ++K DLE ++    
Sbjct: 257  ELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLE-KAYDVA 315

Query: 321  GDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHEYP-- 378
             + G   +    L  +L    ++LE S+  V +LE T+++L+ TD       +  E+   
Sbjct: 316  KNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANV 375

Query: 379  ------ASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDM 432
                  ++++ +YGD++ L++Q++ E+R KE LQ QVE+FVVELE K+P+L+SFK R + 
Sbjct: 376  GSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEE 435

Query: 433  LEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQ 492
            LE+QL     +LE+ +++++   + +++ K ++ D+E Q+  L +QRSDLARQVQ LLI 
Sbjct: 436  LEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIH 495

Query: 493  ASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLLR 552
             SVR DS GPLT EE+ FV+++    D +   DTQ +IS RLVEF+ +VELQ KN++LL 
Sbjct: 496  ISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLN 555

Query: 553  TIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYK 612
             IR LA KLE EE +++ + K++E + + EAKEAI++LQEH Q LE ++E +T ERD++K
Sbjct: 556  AIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTERDSFK 615

Query: 613  -AIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQ 671
              +    NN       A A    +++  +  LE  L    EE+E++ KMLN EI+ L + 
Sbjct: 616  LLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALYKS 675

Query: 672  KTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQET 731
             ++LAIE+E+ER+S+ LA+E+L + Q SL+L K EN +L  R   +Q  LL+QDT+ Q T
Sbjct: 676  NSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQST 735

Query: 732  LSCLIECQSKLATLESEL------KSSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXX 785
            +   +  +S+L ++ S+L      +  + K+E  +  +K+N    E L  + N+      
Sbjct: 736  IEEFVSAKSELFSISSQLTILQSERDFLRKVE--ADLKKEN----ESLNKDNNDSQLLIL 789

Query: 786  XXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQ 845
                   ERD L+ ET K Y+ +++ L+ E S  + QL RK  E+++   ++ ++ +W+Q
Sbjct: 790  QLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQ 849

Query: 846  EKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKA----QSYDVLNQTDD 901
             K+DSL E L   +S+L  +A+T+ +L++ K  L     ++E  +    QS  VL    D
Sbjct: 850  SKLDSLKEELG--SSKLALKAKTS-ELDALKARLNSSTSKLEPASMDHQQSSLVLE--SD 904

Query: 902  VLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEAL---SAITNAFERFKNEHSKD 958
              ++ ++L  +L+++  KL  AYS+IE    RYK+A  A    S   NA +  K+   + 
Sbjct: 905  HASRVQSLSKDLDEANRKLSSAYSEIE----RYKAASNATERPSLSYNAVQDNKDGSKQA 960

Query: 959  FGNMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSM 1018
              +++ +  +L   +     +I  L +EL  ++  + +E++EL+ ++ +L + ++ +   
Sbjct: 961  AISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEA 1020

Query: 1019 KEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVL 1078
            K  Y+Q++ +L  DL +Q +  N+A+  Y+  LQ+ A++S+ I  LR+ S+ YK++ +  
Sbjct: 1021 KADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKF 1080

Query: 1079 QSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSE 1138
            +S+ E+  K L+ ++  W  QK + EA L   +QRIE+L+ QN LL DQ++L ++ P+S 
Sbjct: 1081 KSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSS 1140

Query: 1139 LGQ-SEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXX 1197
            L   ++     RELI +LRRERDIL+TK++VSKR E +  ++LE  + EL   + +    
Sbjct: 1141 LEPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSES 1200

Query: 1198 XXXXXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXX 1257
                      +    +           RE N++LR+E +K ++  + L+ +I +      
Sbjct: 1201 KGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQ 1260

Query: 1258 XXXXXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAK 1317
                       ++  K+ +++L+ EE++RWKQRSQDIL K+ERIDPEE++KL  E+   K
Sbjct: 1261 PMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLK 1320

Query: 1318 AELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQ 1377
            AEL  K+ ++ + ++RF++L+KQA ERLD  KA +  +  EL  A   +S +E +L + +
Sbjct: 1321 AELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAR 1380

Query: 1378 DVNKALQESL-QRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSEL 1436
            +   +L+  L +R  SE   D+    ELE    KL  AE     ++S+ +  E++ + +L
Sbjct: 1381 EKITSLETQLTERPASE--DDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQL 1438

Query: 1437 EKVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEI 1496
            +++                        +Q     ++ LE  K+ +EE   TLI   + E+
Sbjct: 1439 DELNKQLETIQKNSAPSSGHSDPSSYHEQ----PTAVLEDFKKQVEEERRTLIESHQQEL 1494

Query: 1497 RSHYEELRLKEKATYEKELEE--------NGKHTPVDIETLKKQWEEDYEQKTIKRIEES 1548
             +  E  R    A  EK LEE        + +    ++E LKK+WEE+YEQ+T++RI E+
Sbjct: 1495 TARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREA 1554

Query: 1549 NEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASF--TEVMKR 1606
             E L+KRIRLP+EE+IN+++E ++  LEQEF  K+   A  L  E P   +    +++K 
Sbjct: 1555 EEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKD 1614

Query: 1607 HKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKAS-GTE 1665
            H++E+ +LK DL  + + ++ QV+KKAF+EG+QQ  MK   LE KI+KLE+Q KA  GT 
Sbjct: 1615 HQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKAPLGTN 1674

Query: 1666 AVPSAPTSKNSPTEKPVRILEASPLEDALS 1695
                 P     P  + V + + SP + A +
Sbjct: 1675 VPTKIPLENTQPLAQQVPV-KPSPFQLAYA 1703

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1706 (34%), Positives = 965/1706 (56%), Gaps = 115/1706 (6%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            F G    ++ +++  ++ ++  K  +F +L++ENL+ +V+ DEL+++S +K+   K ++ 
Sbjct: 27   FFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKKEME 86

Query: 82   LLLQELESLRGE-SAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVA 140
             L+++ + +R E     +K++ E  +EK +  N+ E+++ R + L ++K+ L+ ++    
Sbjct: 87   NLIKQNDGIRKERDDTCDKLESE-KNEKTKISNELESIKRRADDLIEEKKELQCNQQRTL 145

Query: 141  RLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELS 200
            ++L+E++ EL   + + +    E +RLR   +DLE++ +   + DL  +AEL R +QEL+
Sbjct: 146  KILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELERKAQELN 205

Query: 201  LCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLREHNA 260
            + +S ++WLE +L  KN ++ +YR  T   +                    N  L + N 
Sbjct: 206  ILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQKND 265

Query: 261  RITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAG- 319
             ++  L+ +L  +K L+D L+SEKQEF+ E++LK+RLVDLLE Q+ ++K   EL ST G 
Sbjct: 266  ELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKE--ELDSTRGL 323

Query: 320  EGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKES-RLKS----SA 374
            E  + S                + + E E  V++L+ T ++L     E  RL S    + 
Sbjct: 324  ETSNDS---------------KKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGETD 368

Query: 375  HEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLE 434
             E  +S +    D  LLK+Q+I EKR KEHLQNQ+E+F++ELE KVP+++SFK+R D LE
Sbjct: 369  EESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTLE 428

Query: 435  EQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQAS 494
             +L   A +LE  S +K +   +L     ++   E  I  L +QR DL RQVQYLLI  S
Sbjct: 429  NELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNS 488

Query: 495  VRSDSKGPLTTEEIAFVRRILEQ-GDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRT 553
            V  DSKGPL  EEI F++ IL+   D + E D+QK+++ERLVEFR I+ELQ KN++LL+ 
Sbjct: 489  VSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKI 548

Query: 554  IRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKA 613
            +RNLAD+LES E +SK   + +E++ I EAKEAI+TL+   ++LES++E L KE +  KA
Sbjct: 549  VRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKECENSKA 608

Query: 614  IQPS--TNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQ 671
            +  +  T++ N  T   L  +K  +  ++ DL+ ++     E+ +NM +LN EIQ+L   
Sbjct: 609  LLSNEETSHLNS-TIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDLYDS 667

Query: 672  KTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQET 731
            K+ ++I++ KE++S+ LAEER K+   +L LTK EN++L KR+  +Q  +LKQD+KTQET
Sbjct: 668  KSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQET 727

Query: 732  LSCLIECQSKLATLESELKS----SVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXXX 787
            L+  I C+SKL   E+EL +       KI+S  + +++    +++L++E+          
Sbjct: 728  LNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQE----MQKLSSEKTGLRIMVTQL 783

Query: 788  XXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEK 847
                 ER+ LL ET KSY+ K+D LE   ++L+ + S KD+      + N+S  +WYQ K
Sbjct: 784  QTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNK 843

Query: 848  IDSL---NETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLA 904
            I+ L   NE+  ++ S  + QA+  + L+ + K LE  + E + +  +Y+V++ T     
Sbjct: 844  IEVLKKDNES--IICSMNDKQAEIEK-LQHKVKSLEKEIDENKIRLHTYNVIDGT----I 896

Query: 905  QTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGN--- 961
              ++LR ELEKSKI L DAYSQI+E++  Y++  ++L  + + FE    E SKDF N   
Sbjct: 897  NDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFE----ESSKDFSNRIK 952

Query: 962  -MKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKE 1020
             +  ++  L  ++  LK QI NLNNEL  Q K    EK E   ++  LQ+  + + ++K 
Sbjct: 953  NLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKS 1012

Query: 1021 HYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQS 1080
             YE +L K+ +DL+QQ  +AN AQ NYEQELQ+HADVSKTIS+LRE+   Y+ Q + L  
Sbjct: 1013 EYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTL 1072

Query: 1081 SIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELG 1140
            S  QLE TL E++  W +Q++    QL S N RIEDLT QN LL DQ++L      ++ G
Sbjct: 1073 SRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYT---TADKG 1129

Query: 1141 QSEPQEK--VRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXX 1198
             ++  +K  +  ++ SLRRERDIL TK+ V++R   +  +K+  ++ EL  A+ +     
Sbjct: 1130 VTDTNDKPALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSR 1189

Query: 1199 XXXXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXX 1258
                    +  +H             RESNITLR+E++   +  + L+ ++D        
Sbjct: 1190 LEEEKRPTIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAP 1249

Query: 1259 XXXXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKA 1318
                    K S++ K+ ++ L  EE +RWK+RSQDIL K  ++   +++KL  E+   K 
Sbjct: 1250 IESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKV 1309

Query: 1319 ELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQD 1378
            +L  K  Q +E E+RF RL++QA+ERL  +K   + L+ ++   + A+  +E  L    D
Sbjct: 1310 KLDEKTRQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSL---DD 1366

Query: 1379 VNKALQESLQRVESEAKADSTTQPELESALQKLSQ-AEKKAQDIESDRAQIEKALQSELE 1437
             N  ++E L+  ++E   +         A+++L Q AE  +++ ++   +      S ++
Sbjct: 1367 ANTKIEE-LENAKAEQDNNQL------DAIKRLQQDAENSSKEFKTKLEEKATFYDSTIK 1419

Query: 1438 KVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSEL-EKMKRDLEEHSNTLIAEKEAEI 1496
            K+                    L+        D S++ E MK+  EE     I EK  E+
Sbjct: 1420 KLNEEIITLREEIEKQRRIQQQLQSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEV 1479

Query: 1497 RSHYEELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRI 1556
                 E +           E   + + ++I+ LK +W+ ++E++ + RI E+ E L+KRI
Sbjct: 1480 NEKILEAQ-----------ERLNQPSNINIDELKIKWKAEHEEEVVNRIREAEEALKKRI 1528

Query: 1557 RLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASF---TEVMKRHKQ---- 1609
            RLPTEEKI+KI+E ++ +LE+EF+ K+++R   L+       +F    E+  + KQ    
Sbjct: 1529 RLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELE 1588

Query: 1610 -------------------EMEKLKAD----LTREMDEEMAQVRKKAFDEGKQQASMKSM 1646
                               E ++L+A+    + +E+D E+  ++KK+F+EGKQQA MK+ 
Sbjct: 1589 DKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTT 1648

Query: 1647 FLEKKIAKLEAQVKASGTEAVPSAPT 1672
             LE+K+AK+E+Q+  S T+ +  +P+
Sbjct: 1649 LLERKLAKMESQL--SETKKITESPS 1672

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1716 (33%), Positives = 964/1716 (56%), Gaps = 118/1716 (6%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            F G    ++ + DG VV ++  K  +F +L++ENL+ +V+ DEL++SS +K+   K ++ 
Sbjct: 27   FFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKTEME 86

Query: 82   LLLQELESLRGES----AQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKN 137
             +++E + +R E      +FE ++    +EK +  ++ E ++ + + L ++K+  +S++ 
Sbjct: 87   NVIRENDKIRKERNDTFVKFESVE----NEKMKLSSELEFVKRKLDDLTEEKKETQSNQQ 142

Query: 138  DVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQ 197
               ++L+E++ E+   + E +    E ++LR   +DLE++ +   + DL  + EL R +Q
Sbjct: 143  RTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELERKTQ 202

Query: 198  ELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLRE 257
            EL+L +SN++WLE +L  KN ++ +YR  T   +                    N  L++
Sbjct: 203  ELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNNDVLKQ 262

Query: 258  HNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDL----E 313
             N  ++  L+ +L  +K L+D+LNSEKQEF+ EMSLK+RLVDLLE Q+ ++K +L    E
Sbjct: 263  KNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIRE 322

Query: 314  LRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKES-RLKS 372
            L +     DD     P                E+E  +++L+ T + L   +KE  RL S
Sbjct: 323  LNTAKVIADDSKKQTP----------------ENEDLLKELQLTKEKLAQCEKECLRLSS 366

Query: 373  SAHEYPASVTDLYG----DISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKD 428
               E      +L      D   LK+Q+I E+R KEHLQNQ+E F+VELE KVP+++SFK+
Sbjct: 367  ITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKE 426

Query: 429  RNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQY 488
            R DMLE +L   A +LE  S +K +   +L     ++ + E  +  LT+QR DL RQ+QY
Sbjct: 427  RTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQY 486

Query: 489  LLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSL-ERDTQKVISERLVEFRDIVELQSKN 547
            LLI  SV +DSKGPL  EEI F++ I+++ D ++ E D+QKV++ERLVEF++I++LQ KN
Sbjct: 487  LLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQEKN 546

Query: 548  SDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKE 607
            ++LL+ +RNLADKLES+E++SK   + +E++ + EAKEAIITL+    +LESRIE L KE
Sbjct: 547  AELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRIEELQKE 606

Query: 608  RDAYKAIQPSTN-NGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQ 666
             +  K   P+ + + + +T   L  +K  + ++V DL+  +     E+ +NM +LN EIQ
Sbjct: 607  LEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQ 666

Query: 667  ELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDT 726
            +L   K+ ++I++ KE++S+ LAEER K+   +L LTK EN++L KR+  +Q+ +LKQD+
Sbjct: 667  DLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDS 726

Query: 727  KTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXX 786
            KT ETL+  + C+SKL+ +E+EL +   + +     +K   + + +L+ E+++       
Sbjct: 727  KTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVTQ 786

Query: 787  XXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQE 846
                  ER+ LL ET KS ++K+D LE   S+L+ + S+KD       + N+S  +WYQ 
Sbjct: 787  LQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQN 846

Query: 847  KIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQT 906
            KI++L +  + V + ++S+      L+ + K LE  ++E + +  +Y+V+++T       
Sbjct: 847  KIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDET----IND 902

Query: 907  EALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEAL----SAITNAFERFKNEHSKDFGNM 962
            ++LR ELEKSKI L DAYSQI+E++  Y++  ++L    S +  +F+ F N+      N+
Sbjct: 903  DSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQ----IKNL 958

Query: 963  KKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHY 1022
              ++  L  ++  LK Q+ NLNNEL  QKK  + EK + + ++  LQ+  + + ++K  Y
Sbjct: 959  TDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEY 1018

Query: 1023 EQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSI 1082
            E +L K+  DL+QQ  +AN AQ NYEQELQ+HADVSKTIS+LRE+   YK Q   L  S 
Sbjct: 1019 ESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSR 1078

Query: 1083 EQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQS 1142
            +QLE  L E++  W +QKE    QL   N RIEDL+ QN LL DQ+ +     + E+  S
Sbjct: 1079 DQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTA-ADKEVNNS 1137

Query: 1143 EPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXXXXXX 1202
                 +  ++ +LRRERDIL TK+ V++R   +  +K+  ++ EL  A+ +         
Sbjct: 1138 TNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKE 1197

Query: 1203 XXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXXXX 1262
                +  +H+            RESNITLR+E++    + +EL+ ++D            
Sbjct: 1198 NHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESE 1257

Query: 1263 XXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAA 1322
                K S++ K+ ++ L  EE +RWK+RSQDIL K E++   +++KL  E+   K EL  
Sbjct: 1258 LTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELEN 1317

Query: 1323 KADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKA 1382
            K  Q +E E++F RL++QA+ERL  +K  Q++L+ ++   R+A++ +E           +
Sbjct: 1318 KERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLE----------NS 1367

Query: 1383 LQESLQRVESEAKADSTTQPELESALQKLSQ-AEKKAQDIESDRAQIEKALQSELEKVKS 1441
            L E+  R+E    A          A++KL + AEK ++++++   +   + +S +  +  
Sbjct: 1368 LSEANARIEELQNAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNE 1427

Query: 1442 HXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSEL-EKMKRDLEEHSNTLIAEKEAEIRSHY 1500
                              L+        D S + E MK+  EE     I EK  E+    
Sbjct: 1428 EITTLKEEIEKQRQIQQQLQATSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKI 1487

Query: 1501 EELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPT 1560
             E +           E   + + +++E +KK+WE ++EQ+  ++I E+ E L+KRIRLPT
Sbjct: 1488 LEAQ-----------ERLNQPSNINMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPT 1536

Query: 1561 EEKINKIV---------------ETRKSELEQ----------EFEAKLQKRASELANEK- 1594
            EEKINKI+               E R   +EQ          + EAK+Q++  EL NE  
Sbjct: 1537 EEKINKIIERKKEELEKEFEEKVEERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYN 1596

Query: 1595 ----------PQPASFTEVMKRHKQEMEKLKAD----LTREMDEEMAQVRKKAFDEGKQQ 1640
                      P  +  ++       E +KL+A+    L  E + E+  ++KK+FDEGKQQ
Sbjct: 1597 KKLQEELKDVPHSSHISD------DERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQ 1650

Query: 1641 ASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNS 1676
            A MK+  LE+K+AK+E+Q+ +   ++  S P S N+
Sbjct: 1651 AMMKTTLLERKLAKMESQL-SETKQSAESPPKSVNN 1685

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1664 (33%), Positives = 927/1664 (55%), Gaps = 79/1664 (4%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            FL +   +L A++  ++ N+  K  +F +LQ+++L+  V+++EL+ +S+ ++   + Q+ 
Sbjct: 19   FLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRTQLE 78

Query: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSET---LRVRKEALEQQKQALESSKND 138
             L+++  S    S + +K++ EL+ EK+ +   S T   LR   + ++++   L+    D
Sbjct: 79   DLIEQNASA---SEEKKKIEKELSDEKKESFQLSSTRDNLRAELKEIQEKFDNLQKQNQD 135

Query: 139  VARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQE 198
              +LL+ KIS+    K+    L  + R    +  DLE E +  K  D   +  +++LSQ+
Sbjct: 136  TIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMNKLSQD 195

Query: 199  LSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLREH 258
            L       E LE++L  K+ + + Y    Q+++                    N +L++ 
Sbjct: 196  LKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSENDALKKE 255

Query: 259  NARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSD----LEL 314
            N  ++++L  +   V++LT+  N+EK+E  +E+SLK+ ++D+L+ QVQ L+ D    L  
Sbjct: 256  NRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQDDYTRILNT 315

Query: 315  RSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSA 374
            +    + D+       N   EEL QK   L E+E ++ K  +  +++    + S L +  
Sbjct: 316  KQPIVQNDEER-----NLEVEELKQK---LIETETQLNKELEERRNITMQTESSTLSNQQ 367

Query: 375  HEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLE 434
             E          D+  +K+++I E+ QKE LQNQVE F+VELE KVP ++SFK R DMLE
Sbjct: 368  QE----------DLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLE 417

Query: 435  EQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQAS 494
            ++L +   +LE++ ++K  V  +L   +      + +   LT+QR+DLA Q+QY+LI  S
Sbjct: 418  KELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTS 477

Query: 495  VRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTI 554
            V++DS GPL+ EE+ F++ IL+        D+Q+VISERLV F++IVELQ KN DLL+++
Sbjct: 478  VQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQVISERLVTFQNIVELQQKNIDLLKSV 537

Query: 555  RNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKAI 614
            R LA KLE +EE  +  S+ VE  AI EAKEAII+LQ +  +LE +I+ L  E D YK++
Sbjct: 538  RELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSL 597

Query: 615  -QPSTNNGNKI-TEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQK 672
             +P T    K+ TEH   N +   +  + +LE  L T REE+ K    LN+EI ++ R  
Sbjct: 598  PKPDT----KVETEHLRLNEEN--TDLIKELETRLATSREESNKTFASLNNEIDDIRRNH 651

Query: 673  TKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQETL 732
            ++   E + ER S+ LAE+RLK+ Q SL L+K ENE+L KR  I+QD  LKQD +TQETL
Sbjct: 652  SQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETL 711

Query: 733  SCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXXXXXXXG 792
               + C+  L+  ++EL    +++    + +K   + I  ++ ERN              
Sbjct: 712  KEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQT 771

Query: 793  ERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLN 852
            ER+++   T+   + ++D +E E   +  +L  KD E  +      S  +WYQ KID++ 
Sbjct: 772  EREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIK 831

Query: 853  ETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRME 912
            E       +L  +     +L  + K L+  L+  E++  +Y VLN +D+V  + E L+ E
Sbjct: 832  EKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNE 891

Query: 913  LEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDELVGQ 972
            LEKSKI L +AY+++++++      EE L    N  E  K E  +    ++K  DEL+  
Sbjct: 892  LEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDT 951

Query: 973  VEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQD 1032
               L  QI++LNNEL HQ K    EK+E+  +L  L +    +  +   YE +L  L  D
Sbjct: 952  KSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQND 1011

Query: 1033 LNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDES 1092
            L QQA++AN AQ NYEQELQ+HA+++KTISQLRE++  Y+ +   +Q++    E+ L ++
Sbjct: 1012 LEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKN 1071

Query: 1093 DGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSE--PQEKVRE 1150
            +  W  Q++ YE Q+ +L +RIEDL+ QN LL DQ+DL +K  NS   QS   P E   +
Sbjct: 1072 EKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNE---D 1128

Query: 1151 LITSLRRERDILQTKLEVSKRSETVSLR-KLEAIEQELSFAKEEXXXXXXXXXXXXIMAD 1209
            L+ SLR +RDILQT+L V++  E  +LR KL ++  EL+  + +            I  +
Sbjct: 1129 LVLSLRSDRDILQTRLSVTEE-EGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVE 1187

Query: 1210 EHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXXXXXXXXKRS 1269
            EH+            RESNITLR+E     ++ ++L+  ++                K  
Sbjct: 1188 EHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEV 1247

Query: 1270 VRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSE 1329
            ++  + Q++   EE NRWKQRSQDIL+K ++IDP EH+KL  E++  K  LA K  +N E
Sbjct: 1248 IKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEE 1307

Query: 1330 LEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQR 1389
            L DRF R+KKQA ERL+++KA Q  L  ++ Q  +  ++++  L  E+   +  +E  ++
Sbjct: 1308 LNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQ 1367

Query: 1390 VESEAKADSTTQPELESAL-------QKLSQAEKKAQDIESDRAQIEKALQSELEKVKSH 1442
            +  +++  +  + +LE AL        K + + K + +I S    +  +L +EL  +K  
Sbjct: 1368 MNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKES 1427

Query: 1443 XXXXXXXXXXXXXXXXSLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEE 1502
                              E    G    S+ +E+MK+  EE     + ++  E +    E
Sbjct: 1428 KNN---------------EATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAE 1472

Query: 1503 --LRLKEKATYEKELEENGKHTPV-DIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLP 1559
               R++ +AT      +N   TP+ DI   ++QWE++YE+  +KRIE++ E L++RIRLP
Sbjct: 1473 EVKRIEAQATD----TQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLP 1528

Query: 1560 TEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLT 1619
            TEEKIN +++ +K+ELE+E++ K+ +RA EL + + +  +F E +K        +K +L 
Sbjct: 1529 TEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSE-ENKTFIEDLKND------IKKELE 1581

Query: 1620 REMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASG 1663
            R +D+E+   + KAF+EGKQQA MK+ FLEKKI+KLE+Q++ S 
Sbjct: 1582 RNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSN 1625

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/1731 (33%), Positives = 952/1731 (54%), Gaps = 103/1731 (5%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            F      ++ ++D  ++  +  K  +F +L++ENL+ +V+ DEL+++S +K+   K ++ 
Sbjct: 27   FFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKTEME 86

Query: 82   LLLQELESLRGE----SAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKN 137
             +L++ + +R E    SA+FE     L +EK +  N+ E+++ +   L ++K+ ++S++ 
Sbjct: 87   NVLRQNDEIRKERNDTSAKFEF----LQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQ 142

Query: 138  DVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQ 197
               ++L+E++ E+   K E +    E R LR   ++LE++ +   + DL  ++EL R +Q
Sbjct: 143  RTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQ 202

Query: 198  ELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLRE 257
            EL+L +SN +WLE +L  K+ ++ +YR  T + ++                   N  L++
Sbjct: 203  ELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQ 262

Query: 258  HNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRST 317
             N  ++N L+ ++ ++K L+D+LN+EKQEF+ E++LK+RL+DLLE Q+ ++K   EL+S 
Sbjct: 263  KNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKE--ELKSI 320

Query: 318  AGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKES-RLKSSAHE 376
                     S+    L          + E+E  ++ L  T + L   + E  RL S   E
Sbjct: 321  RKSDSSNVTSDDSRKL----------ISENESLLKDLRLTKEKLAQCESECLRLSSITEE 370

Query: 377  YPASVTDLYG----DISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDM 432
                   L      D  LLK+Q I EKR KE LQNQ+E+F+VELE KVP+++SFK+R DM
Sbjct: 371  TGEESGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERTDM 430

Query: 433  LEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQ 492
            LE +L  +A +LE  S +K +   +L     +I   E  I  LTRQR DL RQVQYLLI 
Sbjct: 431  LENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLIT 490

Query: 493  ASVRSDSKGPLTTEEIAFVRRILEQGDLS--LERDTQKVISERLVEFRDIVELQSKNSDL 550
             SV +DSKGPL  EEI F++ IL Q D S   E D+QK+++ RLVEFR+++ELQ KN++L
Sbjct: 491  NSVSNDSKGPLRKEEIKFIQNIL-QNDNSGTTESDSQKILTGRLVEFRNVIELQEKNTEL 549

Query: 551  LRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDA 610
            LR  RNLADKLES E +SK     +EN  I EAKEAI++LQ     LES++E L +ER+ 
Sbjct: 550  LRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEELERERET 609

Query: 611  YKA-IQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELL 669
             K+ I    ++ N      L  +K ++ ++V DL+  +     E+ +NM +LN EIQ++ 
Sbjct: 610  LKSSISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLNKEIQDIY 669

Query: 670  RQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQ 729
              K+ ++IE+ KE++S+ LAEER K+   +L LTK EN++L KR   +Q ++ KQD+KT 
Sbjct: 670  DSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTH 729

Query: 730  ETLSCLIECQSKLATLESELKS----SVAKIESLSSCQKKNTESIEQLTAERNNXXXXXX 785
            ETL+  I C+SKL+  E+ L +       KI+S  S +++    +++L++E+ +      
Sbjct: 730  ETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQE----LDKLSSEKTSLRIMVT 785

Query: 786  XXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQ 845
                   ER+ LL E  KS + K++ +E   ++L+ + S KD+      + N S+ +WYQ
Sbjct: 786  QLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQ 845

Query: 846  EKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQ 905
             KI++L +    V + +  +      L+ + K LE  ++E + +  +Y+V+++T      
Sbjct: 846  NKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDET----IN 901

Query: 906  TEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKK 965
             ++LR ELE SKI L +AYSQI+E++  Y+S  ++L  + +  +      S    ++  +
Sbjct: 902  DDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDE 961

Query: 966  EDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQ 1025
            +  L  +V  LK Q  NLNNEL  QK + + +K E +  +  LQ+  + + ++K  YE +
Sbjct: 962  KINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESK 1021

Query: 1026 LGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQL 1085
            L K+  DL+QQ  +AN AQ NYEQELQ+HADVSKTIS+LRE+   Y+ Q   L  S  +L
Sbjct: 1022 LSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSEL 1081

Query: 1086 EKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQ 1145
            E  L E++  W +QK+    QL   N RIEDL+ QN LL +Q++L     N  +G +   
Sbjct: 1082 ENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNG-VGDARNG 1140

Query: 1146 EKV-RELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXXXXXXXX 1204
              +  +++ +LRRERDIL TK+ V++R   +  +K+  ++ EL  A+ +           
Sbjct: 1141 PTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDER 1200

Query: 1205 XIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXXXXXX 1264
              +  +H+            RESNITLR+E++  +++ +EL+ ++               
Sbjct: 1201 SSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELS 1260

Query: 1265 XXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKA 1324
              K S++ K+ +I L  EE +RWK+RSQDIL K +++   +++KL  E+   KA+L  K 
Sbjct: 1261 ALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKM 1320

Query: 1325 DQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQ 1384
             Q +E E+RF RL++QA+E+L  +K  Q  L+ +L + ++A+  +E   R   D N  +Q
Sbjct: 1321 QQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALE---RSLNDANTRIQ 1377

Query: 1385 ESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHXX 1444
            E    +E E  A+   + E+    Q+   AEK ++++E    +   +  S + K+     
Sbjct: 1378 E----LEGEKVAEDNNRSEMIKRSQE--DAEKSSRELEEKLEENAISYSSTVRKLNEEIA 1431

Query: 1445 XXXXXXXXXXXXXXSLEEVKQGAFTDSSEL-EKMKRDLEEHSNTLIAEKEAEIRSHYEEL 1503
                           L+        D S + E MK+  EE     I EK  E+    +E 
Sbjct: 1432 TLKEEIEKQGQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEKTREVNKKIQEA 1491

Query: 1504 RLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEK 1563
            +           E   + + V+I+ +KKQWE ++E++  +R+ E+ E L+KRIRLPTEEK
Sbjct: 1492 Q-----------ERLNQPSSVNIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEK 1540

Query: 1564 INKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQE------------- 1610
            I+KI+E +K +LE+EF  KL+++   ++  +   A   + ++   QE             
Sbjct: 1541 ISKIIERKKEDLEKEFNEKLEEKVKSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKL 1600

Query: 1611 MEKLK---------------------ADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLE 1649
             EKLK                     A L  E+++E+  V+KK+F+EGKQQA+MK+  LE
Sbjct: 1601 QEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLE 1660

Query: 1650 KKIAKLEAQ---VKASGTEAVPSAPTSKNSPTEKPVRILE--ASPLEDALS 1695
            +K+AK+E+Q   +K S       A    N     P +I E   SP    LS
Sbjct: 1661 RKLAKMESQLSEIKQSAESPPKHANNVPNPLLGLPRKIEENSNSPFNTLLS 1711

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/1707 (31%), Positives = 914/1707 (53%), Gaps = 82/1707 (4%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            FL +E + + ++   +   I +KA EF QLQ++NLRT+V ++E +++   K    K+++ 
Sbjct: 12   FLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKEELD 71

Query: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVAR 141
             ++++   +R E+    +    L +     L +   L+   E L+           ++  
Sbjct: 72   YVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERYKELNG 131

Query: 142  LLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSL 201
              +EK++EL   + E  +L  + + L  + L+LE + +  +S +L RK+EL R +QE+ L
Sbjct: 132  SYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELERNAQEILL 191

Query: 202  CRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLREHNAR 261
             R N EWLE +L  KN  F  YR  T   +                   + + L +    
Sbjct: 192  LRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSSKEILSKKLDE 251

Query: 262  ITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEG 321
             T  L+  L   K L D L  EKQEF +E+S+K++L+ L E Q++SL+S L+ +    E 
Sbjct: 252  TTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQKFKTAEA 311

Query: 322  DDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHEY---- 377
            ++ + S  + +L EEL+   ++L++ E K  +LE ++ D  S D   + K     Y    
Sbjct: 312  NEENSSEVVKSLKEELSLAERKLQDMEEKCVRLE-SILDHDSNDVSLQTKGRKRTYSNDS 370

Query: 378  --------------PASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPML 423
                            S++ + GDI +LKRQ++ EKRQKE LQNQVE+FV+ELE K+P++
Sbjct: 371  NSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVI 430

Query: 424  SSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLA 483
            +SF++R  +LE++L +TA +LE  +K+ E    +L+  K +I D   Q+  L RQR+DLA
Sbjct: 431  NSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLA 490

Query: 484  RQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVEL 543
             Q+QYLLI  S+ +D+   L  +EI F++ ++   +++   D+QKVISE L++F+DI +L
Sbjct: 491  HQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQL 550

Query: 544  QSKNSDLLRTIRNLADKLESEEEQSKMRSKTV---ENDAIREAKEAIITLQEHAQELESR 600
            Q KN +L++T+R LA +LE  EE+ K  S      +N+   EAKEAI+TL++  + LE  
Sbjct: 551  QEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAILTLEKVNENLEKN 610

Query: 601  IEVLTKERDAYKAI-----QPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAE 655
            ++++TKERDA+K +     + +  + N +  H     K      V DLE  L     ++ 
Sbjct: 611  LQIVTKERDAFKLLVSEDRERNFKSSNSV--HKYHELKSYNETVVKDLENRLTQLTNDSN 668

Query: 656  KNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYH 715
             + K L  E+  L ++ ++L ++IEK R++K LAEERLK++Q S++L  +ENE+L  R  
Sbjct: 669  AHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSS 728

Query: 716  IIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTA 775
             ++D+LL+QD +TQ+T S  +E  SK ++LE+ +++   ++  L   +      +   T 
Sbjct: 729  RLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTE 788

Query: 776  ERNNXXXXXXXXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQ 835
            E+               ER+ LL   +  +K+++  +     +L  QLS +  E +   +
Sbjct: 789  EKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEK 848

Query: 836  TNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDV 895
              +++ +WYQ+KID  ++  + +  QL+++      L  Q K LE  L+  + +  +Y+ 
Sbjct: 849  ERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELEGAQIRIHTYET 908

Query: 896  LNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEH 955
            +NQ +    +   +  ELEK+KI+L DAYSQ+EE ++  +++E+AL  +  +F     ++
Sbjct: 909  INQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDY 968

Query: 956  SKDFGNMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETM 1015
                  + +++ E+ G+ E LK Q+ N+ NEL  Q ++ +SE+  L   +  LQ   + +
Sbjct: 969  RDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQPI 1028

Query: 1016 NSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQA 1075
              +K+ +E++L KL  DL +Q  +AN AQ+NYEQELQRHADVSKTIS+LRE++Q+ KN  
Sbjct: 1029 EEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDT 1088

Query: 1076 SVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDL----E 1131
              L + ++ L+  + +++    ++++EY  Q+    QRI+D+T QN LL +Q+DL    E
Sbjct: 1089 KSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAE 1148

Query: 1132 AKDPNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAK 1191
            + + NS   ++        L+ SLRRERDIL TK+ V +  +    +KL+ I+ EL   K
Sbjct: 1149 SVNENSSDDEANGSTA---LVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTK 1205

Query: 1192 EEXXXXXXXXXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDN 1251
                           + + +             RESN+TLR+E+++      ++   +  
Sbjct: 1206 RSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQI 1265

Query: 1252 XXXXXXXXXXXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGE 1311
                              ++ KD +I+  ++E+ RWK R ++++ K ++++ +++ KL E
Sbjct: 1266 CRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEE 1325

Query: 1312 ELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMEL 1371
             L++ K  L  K  + +EL DRF RLKKQA E+L+ +K +Q++L  +++     + ++  
Sbjct: 1326 TLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRK 1385

Query: 1372 QLRKEQDVNKALQESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKA 1431
            QL  + + N  L   L     +       Q +LE+  ++L++   K++++E         
Sbjct: 1386 QLDVKTEENSELLSELNNFREK-------QNDLETLREELNKEISKSEELEV-------K 1431

Query: 1432 LQSELEKVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSE-----LEKMKRDLEEHSN 1486
            LQ+E+E                      L+       TD+ E     +E +KR+ E    
Sbjct: 1432 LQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQKT 1491

Query: 1487 TLIAEKEAEIRSHYEELRLKEKATYEKELEENGK---HTPVDIETLKKQWEEDYEQKTIK 1543
              IAEK  E         ++E      E +EN K      VD+E L+KQWEED E+   K
Sbjct: 1492 KFIAEKTEEFNKRL----IEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQK 1547

Query: 1544 RIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEV 1603
            RI E+ + L+KRIRLP+EEKINKI+E R+SELE EF+ K++ +A +L            +
Sbjct: 1548 RIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDL------------L 1595

Query: 1604 MKRHKQEM-----EKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQ 1658
            M  H  E      E L+ +L    ++E+   RKKAF+EGKQQA+MK+  LE+KI KLE+Q
Sbjct: 1596 MNDHSNEFNNELKEALEKELKERFEDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQ 1655

Query: 1659 VK---ASGTEAVPSAPTSKNSPTEKPV 1682
            ++       E     P   ++P+ K +
Sbjct: 1656 IQEKEKDSEETQDVKPEENSTPSVKKI 1682

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/1706 (31%), Positives = 913/1706 (53%), Gaps = 78/1706 (4%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            FL    + +  +D  ++ ++  +  EF  ++ E ++ S  ++  + ++   +   K+++ 
Sbjct: 27   FLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVTKKTNNTTIKKLKNELT 86

Query: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVAR 141
             L+   ES+  E     K   E   +K    ++ E+  ++  +LE+    L+S K ++ +
Sbjct: 87   ELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQIHSLEENVSELQSKKQELIK 146

Query: 142  LLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSL 201
             L+++I+EL+ ++   + L  E  + R + L LE+E++  K  DL ++ +L RLSQEL  
Sbjct: 147  SLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQELET 206

Query: 202  CRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLREHNAR 261
                  WLE +LG+K  +F++YR  + ++                    TN  L+E    
Sbjct: 207  INKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQERTDE 266

Query: 262  ITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSD------LELR 315
            ++N L     N+K +  + N++K    +E++LK++L+ +L+ Q+  L+ +      L + 
Sbjct: 267  LSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSLTVS 326

Query: 316  STAGEG-DDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSA 374
             TA     D  F+  +N L  +L    ++  E EFK++K E       ST        S+
Sbjct: 327  DTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVSNST--------SS 378

Query: 375  HEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLE 434
             +   S+   Y DI +LK+++  E+ Q+E+ +  +E F+ +LE+++P L +++ R    E
Sbjct: 379  DDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLEAYRHRAAARE 438

Query: 435  EQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQAS 494
            E+L E   +LE  +K+K  V+ +L + +++I   E +I  + +QRSDLA Q+Q+ L+  S
Sbjct: 439  EELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNS 498

Query: 495  VRSDSKGPLTTEEIAFVRRILEQGD--LSLERDTQKVISERLVEFRDIVELQSKNSDLLR 552
            V +DS GPLT EE+ F+R I+++ D     E DTQKVISERL +F+DI+ELQ KN +LL+
Sbjct: 499  VANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLK 558

Query: 553  TIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYK 612
            T R LA KLE E++  +     +E + I EAKEAI+TLQ +   L ++I  LTKE + YK
Sbjct: 559  TTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKIAALTKELETYK 618

Query: 613  AIQPSTNNGNKI----------TEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLN 662
             +  + ++               EH         +  V +LE  + +  +E+++N  +LN
Sbjct: 619  VLSNTEDSSTPADFDKQREQREIEH---------TQLVKELETRIASIIQESKENANILN 669

Query: 663  SEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLL 722
             +I  L  +   ++IE+ +E+++K LAEERLK+ Q S+ +T  ENE L KR + +++ ++
Sbjct: 670  DKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVV 729

Query: 723  KQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNXXX 782
            +QD +T ET++ LI+ +S+LAT+E++   S  +I+ L S ++     + +L  E+N+   
Sbjct: 730  EQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKL 789

Query: 783  XXXXXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQ 842
                      ER+ LL+ T+  + ++++ LE   + LR +L   +E +   ++       
Sbjct: 790  LVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKD 849

Query: 843  WYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDV 902
             +++K  SL E +  V  +     +  R+ + +   L  +LKE     + Y   +  +  
Sbjct: 850  DFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYKAASDDEGK 909

Query: 903  LAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNM 962
            L +  +L+ EL+  K +L ++YSQ E +R   +   ++++ I       +    +    +
Sbjct: 910  LEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEV 969

Query: 963  KKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHY 1022
            +  ++ +      LK QI +LNNEL  QKK ++ EK         L+   + +   K  Y
Sbjct: 970  ELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDY 1029

Query: 1023 EQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSI 1082
            E +L  L +DL +Q  +ANKAQ NYEQELQ HA+VSKTISQLRE++Q Y+ + + L  S 
Sbjct: 1030 EDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISA 1089

Query: 1083 EQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQ--LDLEAKD-PNSEL 1139
               ++ L+E+   W  Q++EYE Q+    +RIE+ + QN +L +Q  L  +A D  N+E 
Sbjct: 1090 TDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAES 1149

Query: 1140 GQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXXX 1199
                  E   +L+ SLR ERD+LQ +L V++  E +   +L +IE++      E      
Sbjct: 1150 SGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKE 1209

Query: 1200 XXXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXX 1259
                   + ++H             RESNITLR+E  +   + Q L+ +++N        
Sbjct: 1210 ETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPL 1269

Query: 1260 XXXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAE 1319
                      +  KD Q+S+  EE+ RWKQRSQDILSK++RIDP EH+ L EE ++ +A+
Sbjct: 1270 ETELQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQ 1329

Query: 1320 LAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDV 1379
            L  K+ +N EL +RF++LKKQA E+L+A+K  QN+L++++      +  +  QL  E++ 
Sbjct: 1330 LEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEG 1389

Query: 1380 NKALQESLQRVESEAKADSTTQPELESALQKLSQAEKK-AQDIESDRAQIEKALQSELEK 1438
              +L++ L+     +    + Q +LE AL K    E K    +ES + QIE+ L SE++K
Sbjct: 1390 KLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSK-QIEENLNSEIKK 1448

Query: 1439 VKSHXXXXXXXXXXXXXXXXSLE-------EVKQGAFTDSSELEKMKRDLEEHSNTLIAE 1491
            ++                  + E        V  G   D   +E MK+  EE     I E
Sbjct: 1449 LQEESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDI--VESMKQSFEEEKIKFIEE 1506

Query: 1492 KEAEIRSHYEELRLKEKATYE-KELEENGKHTPVDIE--TLKKQWEEDYEQKTIKRIEES 1548
            +  E +   +    K KA YE K++E      PV I+   ++KQ EE+YEQ T +RI+E+
Sbjct: 1507 QTTEFKKKLQAEINKLKAEYETKQIE------PVSIDENAIRKQIEEEYEQATSQRIKEA 1560

Query: 1549 NEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASEL--ANEKPQPASFTEVMKR 1606
             E L++RIRLPTEEKINK+++ R+++LE EF+ K++ RA EL   +EK +   F + MK+
Sbjct: 1561 EENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNE---FFDRMKK 1617

Query: 1607 HKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVK--ASGT 1664
              QE      +L R+ +EE+  V+KKAFDEG+QQ  MK+ FLEKKI KLE+ ++   S T
Sbjct: 1618 EIQE------ELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNT 1671

Query: 1665 EAVPSAPTSKNSPT------EKPVRI 1684
             A  +   S ++ T      +KPV I
Sbjct: 1672 GATDNTIVSTDNETKYEGSDKKPVTI 1697

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  444 bits (1141), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 368/1237 (29%), Positives = 642/1237 (51%), Gaps = 51/1237 (4%)

Query: 188  RKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXA 247
            R++E+ RL QE++    N   L  Q  ++  EFN  +   +  L               +
Sbjct: 166  RESEIQRLKQEVTFLNENKSSLSEQWLKEKEEFNKAKLLLEKNLNNSTIKLEEATTTLKS 225

Query: 248  STRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQS 307
                   L + N  +T   E  +  +K L DNL   K +  +E+++K +L+DLL+GQ+ S
Sbjct: 226  MEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSS 285

Query: 308  ----LKSDLELRSTAGEGDDGSFSN-PLNALSEELAQKTQQLEESEFKVQKLEQTVQDLV 362
                L+ ++EL S   +  D    N  L +  ++L  K ++L+   F +  +    Q   
Sbjct: 286  TQEELRQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNLNSM--INQMSN 343

Query: 363  STDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPM 422
              +  +   S     P     LY  I+LLK+QV  EK +K+HLQ Q+E+F++ELE+K+P+
Sbjct: 344  EQNNSNNSSSIDSNLPT----LYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPI 399

Query: 423  LSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDL 482
            +SSF+++N  LE +L     +L   S +K ++   L    +++  ++  I EL RQR DL
Sbjct: 400  ISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDL 459

Query: 483  ARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQG-DLS-LERDTQKVISERLVEFRDI 540
            A QV++LL+  +V++DS GPLT EEI F+ +I     DL+  E  +Q VISERLV F +I
Sbjct: 460  ANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNI 519

Query: 541  VELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESR 600
             ELQ+KN +LL +IR+L++ LE+ E  +    K  +N  I +AKEAI+TLQ H   LES+
Sbjct: 520  EELQAKNMELLNSIRSLSENLENIENAN--SHKEFQNKTIADAKEAILTLQYHNDILESK 577

Query: 601  IEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLERS------LVTE-REE 653
            ++VL  ERD++K +     N N   + ++ N     S   +  E+S      L+ E + E
Sbjct: 578  VKVLEAERDSFKLLL----NNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAE 633

Query: 654  AEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKR 713
             +KN   L S+I      K+ L I +EKE++S  L  E++ +++ +  + K EN+ELNKR
Sbjct: 634  LKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKR 693

Query: 714  YHIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIES---LSSCQKKNTESI 770
            +  +Q+ ++KQ++K  + ++  I  +++++ L+++L  S+AK E    + S    N+E I
Sbjct: 694  FENLQNIIIKQESKLGDIINKYITGETEISNLKTQL--SIAKSEKDFLVKSQDSLNSELI 751

Query: 771  EQLTAERNNXXXXXXXXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEF 830
             + + E+N              ER  LL +T+K +  K+  LE     L   L  K  E 
Sbjct: 752  -KTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEI 810

Query: 831  NDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKA 890
                 +N+S+  WYQ  ID L +    + ++L S+     DL ++ +LLE +   ++T  
Sbjct: 811  QKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQSYTIDTNT 870

Query: 891  QSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFER 950
            +     N    +         +L+ +K+ L +AY+Q+EE++  Y S EE+L  + + FE 
Sbjct: 871  RCSSSGNDFSQI-------SKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFES 923

Query: 951  FKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQS 1010
             KN        +  + + L         +IS L+ +L ++K ++  E  +L  Q+  L  
Sbjct: 924  VKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNK 983

Query: 1011 TQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQK 1070
             ++        YE+++ KL   L  +A FA+ AQE YE  L +     ++I + +E+ +K
Sbjct: 984  FKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEK 1043

Query: 1071 YKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDL 1130
               +  +++S +E+    L E++  W  +++ + + L    ++I++LT QN L +DQL+L
Sbjct: 1044 LNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLEL 1103

Query: 1131 EAKDPNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFA 1190
              KD +S        E  + +   LR +RD+L+TKL +++R    +  KLE++  EL+  
Sbjct: 1104 LNKDFSSMDSSQLSSE-TKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANV 1162

Query: 1191 KEEXXXXXXXXXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQID 1250
            + +             + + H K           +ESN TLR++V +  ++ + L+ +++
Sbjct: 1163 QMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLN 1222

Query: 1251 NXXXXXXXXXXXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLG 1310
                            K S+  K++ I LI EE+N+W+ R++++  + +++D +   KL 
Sbjct: 1223 EENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLS 1282

Query: 1311 EELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNME 1370
             EL   K +   K  QN+ELE+RF  LKKQA ERL+A+K +Q++L+ ++ + + + +N+E
Sbjct: 1283 TELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIE 1342

Query: 1371 LQLRKEQDVNKALQES-----------LQRVESEAKA 1396
            L L  EQ  +  LQ +           L  +ESE KA
Sbjct: 1343 LALSSEQKKSMDLQNTLSDNEVKYTQKLSNIESELKA 1379

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  441 bits (1134), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 463/1618 (28%), Positives = 801/1618 (49%), Gaps = 167/1618 (10%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            +L + S  L  V+  ++  +  +  +F++ + E  R +V +DE++S           Q +
Sbjct: 8    YLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKS-----------QYY 56

Query: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRK-EALEQQKQALESSKNDVA 140
              + +L  L GES++ + +  +  S     L +  +   RK +AL +Q   L +SKN + 
Sbjct: 57   TRISKLNELLGESSEEKNVSKKELSRLHNLLKNERSKCARKIDALNKQ---LNASKNTIT 113

Query: 141  RLLNEKI----SELSSFKQEADDL-----MQENRRLRQQTLDLESESRVSKSEDLQRKAE 191
            +L +E+     +E+   + + +DL       EN+ LR++ L++E+  +  KS  L  K +
Sbjct: 114  KLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLK 173

Query: 192  LHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRT 251
               + QE  L   N +W+E QL  ++ +      T  S +               + +  
Sbjct: 174  YDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTN 233

Query: 252  NKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSD 311
            N+ L   N ++++ +E ++  +K L D +N EK +F++EM+L++ + DLL  Q+ S + +
Sbjct: 234  NQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKN 293

Query: 312  LELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLK 371
              L +   + DD   ++    + ++L     QLE+S+ + Q+L+  V D +  D+ +   
Sbjct: 294  YSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAF-- 351

Query: 372  SSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRND 431
             + H    SV  ++ DI  LKRQ+I E+ QK  LQNQ+E+F+ ELE K P L SFK+R +
Sbjct: 352  DNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTE 411

Query: 432  MLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLI 491
             LE++L  +  +LE+IS  K     +L   + +I++ E  I  L +QR DLARQV+ LL+
Sbjct: 412  SLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLL 471

Query: 492  QASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLL 551
              S       PL+ +E+  ++++LE GD+  E+D+Q +I+ERLVEF +  ELQ KN +LL
Sbjct: 472  NISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELL 531

Query: 552  RTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAY 611
              +R LADKLE+ E +       +EN  I+EAK+AII L+     LESRI++L++ERD+Y
Sbjct: 532  NCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSY 591

Query: 612  KAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQ 671
            K +  ++ NGNKI   A   ++     ++ +LE  L   + E    ++ LN E+    + 
Sbjct: 592  KLL--ASANGNKIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKS 649

Query: 672  KTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQET 731
            ++   I +++    K LA E+  +              L  R   ++  L KQ +    +
Sbjct: 650  QSNGQIALQEFSNFKVLAIEKENL--------------LQTRIDDLKTKLEKQRSSAPSS 695

Query: 732  LSCLIEC-QSKLATLESELKSSVAKIESLSS------CQKKN-TESIEQLTAERNNXXXX 783
            +   I   +++L+  +++ KS + +I +LS       C K++ T  +E+   E+      
Sbjct: 696  IHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMK 755

Query: 784  XXXXXXXXGERDKLLAETEK-SYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQ 842
                     E+ KL +++++  Y  K+  LE    +L  +L  K +E      + +S+ +
Sbjct: 756  LTESETSHNEQ-KLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQTSKNSQLK 814

Query: 843  WYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDV 902
            W Q  ID   + +K +++ L  +  T R L  + K LE  L+  +TK Q Y +LN + D 
Sbjct: 815  WAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQ--KTKLQ-YKLLNNSSDA 871

Query: 903  LAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNM 962
                 AL+ ELE+S+I L+DA+SQIE +       EE +S   N  +   ++ +K    +
Sbjct: 872  NTLETALKKELERSQIDLKDAHSQIEAY-------EEIISTDENTLKELNDQLTKTKEEL 924

Query: 963  KKKEDELVGQVEALKHQISNLNNEL----GHQKK------QFDSEKNELENQLVSLQSTQ 1012
            K K   L  +  A + +IS L  EL    G Q K      +   +  +L NQ   +Q+  
Sbjct: 925  KVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGALRLVQQSEKLGNQTQRIQAMN 984

Query: 1013 ETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYK 1072
            E ++ M    E         L+Q+   +      Y+ +L+ + D+S  + +L  E   Y+
Sbjct: 985  EKIDKMTTIVE---------LHQEVETS-----QYQAKLKANKDLSALVLRLENEVLDYQ 1030

Query: 1073 NQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEA 1132
             +    +SS+   ++ LD+ + KW+ +K +YE +L S  ++ E L V+N  L++++D   
Sbjct: 1031 TELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVEKID--- 1087

Query: 1133 KDPNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKE 1192
             D   E    +   K+  L +SLR ER+ L+TKL   KR   ++ +K   +E+ ++  ++
Sbjct: 1088 -DGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQ 1146

Query: 1193 EXXXXXXXXXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNX 1252
                          + DE              +E+N  L+  ++K T++ + +  +  + 
Sbjct: 1147 THLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSL 1206

Query: 1253 XXXXXXXXXXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEE 1312
                          K  V    +++ +   E  +WKQR  ++  + +    +E +KL  E
Sbjct: 1207 QYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNE 1266

Query: 1313 LSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQ 1372
            +S  KA+L    + N++L D+F RLKKQA E+LDA+K  Q  L+ E+ + ++ ++ +E  
Sbjct: 1267 ISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMKNELEES 1326

Query: 1373 LRKEQDVNKALQESLQRVESEAKADSTTQPELESALQK-LSQAEKKAQDIESDRAQIEKA 1431
            L  E+   K L                   ELE+ L+K L QAE  ++D E D +   K 
Sbjct: 1327 LHSEES--KVL-------------------ELEAKLKKHLVQAEGVSKDQEEDTS---KP 1362

Query: 1432 LQSELEKVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSE-LEKMKRDLEEHSNTLIA 1490
            L  E+E +K                   L+  K+ +  DSS+ +EKMK  +E   N +I 
Sbjct: 1363 LMEEIELLKRE-----------------LQVFKETS--DSSDTIEKMKEIMEAEKNKIIE 1403

Query: 1491 EKEAEIRSHYEELRLKEKATYEKELEE-NGKHTPVDIET------LKKQWEEDYEQKTIK 1543
            EK  E               +E++LEE  GK+T   IE       LKKQW + YE++T++
Sbjct: 1404 EKTTE---------------FERKLEEATGKNTGATIENGENMEELKKQWLKQYEEETMR 1448

Query: 1544 RIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFT 1601
            RI+E+ E L+KRIRLP+EE+I KI+  RK ELEQEF+ KL          K    SFT
Sbjct: 1449 RIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKL----------KANSGSFT 1496

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  422 bits (1084), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 448/1622 (27%), Positives = 792/1622 (48%), Gaps = 184/1622 (11%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            FL +    L  ++  V+  +  K   F+  + E  R +V VDE++S           Q +
Sbjct: 8    FLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKS-----------QYY 56

Query: 82   LLLQELESLRGESAQFEKM-KLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVA 140
              + +L  L  ES++ + +   EL+  + + + D E  R + +AL +Q   L+SS++ + 
Sbjct: 57   SRISKLSKLLNESSEQKNIASKELSHLQDQLMQDRERCRRKIDALNKQ---LDSSRDAIK 113

Query: 141  RLLNEKISELSSFKQEA---------DDLMQENRRLRQQTLDLESESRVSKSEDLQRKAE 191
            RL +EK ++  S  +++         + L +EN+ LR++ +++E+  ++ KS  +  + +
Sbjct: 114  RLNDEKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLK 173

Query: 192  LHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRT 251
               + QE  L   N +W E +L   N +  A   T  S++               ++   
Sbjct: 174  YDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSY 233

Query: 252  NKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSD 311
            ++ L + N ++++ +E ++  +K L D    EK EF++EM+L++ + DLL  Q+ S + D
Sbjct: 234  SQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERD 293

Query: 312  LELRSTAGEGDDGSFSNP-LNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRL 370
                   G+ DD    +P  N +++EL     Q ++S+ + Q+L+  + D V  DK +  
Sbjct: 294  -HSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVD 352

Query: 371  KSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRN 430
             + A     +V  L+ DI +L++Q+I E+ QK  LQNQ+E F++ELE K P L SFK+R 
Sbjct: 353  TNGASH---TVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERT 409

Query: 431  DMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLL 490
              LE +L  +  +LE+IS  K     +L   + +I+  E  I  L +QR DLARQV+ LL
Sbjct: 410  KSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLL 469

Query: 491  IQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDL 550
            +  S    +  PL+ +++  +R+ILE G    E D Q +ISERLVEF +I ELQ KN +L
Sbjct: 470  LNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVEL 529

Query: 551  LRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDA 610
            L  IR LADKLE  E +       VE   I+EAK+AII L+    ++ESRI +L +ERD+
Sbjct: 530  LYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDS 589

Query: 611  YKAIQPSTNNGNKIT----------------EHALANSKGKMSARVDDLERSLVTERE-- 652
            YK +  S  N   +                 E  L+++K + SA + +L + L T ++  
Sbjct: 590  YKLLASSKENNVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLL 649

Query: 653  -------EAEKNMKMLNSEIQELLRQKT-KLAIEIEKERTSKCLAEERLKVSQGSLKLTK 704
                   +  +N KML  E + +L  +   L  ++EK+           K+S  S     
Sbjct: 650  CDKKIASQDFENFKMLAKEKESILETRVNNLKTDLEKQ-----------KLSVPSF---- 694

Query: 705  QENEELNKRYHIIQDN-------LLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIE 757
                        +QDN       LL+  TKT+  +        ++++L+ E  +S+   E
Sbjct: 695  ------------VQDNKVRDSTELLQSRTKTEILM-------HEISSLKKETANSMVLKE 735

Query: 758  SLSSCQKKNTESIEQLTAERNNXXXXXXXXXXXXGERDKLLAETEKSYKEKVDALEVEAS 817
            SL       T  +E+   E+               E+          Y  ++  LE    
Sbjct: 736  SL-------TRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLE 788

Query: 818  QLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKK 877
            +LR +L  K +E      + DS+ +W Q  ID   E LK V ++L  + +T   L S+ +
Sbjct: 789  RLRIELKSKAQEIKSLQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIE 848

Query: 878  LLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSA 937
             L+  L+E + K   Y+ LN T D      ALR ELE+++++L+DA+SQ+  +     + 
Sbjct: 849  NLDNELRENKLK---YEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTN 905

Query: 938  EEALSAITNAFERFKNEHSKDFGNMKKKEDELVGQVEA-LKHQISNLNNELGHQKKQFD- 995
            E+AL            E +    +MK+  D    ++E   K +++N   EL   +++ D 
Sbjct: 906  EKALK-----------ELNSQLASMKEDYD---ARIELECKEKLAN-EEELSLLRRELDE 950

Query: 996  --SEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQ-DLNQQAAFANKAQENYEQELQ 1052
              S + +L+   V L    E + +  E  ++   K+ + + N Q  +  +    ++  ++
Sbjct: 951  IRSLQPKLKEGTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQ-VYKKEKTSQFQSIMK 1009

Query: 1053 RHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQ 1112
             + ++S+ +++L +E+   + +   L+SS+ + +  LD  + KW+ +K +YE +L S  +
Sbjct: 1010 ANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIE 1069

Query: 1113 RIEDLTVQNGLLLDQLD--LEAKDPNSELGQSEPQEKVRELITSLRRERDILQTKLEVSK 1170
            + E L V+N +L++++    E  D N      E   K+    ++LR ER+ L+TKL   K
Sbjct: 1070 QTESLRVENSVLIEKIGSVTEGSDGN------EDYLKLVSFFSNLRHERNSLETKLTTCK 1123

Query: 1171 RSETVSLRKLEAIEQELSFAKEEXXXXXXXXXXXXIMADEHNKXXXXXXXXXXXRESNIT 1230
            R   +  +K  ++E+ ++  + +            ++ DE N            +E+N  
Sbjct: 1124 RDLALVKQKNASLEKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAI 1183

Query: 1231 LRSEVQKKTQRCQELEGQIDNXXXXXXXXXXXXXXXKRSVRAKDSQISLISEETNRWKQR 1290
            L+  ++  T++ +E+  ++                 K  V    ++I +   E ++ KQR
Sbjct: 1184 LQKSLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQR 1243

Query: 1291 SQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKA 1350
              D+ ++   +  +  +KL  E+S  KA+L    +  +ELE++F RLKKQA E+LDA+K 
Sbjct: 1244 YHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKK 1303

Query: 1351 VQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVESEAKADSTTQPELESALQK 1410
             Q  L+ EL + +  +  +      EQD+N    ++ + V      D  T+P+ E  +Q 
Sbjct: 1304 QQTALTNELKELKAVRDKL------EQDLN---SKNFKTV------DLDTEPK-EHTVQ- 1346

Query: 1411 LSQAEKKAQDIESDRAQIEK-ALQSELEKVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFT 1469
                   + D+  D+ ++    L  E+E +K                     +V + A  
Sbjct: 1347 -------SGDLLRDQEKVASLPLIEEIESLKREL------------------QVFKNANN 1381

Query: 1470 DSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATYEKELEENGKHTPVDIETL 1529
             S   EK++ ++EE  N +I E+  E     EE+  K K+T   ++ +N ++    IETL
Sbjct: 1382 SSDAFEKLRDNMEEEKNKIINERTKEFEKKLEEIVSKSKST--GKVADNSEN----IETL 1435

Query: 1530 KKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASE 1589
            KK+W ++YE++TI+RI E+ E L+KRIRLP+EE+I KI+  RK ELE+EF+ KL++ AS 
Sbjct: 1436 KKEWLKEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASS 1495

Query: 1590 LA 1591
            L 
Sbjct: 1496 LT 1497

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  415 bits (1066), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 445/1587 (28%), Positives = 781/1587 (49%), Gaps = 128/1587 (8%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
            FL + S  L  +    +  +  K  EF++ + E  + +V VDE++S           Q +
Sbjct: 8    FLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKS-----------QYY 56

Query: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRK-EALEQQKQALESSKNDVA 140
              + +L  L  ES++ + +  ++ +  Q  L +  +   RK +AL +Q   L +S   + 
Sbjct: 57   TRISKLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQ---LNASHETIK 113

Query: 141  RLLNEKIS--ELSSFKQ--EADD-----LMQENRRLRQQTLDLESESRVSKSEDLQRKAE 191
            +L +E+ +  E SS++     DD     L +EN+ L+++ L++E+  +V KS  +  + +
Sbjct: 114  KLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFK 173

Query: 192  LHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRT 251
                SQE  L   N +W E +L   N +      T  S L               + +  
Sbjct: 174  YDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTY 233

Query: 252  NKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSD 311
            NK L + N ++++ +E +L  +K L D  N+EK EF++EM+L++++ DLL  Q+ S +  
Sbjct: 234  NKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERG 293

Query: 312  LELRSTAGEGDDGSFSNPLNA-LSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRL 370
              LR    +GDD    NP +  ++EEL     +LE+S+ + Q L+  V D +   +E+  
Sbjct: 294  HSLRPKE-KGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCI---EENGT 349

Query: 371  KSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRN 430
              + +    +V  L+ +I  LKRQ++ E+ QK  +QNQ++ FV+ELE K P L SFK+R 
Sbjct: 350  TVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERT 409

Query: 431  DMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLL 490
            ++LE +L  +  +LE++S  K      L   + +I+ +E  I  L RQR DLARQV+ LL
Sbjct: 410  ELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILL 469

Query: 491  IQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDL 550
               S    +  PL+ +E+  +R++LE  +   ERD+Q +I+E+LVEF++I ELQ KN +L
Sbjct: 470  SNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMEL 529

Query: 551  LRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDA 610
            L  IR LADKLE+ E ++      +EN  I+EAKEAII ++    +L  R+ +LT+ERD+
Sbjct: 530  LDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLALRVNILTRERDS 589

Query: 611  YKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLR 670
            YK +  ++ N NK        ++     ++ +L+  L + R E+   ++ LN ++    +
Sbjct: 590  YKLL--ASANDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKK 647

Query: 671  QKTKLAIEIEKERTSKCLAEERLKVSQ---GSLKLTKQENEELNKRYHIIQDNLLKQDTK 727
             +T   I +++    K L  E+  + Q     LK T+ E + L+    +       QD K
Sbjct: 648  SQTDGKIALQEFENFKVLVAEKEAMLQERINHLK-TQLEKQRLSAAPPV-------QDYK 699

Query: 728  TQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXXX 787
                L+ L   ++K+ +L+ E+ +   +   L + ++  T  +E+   E+          
Sbjct: 700  YS-NLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSES 758

Query: 788  XXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEK 847
                 E++ +    E  Y  ++  LE    +L  +L  K++E      + +S+ +W Q  
Sbjct: 759  ETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNT 818

Query: 848  IDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTE 907
            ID   + LK V+++L ++  T   L  + + L   L+   TK Q Y  L+ T D      
Sbjct: 819  IDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELR--MTKLQ-YKFLSNTSDTNTLEP 875

Query: 908  ALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKED 967
             LR EL++++I+L+DA+SQI       K+ EE +S   N  +          G +KK ++
Sbjct: 876  TLRKELKQTQIELKDAHSQI-------KAYEEIISTNENVLKELN-------GELKKAKE 921

Query: 968  ELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLG 1027
            +   +++    +      EL H +K+ D E   L+ +L    S     +       Q++ 
Sbjct: 922  DCETKIQLENKEKGAKEEELSHLRKELD-EIRCLQPKLREGASYLVLQSEKVGDQAQRIQ 980

Query: 1028 KLTQDLNQQAAFANKAQE----NYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIE 1083
            ++   +++ AA     Q+     Y+ EL+ + D+S+ + +L +E+  Y+ +    + S+ 
Sbjct: 981  EMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLY 1040

Query: 1084 QLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSE 1143
              ++ LD  + KW+ +K +YE +L S  ++ E L V+N +L++++D   +  NS    +E
Sbjct: 1041 STQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIDGATEGSNS----NE 1096

Query: 1144 PQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXXXXXXX 1203
               ++  L ++LR ER  L+TKL   KR   +  +K  ++E+ +   +            
Sbjct: 1097 KYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKVQC 1156

Query: 1204 XXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXXXXX 1263
              ++ DE+ K           RE+N  L   ++  T++ + +  ++ N            
Sbjct: 1157 PAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHL 1216

Query: 1264 XXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAK 1323
               K  V    +++     E  + KQR QD+  + +     E +KL   +   + +L   
Sbjct: 1217 IQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNV 1276

Query: 1324 ADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQ----DV 1379
             + N++LE++F RLKKQA E+LDA+K  Q  L+ EL + +E +  +E  L  E+    D+
Sbjct: 1277 QNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDL 1336

Query: 1380 NKALQE-SLQRVESEAKADSTT-QPELESALQKLSQAEKKAQDIESDRAQIEKALQSELE 1437
               L+E  LQ  E     DS   +P +E              +IES    ++K LQ    
Sbjct: 1337 ELKLKEHGLQVGEVSKDHDSIAFKPFVE--------------EIES----LKKELQ---- 1374

Query: 1438 KVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIR 1497
                                     V + A   S   EK+K ++EE  N +I EK  +  
Sbjct: 1375 -------------------------VFRNANDASDAFEKIKNNMEEEKNKIIDEKTKDFE 1409

Query: 1498 SHYEELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIR 1557
               ++   K K+  E E+ EN +H    IE LKK+W ++YE++T+KRI+E+ E L+KRIR
Sbjct: 1410 KKLQDAVNKSKSN-ESEV-ENSEH----IEALKKEWLKEYEEETVKRIKEAEENLKKRIR 1463

Query: 1558 LPTEEKINKIVETRKSELEQEFEAKLQ 1584
            LP+EE+I KI+  RK ELEQEFE KL+
Sbjct: 1464 LPSEERIQKIISKRKGELEQEFERKLK 1490

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  401 bits (1031), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 438/1603 (27%), Positives = 774/1603 (48%), Gaps = 149/1603 (9%)

Query: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRS-------------- 67
            FL +    L  V   V+  +  K  +F++ + E  + +V VDE++S              
Sbjct: 8    FLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQLLD 67

Query: 68   -SSERK------LGACKDQVHLLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRV 120
             SSE+K      L   KDQ++   +E    R E    +K +L ++ E  R +ND + ++ 
Sbjct: 68   ESSEQKNTAKEELNGLKDQLN---EERSRYRREIDALKK-QLHVSHEAMREVNDEKRVKE 123

Query: 121  RKEALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRV 180
              +  + + Q  +S        LN             DDL +EN+ LR++ +++E+  + 
Sbjct: 124  EYDIWQSRDQGNDS--------LN-------------DDLNKENKLLRRKLMEMENILQR 162

Query: 181  SKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXX 240
             KS  +  + +     QE  L   + + +E +L   + +      T  S +         
Sbjct: 163  CKSNAISLQLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQ 222

Query: 241  XXXXXXASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDL 300
                  +    NK L   N +++  +E ++  +K L D  + EK EF++EM+L++ + DL
Sbjct: 223  MQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDL 282

Query: 301  LEGQVQSLKSDLELRSTAGEGDDGSFSNPLNA-LSEELAQKTQQLEESEFKVQKLEQTVQ 359
            L  Q+ SL+ D  LR+   + DD S  NP +  + +EL     +LE+S+ + Q+L+  V 
Sbjct: 283  LRSQLTSLEKDCSLRAIE-KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVM 341

Query: 360  DLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESK 419
            D  + ++E+ + +SA     +V  L+ DI +LKRQ+I E+ QK  LQNQ+E F++ELE K
Sbjct: 342  D-CTKEEEATMTTSA--VSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHK 398

Query: 420  VPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQR 479
             P L SFK+R   LE +L  +  +LE++S  K     ++   + +I+  E  I  L +QR
Sbjct: 399  TPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQR 458

Query: 480  SDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRD 539
             DLARQV+ LL+  S   ++  PL+ +E+  +R+ILE  ++  E D+Q +I+ERLVEF +
Sbjct: 459  LDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSN 518

Query: 540  IVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELES 599
            + ELQ KN +LL  IR LADKLE+ E +     + VEN  I+EAK+AII L+    ++E+
Sbjct: 519  VNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMET 578

Query: 600  RIEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMK 659
            RI +L +ERD+YK +  ++   NK   +++ + +     ++ +LE  L + + E    ++
Sbjct: 579  RINILLRERDSYKLL--ASTEENKANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQ 636

Query: 660  MLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQD 719
             L  E+    + + K    +E     K LA+E+ ++ + ++   K E   L K+   +  
Sbjct: 637  NLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPS 693

Query: 720  NLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNN 779
             +  +  +    LS   + + K+ +LE E+     +  S    ++  T   EQ   E+  
Sbjct: 694  YIHVEKERASTELS---QSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKE 750

Query: 780  XXXXXXXXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDS 839
                         E     +  E  YK K+  LE    +LR+ L  K +E        DS
Sbjct: 751  LQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDS 810

Query: 840  RSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQT 899
            + +W Q  ID     +K + ++L ++  T   L S+ + L+  L++  TK Q Y  L+Q 
Sbjct: 811  QLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRK--TKFQ-YKFLDQN 867

Query: 900  DDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDF 959
             D       LR ELE+ +++L+DA SQI+ +       EE +S+  NA    KNE +K  
Sbjct: 868  SDASTLEPTLRKELEQIQVQLKDANSQIQAY-------EEIISSNENALIELKNELAKTK 920

Query: 960  GNMKKKEDELVGQVEALKHQISNLNNELGHQKK----------QFDSEKNELENQLVSLQ 1009
             N   K +    +  A +  +S L  ELG  +            F  +  +L N++  +Q
Sbjct: 921  ENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKEGALHFVQQSEKLRNEVERIQ 980

Query: 1010 STQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQ 1069
               E +  M      QL K             K    Y+  ++ + D+S+ + +L +++ 
Sbjct: 981  KMIEKIEKMSTIV--QLCK------------KKEMSQYQSTMKENKDLSELVIRLEKDAA 1026

Query: 1070 KYKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLD 1129
              + + +  +SS+   +  LD+ + KW+ +K +YE +L S  ++ E L V+N +L++++D
Sbjct: 1027 DCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD 1086

Query: 1130 LEAKDPNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSF 1189
                D  +  G  +   K+  L ++LR ER+ L+TKL   KR      +K +++E+ ++ 
Sbjct: 1087 ----DTAANNGDKD-HLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTIND 1141

Query: 1190 AKEEXXXXXXXXXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQI 1249
             +              ++ DE              +E+N  L+  ++  T++ +E+  Q+
Sbjct: 1142 LQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQL 1201

Query: 1250 DNXXXXXXXXXXXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKL 1309
            ++               K  V    ++I +   E  + KQR QD+  + +    ++ +KL
Sbjct: 1202 NDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKL 1261

Query: 1310 GEELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNM 1369
              E+S  K +L++  + N++LE++F RLKKQA E+LDA+K  Q  L+ EL + +  +  +
Sbjct: 1262 TNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKL 1321

Query: 1370 ELQLRKEQDVNKALQESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQ-I 1428
            E      QD++          E+    D  T         KL   E +++D+  D  +  
Sbjct: 1322 E------QDLH---------FENAKVIDLDT---------KLKAHELQSEDVSRDHEKDT 1357

Query: 1429 EKALQSELEKVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSELEKMKRDLEEHSNTL 1488
             + L  E+E +K                     ++ + A + S   EK+K ++E+  + +
Sbjct: 1358 YRTLMEEIESLKKEL------------------QIFKTANSSSDAFEKLKVNMEKEKDRI 1399

Query: 1489 IAEKEAEIRSHYEELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEES 1548
            I E+  E     +E       T  K      +++  DIETLKK+W ++YE +T++RI+E+
Sbjct: 1400 IDERTKEFEKKLQE-------TLNKSTSSEAEYSK-DIETLKKEWLKEYEDETLRRIKEA 1451

Query: 1549 NEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELA 1591
             E L+KRIRLP+EE+I KI+  RK ELE+EF  KL++ A  L 
Sbjct: 1452 EENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLT 1494

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  382 bits (981), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 464/1687 (27%), Positives = 844/1687 (50%), Gaps = 135/1687 (8%)

Query: 23   LGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVHL 82
            L + + +L  ++  V+  I AK    +Q   E  R + T+D  +S    +    K+ + L
Sbjct: 11   LEVTATDLETIEPTVLEKINAKLLSSEQ---EKDRLNATIDNFKSKMSSQFDTVKNDLEL 67

Query: 83   LLQELESLRGESAQFEKMKLELTSEKQRALND--------SETLRVRKEALEQQKQALES 134
            L +E E L  +  Q E   ++   E+Q A +         S+ +    E  ++  Q L S
Sbjct: 68   LQKEKELLIQDKKQLESKCIQW--EQQYAQHQDISKTDLASDDVIKENETFKRDHQLLTS 125

Query: 135  SKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHR 194
               ++++ L+   + L        +L  +N  +R Q  + +SE++  KS+  ++  +   
Sbjct: 126  DLMNLSKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSKYERKVKDFEE 185

Query: 195  LSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXXASTRTNKS 254
            L    S  ++  E    +L + + +F   + ++ ++L                    NK+
Sbjct: 186  LKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYELLLEENKA 245

Query: 255  LREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLEL 314
             +E N  +T  +  +L   K L ++LN  K+ FTREM+L +   DLL+  ++ LK+    
Sbjct: 246  FKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLLKEHIEYLKN---- 301

Query: 315  RSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSA 374
              T  E   G+ +   + L  EL    + LE+SE +   L   ++  ++ ++ES      
Sbjct: 302  --TTKETTGGTSTLEKDRLLHELVDIKKSLEKSELENVHLNDFIEQYLTENEES------ 353

Query: 375  HEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLE 434
                   +D   ++ LLK Q+I EKRQK++LQ QVE FV+ELE+++P ++S KDRN  LE
Sbjct: 354  ------TSD--NELVLLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLE 405

Query: 435  EQLAETAYMLESISKDKESVALDL----RRTKAQIHDFEIQISELTRQRSDLARQVQYLL 490
            ++L +   +LE   ++ +    +L    RR K Q  +  + +S    QR DLA QVQ+LL
Sbjct: 406  QELMQITGLLEETERESDIRIKELTTENRRLKEQTENINVLMS----QRVDLAHQVQFLL 461

Query: 491  IQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDL 550
            +   ++   +  LT +EI F+R+I++  +   + D+QK+ISERLV+F DI  LQ +N +L
Sbjct: 462  LNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMEL 521

Query: 551  LRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDA 610
            L T RNLA++LES +      +K+V+     E+KE I  LQE    L S++E L KE+DA
Sbjct: 522  LTTTRNLAEQLESSD------TKSVQKITRNESKEKIAKLQESINGLTSKLEKLQKEKDA 575

Query: 611  YKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLR 670
            YK +    N G +     L +   K   ++  LER    +   AE+  K+LN  I +L +
Sbjct: 576  YKLLSLQ-NTGEQTPTEELRSQLQKKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKK 634

Query: 671  QKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYH----IIQDNLLKQDT 726
            +K  L   I KE + + +AE++ K+ + SL+L  ++ +   K+Y     ++ D+  +   
Sbjct: 635  EKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIK 694

Query: 727  KTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTA---ERNNXXXX 783
             ++E  +     Q+K++ L+ E++S     ++L    K N  ++ +L A   E+      
Sbjct: 695  HSRENET----TQAKISILQKEIESYK---QNLLQYSKDNENTLSKLAAATQEKETLGSR 747

Query: 784  XXXXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQW 843
                     ++  L+ E E  YKE     E    + + QL  K +E  DF    +S+  W
Sbjct: 748  LSTVKNELEQKINLMQERETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINW 807

Query: 844  YQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVL 903
            YQ+++DSL       T+  + Q +  ++L    K+   RLK  + +      L+Q  +  
Sbjct: 808  YQKRLDSL------TTTNDKLQVELNKEL---TKINIQRLKISDLEK----TLSQNTNGS 854

Query: 904  AQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMK 963
            +    +  + EK K +L++   +I ++R     AEE      N  ++  N+  +   +  
Sbjct: 855  SSLPRVDQDFEKLKNELKEKQLEINQYRDLLNLAEET----KNRLQKDLNKQRQIVDDAM 910

Query: 964  KKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYE 1023
            + +++L  Q+  L  + S++N+ L  QK + + ++  ++++    ++ + +++S+    E
Sbjct: 911  EGKEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKNSLSSL----E 966

Query: 1024 QQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIE 1083
             ++  L  ++ ++     + +  Y+++L + ++ S  I ++  E++ YK     L+++I 
Sbjct: 967  NKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIA 1026

Query: 1084 QLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLT----VQNG---LLLDQLDLEAKDPN 1136
              E  +     K L++K  +E Q+    + I++L     +Q G    +  +    + D +
Sbjct: 1027 AYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTD 1086

Query: 1137 SELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLR-KLEAIEQELSFAKEEXX 1195
             E   ++  +K  ELI +LRRERD L  KL++S+R E  SLR ++E ++  L   ++   
Sbjct: 1087 -ETVVNDTSDK-NELILALRRERDGLDIKLDISQR-EVYSLREQVENLKNSLDETRQSFK 1143

Query: 1196 XXXXXXXXXXIMADEHNKXXXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXX 1255
                         ++H +           +E+N  L+ ++++  +    +  +++     
Sbjct: 1144 GLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNE 1203

Query: 1256 XXXXXXXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQ 1315
                       K S+  KD Q++L+SEE  RWK RS++IL K +++D EEH KL EELS 
Sbjct: 1204 MNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELST 1263

Query: 1316 AKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRK 1375
             K +L  K   N +L DRF RLKKQA E+LDAAKA   +L+ E+    +A+S +E+ L +
Sbjct: 1264 LKTQLDTKTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDE 1323

Query: 1376 EQDVNKALQESLQRVESEAKADSTTQPELESALQK-LSQAEKKAQDIESD-------RAQ 1427
            E       ++ +Q VES+ K      P++ +AL+K LS + + ++ IE +         +
Sbjct: 1324 E-------RKRIQEVESQLKQ-KPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLE 1375

Query: 1428 IEKALQSELEKVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSELEKMKRDLE----E 1483
            + K L  E+  +KS                  +  V  G+  +S  +  +K   E    E
Sbjct: 1376 LNKKLTEEVNSLKSQ--------LETLKNQNGVISVADGSAINSETIAHLKESFEVEKTE 1427

Query: 1484 HSNTLIAEKEAEIRSHYEELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIK 1543
               TL  E + ++    ++L  +++  Y  + +  G   P+DIE +K +WEE  E+  ++
Sbjct: 1428 LITTLKEEFKKQLEEEKKKLLEEKEKEY-YDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQ 1486

Query: 1544 RIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEV 1603
            RI ++ E L+KRIRLP+EEKIN+++E R+ ELE+E+E KL+++   L  E       T +
Sbjct: 1487 RIADAEENLKKRIRLPSEEKINRVIEKRRKELEEEYEKKLKRQG--LTTE-------TAI 1537

Query: 1604 MKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASG 1663
             +  ++E+E+   +L  + D E+A+V+KKAF EGKQQ+ MK+  LE+K++KLE+Q   S 
Sbjct: 1538 EEELRKEVER---ELRVKFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSR 1594

Query: 1664 TEAVPSA 1670
            T  + S+
Sbjct: 1595 TPDLESS 1601

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  313 bits (803), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 425/1633 (26%), Positives = 774/1633 (47%), Gaps = 210/1633 (12%)

Query: 104  LTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQE 163
             TSE+Q       T+  R E + ++ + L+SS  D++R++ E+  E+   + E   +  +
Sbjct: 36   FTSERQTV----RTVEGRMELIVEENRLLKSSNLDMSRIVTERAEEIGRLRDEVSTVTGQ 91

Query: 164  NRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAY 223
               LR +  +L+++  + K +DL  ++E       L   +  +  L +++ Q     +  
Sbjct: 92   TSALRAELENLQNDLELLKDKDLALQSERDSTVALLDGLKLENSALRAEIEQAKELASIR 151

Query: 224  RHTTQSQLAAXXXXXXXXXXXXXASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSE 283
            +H  ++ L +              +     SL     R++ +L  +  ++++L D     
Sbjct: 152  QHDYEADLDSKTGALVSKEEELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLR 211

Query: 284  KQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQ 343
            + E+T E++L++    LL+ QV SL+ + +L    G   +  +  P     EE+A   QQ
Sbjct: 212  QDEYTDEINLQKHRARLLQEQVASLEKEAKL---VGHETEPEYEIP--PPGEEVA--LQQ 264

Query: 344  LEESEFKVQKLEQTVQDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKE 403
               S              +S D    L +   E   S+++L  +IS+L  ++  E   K+
Sbjct: 265  RSHS--------------ISMDS---LLTGNDETSHSMSELNNNISILSNRLKRETLSKQ 307

Query: 404  HLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKA 463
             L+ QV  FV ELE   P++ SFK +++  + Q+ +    LE ++KDKE++  ++ + K 
Sbjct: 308  KLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKK 367

Query: 464  QIHDFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRIL----EQGD 519
            Q+     Q   L R+R DLARQ+QYLL+   V+ DS  PLT+ E ++++ IL    E+G+
Sbjct: 368  QLEQISGQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEILNTDPEEGN 426

Query: 520  LSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSK-TVEND 578
             S   D+Q +IS+R+++F+ IVELQ +N +LL  +R L+D+ E+ E   K+ S  ++E  
Sbjct: 427  TS-STDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLER--KLESGDSIE-- 481

Query: 579  AIREAKEAIITLQEHAQELESRIEVLT---KERDAYKAI------QPSTNNGNKITEHAL 629
            AI EAK+ ++ LQ++   LE+++E LT   K  + + +I          ++GN I   AL
Sbjct: 482  AINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSDGNNI--QAL 539

Query: 630  ANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLA 689
             N    + A              E+ + +  L S+I  L + K+ LA E E    SK L 
Sbjct: 540  KNKYDSLMA--------------ESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLI 585

Query: 690  EERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLSCLIECQSKLATLESEL 749
            E+RLK++Q  L L+K EN  L  R       L +++ +T +T+   ++C +KL  ++ +L
Sbjct: 586  EDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQL 645

Query: 750  KSSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXXXXXXXGERDKLLAETEKSYKEKV 809
            ++++ + + L + Q      + Q   ERNN              +D+ L + + S + K+
Sbjct: 646  ENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKI 705

Query: 810  DALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTT 869
            D LE+E ++LR ++  K+   +  +    +  +WYQ K DSL+ +   +  ++   A T 
Sbjct: 706  DDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTI 765

Query: 870  RDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEE 929
              L  + + L+  L+E  +K +  +     DDV   T AL  EL  S+ +L D   ++E 
Sbjct: 766  ETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELE- 824

Query: 930  HRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNELGH 989
                           +N   ++++E       + +++ EL  + + L+ +I+ L +EL H
Sbjct: 825  -------------ISSNTIRQYQSE----IKVLNERQSELENENKHLRDEIAILRDELTH 867

Query: 990  QKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQ 1049
               +F+ EK  L  +L +L+  Q  +  ++E Y  ++ KL  DL++QA    + +  +++
Sbjct: 868  NGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDE 927

Query: 1050 ELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRS 1109
            E++   +           ++ Y+N+  +++  I Q +         ++ +++E E++++ 
Sbjct: 928  EVREVQN---------RNTETYRNELELVE--IRQTK--------VFVEKEKELESRIKI 968

Query: 1110 LNQRIE-------DLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKVRELITSLRRERDIL 1162
            LN++IE         + +  LL +Q+ L A +  S+L  +    +  +L+  L  E+  L
Sbjct: 969  LNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNL 1028

Query: 1163 QTKLEVSKRSETVSLR-KLEAIEQELSF-------AKEEXXXXXXXXXXXXIMADEHNKX 1214
            ++KL  S+ SE   LR +L   E E++        AK+E             + +E  + 
Sbjct: 1029 ESKLFASQ-SEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAE---------VNNESGRA 1078

Query: 1215 XXXXXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXXXXXXXXKRSVRAKD 1274
                      +ESN++L +EV+    R  E+  +++                +  + +KD
Sbjct: 1079 EEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKD 1138

Query: 1275 SQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQ----NSEL 1330
             ++  +  E +R K  S D+     +    E   L   L  + A L  + D     N+EL
Sbjct: 1139 MKLMELQTECSRLKATSHDMPQNGNKDSSSE---LVGALQSSVATLTEQVDNLKHANTEL 1195

Query: 1331 EDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRV 1390
            EDRF RLK+QARERLDA+K   N+L          + N+E  L K++    ALQ+ ++R 
Sbjct: 1196 EDRFGRLKRQARERLDASKVTINSL----------RDNVE-TLTKDK---TALQDVIERS 1241

Query: 1391 ESEA-KADSTTQPELE-SALQK-----LSQAEKKAQDIESD-------RAQIEKALQSEL 1436
            + E  +  +  Q  +E SA+ K     L+    K +DIE++         Q+  AL  E+
Sbjct: 1242 KDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEI 1301

Query: 1437 EKVKS---HXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKE 1493
            E +K    +                 + E  + AF D  E     +   E S   +AE+ 
Sbjct: 1302 ESLKHEVQYLKEASSAEPQGNEEMSGVVESMRKAFED--EKIAFMKATSEDSEARLAEER 1359

Query: 1494 AEIRSHYEELRLKEKATYEKE----LEEN-----GKHTPVDIETLKKQWEEDYEQKTIKR 1544
             +++   E L  KEK +   E     EEN      +    DIETL+KQW           
Sbjct: 1360 GKLKREMEALE-KEKDSLVMEKTRLGEENTALMKARSDVPDIETLQKQW----------- 1407

Query: 1545 IEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVM 1604
             E SN   ++R+ L  +EK ++++  +  ELE++F+ +++ +  EL   K       E+ 
Sbjct: 1408 -EASN---KERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEKELNALKD------EIE 1457

Query: 1605 KRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGT 1664
            ++ K   E           + +  V+K+AF+EGKQQA+MK   LE+KIAKLEA+ KA  T
Sbjct: 1458 EKCKTGHE-----------DTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKA--T 1504

Query: 1665 EAVPSAPTSKNSP 1677
            ++      S+++P
Sbjct: 1505 KSGSDMSVSEDAP 1517

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  306 bits (783), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 407/1564 (26%), Positives = 738/1564 (47%), Gaps = 234/1564 (14%)

Query: 167  LRQQTLDLESESRVSKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHT 226
            +  + L L+ E   +KSE L  ++E  R  ++  L R +++WLE  L +   E    +  
Sbjct: 99   INDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQK-- 156

Query: 227  TQSQLAAXXXXXXXXXXXXXAST--RTNKSLREHNARITNDLETQLRNVKKLTDNLNSEK 284
             QS L                S   + N  L   N  ++ +++ +L  +K+ +D+ ++++
Sbjct: 157  -QSILKMEEKDQEIDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQ 215

Query: 285  QEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQL 344
            QEF  E+ LK+R+   LE Q++ ++ +  +++     +D +       + E+L    +QL
Sbjct: 216  QEFLHEIGLKDRINSSLETQLKEIQQEKSIQN-----EDNTSRAESQKIMEQLIDTRKQL 270

Query: 345  EESEFKVQKLEQTVQDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKR---- 400
            ++S  +                 +RLKS  +E+   + D+ G+ S     +  E      
Sbjct: 271  KDSRNEC----------------TRLKSYVNEF---INDVNGEYSSSSSLLKKELLKVKE 311

Query: 401  QKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRR 460
            QK++L+ QVE F+ ELE KVP++ S + +N  LE++L++   +++ IS ++ES+  + + 
Sbjct: 312  QKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQS 371

Query: 461  TKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDL 520
             K +    +  I  LT QRSDLA Q+Q+LL+    ++ +   L+ +E  F+RR+ E    
Sbjct: 372  FKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTY 431

Query: 521  SLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAI 580
            +   D+Q +ISERL++F DI ELQ +N D+L T+R+LA +LE +E+  +    T+E   +
Sbjct: 432  ARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTL 491

Query: 581  REAKEAIITLQEHAQELESRIEVLTKERDAYKAI----QPSTNN---GNKITEHALANSK 633
             EAK+A++ LQE+   LE ++E   KERD YK +     PS+N     N I +H    + 
Sbjct: 492  EEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECNDIDKH----TT 547

Query: 634  GKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERL 693
            GK       L+  L   RE   K ++ L    +++L +K +L   ++K  ++K  AE + 
Sbjct: 548  GK-------LQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKA 600

Query: 694  KVSQGSLKLTKQENEE--LNKRYHIIQDNLLKQ-DTKTQETLSCLIECQSKLATLESELK 750
            ++ + +L L  QEN +  L +  H+ Q  LL Q + K  E    L E  S+   L+    
Sbjct: 601  ELIENNL-LMLQENRKSVLEQNDHLQQ--LLSQKEAKLAELTQDLHELTSQYNLLQIRFT 657

Query: 751  SSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXXXXXXXGERDKLLAETEKSYKEKVD 810
             + ++  SL +  +   + + ++  E+N              E   + A  E    E++ 
Sbjct: 658  DTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNERLT 717

Query: 811  ALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNET---LKV-VTSQLESQA 866
              ++    L   + +++++  D          WYQ+   +  ET   L V +  + E+  
Sbjct: 718  EYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQTETEIGLPVDMKKEGETGR 777

Query: 867  QTTRD-LESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYS 925
            Q+ RD LESQK           + +  +  L     V   T    M++ ++         
Sbjct: 778  QSNRDTLESQK-----------SGSPGFTDLGTDSSVRKSTSLPVMQVGRT--------- 817

Query: 926  QIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFG---NMKKKEDELVGQVE-------- 974
              EE     K  +    A+T++        S+  G   N+ KKE +L+ Q+E        
Sbjct: 818  --EEESKEAKKCD----ALTDS--------SQVVGLPENVTKKEKDLIAQIEQLASDKKE 863

Query: 975  ------ALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGK 1028
                  A++ +  +L+++L  +K  FD+EK  L N+L  +       NS+ E  ++ L  
Sbjct: 864  LKTSLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMEN----NSLTEVAKKSLED 919

Query: 1029 LTQDLNQQAAFANKAQENYEQELQRHADVSKTISQ-------LREESQKYKNQASVLQSS 1081
               D+  +           E+E Q+H + + T+S+       + EE   Y+ + S  +S+
Sbjct: 920  DLHDVEMK----------LEEERQKHEETNATLSEKELLCEKMIEEISGYREELS--KSA 967

Query: 1082 IEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQ 1141
              Q++          +    E E  L   N+RI+DL  QN LL +QL     +   +L  
Sbjct: 968  EMQVD----------IQHTRELEDLLDLANKRIDDLCTQNNLLHEQL-----NATLDLED 1012

Query: 1142 SEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEXXXXXXXX 1201
            ++ ++ ++++I  ++RERD LQ KL + +R   V   +   ++ EL    +         
Sbjct: 1013 TQNKDDIKDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAVSKGQQWHNLPL 1072

Query: 1202 XXXXIMADEHNKXXXXXXXXXXXRESNITLRSEV-QKKTQRCQELEGQIDNXXXXXXXXX 1260
                 +   H K           RE+N++L +EV Q K   C  L  ++           
Sbjct: 1073 SN---LLTGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCI-LNDELSQVRKLSGPLQ 1128

Query: 1261 XXXXXXKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLG------EELS 1314
                  +R  + KD +ISL  +E  RWK+R Q ++ +       +   LG       E+ 
Sbjct: 1129 DQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMVHR-------QDDTLGLEANFKNEID 1181

Query: 1315 QAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMEL-QL 1373
              K  +  +  +  +L ++FQ LKKQA E+LDA K     L+ +L++ +   SN++L ++
Sbjct: 1182 SLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIK--ASNLQLEEV 1239

Query: 1374 RKEQD-----VNKALQESLQRV-------------ESEAKADSTTQPELESALQKLSQAE 1415
             KE+D     +   L+E+L++              E+EAK + T      + LQKL+  E
Sbjct: 1240 MKEKDKKIREIELTLKENLEKFDKDEKLVSEKTFKENEAKLNKTI-----TMLQKLN--E 1292

Query: 1416 KKAQDIESDRAQIEKALQSELEKVKSHXXXXXXXXXXXXXXXXSLEEVKQGAFTDSSELE 1475
               Q++ S R +I    + +                         +E  Q   T      
Sbjct: 1293 TLNQEVVSLREEINVLRKKD-------------------------DETNQLIST------ 1321

Query: 1476 KMKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATYEKELEENGKHTPVDIETLKKQWEE 1535
             MK D E   + LI EK  E+   +E  R  E  + + E   N  +T  +++ LK++  +
Sbjct: 1322 -MKLDFEREKDRLIEEKVRELNEKFESGR-NEVLSKQSENVTND-NTGSNVDKLKQELRK 1378

Query: 1536 DYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKP 1595
            D+E++T++RIEE+ E L++ IRLP+EEKI +I+E R++ELE +F+ +++++A+ +A    
Sbjct: 1379 DWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADK 1438

Query: 1596 QPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKL 1655
               S  E+ ++ ++E+E     + +++  ++  +R KAF+EGK+QA MK+  LE+K++KL
Sbjct: 1439 ADMSPDELKQKVRRELEHA---IEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKL 1495

Query: 1656 EAQV 1659
            E+QV
Sbjct: 1496 ESQV 1499

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  229 bits (583), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 257/995 (25%), Positives = 487/995 (48%), Gaps = 48/995 (4%)

Query: 124  ALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKS 183
             L+++K A + +KN++ +LL E+I+++ + K + + +++EN+ L + +  L  E   SK 
Sbjct: 62   TLQKEKLASQETKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKD 121

Query: 184  EDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAAXXXXXXXXXX 243
            E L  + +L +++  LSL     +  ES+   K   F +Y+   + +             
Sbjct: 122  EKLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDN 181

Query: 244  XXXASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEG 303
                +   N  L + N  ++ DL  ++  +K L ++L +   +F  E  L+++L++ L+ 
Sbjct: 182  ELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQN 241

Query: 304  QVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVS 363
            Q+++L+  LE  S     D G+     + L  ++    ++LE SE +   L  ++++  +
Sbjct: 242  QIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQN 301

Query: 364  TDKESRLKSSAHEYP--ASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVP 421
              +E     S+H      S   L GD+++L++  + E++QK  L+ Q+   + ELE  +P
Sbjct: 302  IPEEESSSVSSHASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMP 361

Query: 422  MLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSD 481
             LSS+K+R+  LE++L  +  +LE I K+    + +L + +++  +    I+ L  QR+ 
Sbjct: 362  SLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTV 421

Query: 482  LARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIV 541
            LARQV+YLL+           L  +++  + + L         D++K++ ERL +F+++ 
Sbjct: 422  LARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVK 481

Query: 542  ELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRI 601
            ELQ++N  LL+  R LA K E  E+ +  +  + E++ I +AKEAI+ LQE++Q+LES+I
Sbjct: 482  ELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQI 541

Query: 602  EVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKML 661
            + L+ E     A+Q       K +  A++  +   S+   DL + L    + ++  +  L
Sbjct: 542  KELSDEL----AVQKK-EKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDAL 596

Query: 662  NSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNL 721
            NSEI+ L +  T + I ++KE++++ LAE+R  + + ++ L K E EEL +  + +Q N+
Sbjct: 597  NSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNI 656

Query: 722  LKQDTKTQETLSCLIECQSKLATLESELKSSVAK----IESLSSCQKKNTESIEQLTAER 777
            L ++ +   +    I C+SKL+T E+E+ S  A+    IE+ ++ + K     E L  ER
Sbjct: 657  LDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKK----EALLNER 712

Query: 778  NNXXXXXXXXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTN 837
            NN             E   LL ET+  Y +K+    ++ +Q   QL    +  ++    N
Sbjct: 713  NNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQN 772

Query: 838  DSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLN 897
            DS  +WY+  ID L   +  +  +L+   Q    +E   K LE          Q+   L 
Sbjct: 773  DSEIKWYKATIDDLKANVFELNEELK---QKEEKIEEFSKTLEN--------VQNELTLA 821

Query: 898  QTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSK 957
             + DV  +  AL  EL + K       SQ+E+     K  E  +S    +FE    ++  
Sbjct: 822  NSKDVSEEKRALEKELSEVK-------SQLEKSNLEVKEYENVISTSKRSFENKSIQYED 874

Query: 958  DFGNMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQST---QET 1014
                +  K D  + +   L+  +S L   +  Q+ +  S  N L    VS  S    Q+T
Sbjct: 875  RIKALASKLDSELRERTTLQENLSTLQARMVVQQDELTSNNNTLSELRVSYDSLLLEQKT 934

Query: 1015 MNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQ 1074
                   ++ +  +L   +  +    +   ++YE+ +Q ++++SK +  LREE    KN+
Sbjct: 935  -------FKDKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREE---VKNR 984

Query: 1075 ASVL--QSSIEQLEKTLDESDGKWLNQKEEYEAQL 1107
             S    +  +E  E  + +    W  +K+ +E Q+
Sbjct: 985  TSNGEKEGDLEDTESIIKKGQDVWDEEKKVFEVQI 1019

 Score = 97.4 bits (241), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/124 (47%), Positives = 82/124 (66%), Gaps = 4/124 (3%)

Query: 1535 EDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEK 1594
            E YE++  K++ ++ E L+KRIRLPTEEKIN I+E RKSELE  FE K+++ A  L    
Sbjct: 1222 EFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLL--- 1278

Query: 1595 PQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAK 1654
               +   ++ K +K+  E  +  L +E DE++  VRKKAF+EGKQ   MKS FLE+KI+ 
Sbjct: 1279 -LHSDDDKIKKIYKEIEESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISM 1337

Query: 1655 LEAQ 1658
            LE Q
Sbjct: 1338 LEGQ 1341

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  207 bits (528), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 188/608 (30%), Positives = 308/608 (50%), Gaps = 52/608 (8%)

Query: 22  FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81
           F  +  N   ++D   +  I  KA +   L  EN   S  +D+++   E K+     +  
Sbjct: 20  FFDLPGNTWESMDEHALEKIYTKAYD---LMKENSFVSAAIDDIKHVYEGKINTISQKYF 76

Query: 82  LLLQELESLRGESAQFEKMKLELTSEKQR------ALNDSETL-RVRKEALEQQKQALES 134
            L  E + L+ + + +   + +L SEKQ+      ALN   TL +   EA+++    LE+
Sbjct: 77  NLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEA 136

Query: 135 SKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHR 194
            +     +L +        K E  D + EN  L++Q    E +      E      E  +
Sbjct: 137 RERKTENVLEQS-------KLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKK 189

Query: 195 LSQELSLCRSNSEWLESQLGQ--KNAEF-----NAYRHTTQSQLAAXXXXXXXXXXXXXA 247
           L   + L R N+ +LE +  +  KN +      +A R   Q Q+ +              
Sbjct: 190 LQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIA--- 246

Query: 248 STRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQS 307
                 +L+  N  ++ DL+ +L  +K L DNLNS KQEF +E++LK+R+ +LL  ++ S
Sbjct: 247 ------TLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 300

Query: 308 LKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKE 367
            K  +E R T+      +   P   + +EL    ++L  SE +  +L+ TV   ++ D++
Sbjct: 301 YKKQIE-RLTSK-----NLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEK 354

Query: 368 SRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFK 427
             +  S    P  +      I +L+RQ++ EKR K+ LQ QVE+F+VELE K+PM+ SFK
Sbjct: 355 KLI--SKFGNPKKL------IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFK 406

Query: 428 DRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQ 487
           +RN  LE +L      LE  +K+++    +L   + +I + E    EL RQRSDLA QVQ
Sbjct: 407 ERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQ 466

Query: 488 YLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKN 547
           YLL+      D+K P T +E   V++I+   +   + D+ K+IS+RL+ F+++ ELQ KN
Sbjct: 467 YLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKN 522

Query: 548 SDLLRTIRNLADKLE-SEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTK 606
            +LLRT R L   LE  E+EQ K    T  N  +  AK   + L++H + LES+I ++++
Sbjct: 523 MELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQ 582

Query: 607 ERDAYKAI 614
           ERD+YK +
Sbjct: 583 ERDSYKLL 590

 Score =  150 bits (378), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 153/471 (32%), Positives = 244/471 (51%), Gaps = 62/471 (13%)

Query: 1226 ESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXXXXXXXXKRSVRAKDSQISLISEETN 1285
            ESN  L  EV+  T+  + L  Q+ +               K  V  K+  +++  EE  
Sbjct: 1074 ESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELE 1133

Query: 1286 RWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELEDRFQRLKKQARERL 1345
            RWK RSQ IL + + ++ E H K  E++   + +L     +N++L DRF RLKKQA E+L
Sbjct: 1134 RWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKL 1193

Query: 1346 DAAKAVQNNLSVELAQAREAQSNMELQLRKE-----QDVNKALQESLQRVESEAKADSTT 1400
            DAAK +Q NL+ ++ +  E + N+E  L++E     Q  N A  ES + +   A      
Sbjct: 1194 DAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRA------ 1247

Query: 1401 QPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHXXXXXXXXXXXXXXXXSL 1460
              ELE +    ++ EKK +D +  + +IE +L+SEL+ VK++                  
Sbjct: 1248 --ELEKSNNFSNELEKKVEDAKKFKNEIE-SLKSELQSVKAY------------------ 1286

Query: 1461 EEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATY----EKELE 1516
                + +  +S  ++ +K   +   + LI + + E ++  E    KEK T     +  + 
Sbjct: 1287 ----ENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLE----KEKETILAQRKNNIL 1338

Query: 1517 ENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELE 1576
             NG+ +  +IE LKK+WEE+ E   +KRI E+ E L+KR+RLP+EEKIN ++E R+  LE
Sbjct: 1339 ANGQESA-NIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLE 1397

Query: 1577 QEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDE 1636
            QEFE KL+        E    A    V+   + ++EK   +L  + + E+A+++KKAF+E
Sbjct: 1398 QEFETKLR--------ELGLNADGNGVVTDTRAQIEK---ELREKFNLELAEIKKKAFEE 1446

Query: 1637 GKQQASMKSMFLEKKIAKLEAQVKA------SGTEAVPSAPTSKNSPTEKP 1681
            GKQQ+ MKS  LE+K++KLE+Q  +      S    VPS     N  +  P
Sbjct: 1447 GKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSSP 1497

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  193 bits (490), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 154/512 (30%), Positives = 264/512 (51%), Gaps = 65/512 (12%)

Query: 400 RQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDK-ESVALDL 458
           +Q   L++ ++ ++ ELE ++P++ +FK   + L++ L +   ++ES+  DK E++ L +
Sbjct: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKL-M 267

Query: 459 RRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQG 518
              K  I++    I  L  QR+DLA Q+QYLLI +S+++D+ GPL+  EI F++ ++ + 
Sbjct: 268 DSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKD 327

Query: 519 DLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVEND 578
              L  D Q VIS+RL++F+DIV LQ KN +L ++IRNLA  LES+E + K   +  +ND
Sbjct: 328 KQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDND 387

Query: 579 AIREAKEAIITLQEHAQELESRIEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSA 638
            I EAKE I++LQE+   L+  I  L  +    ++  P++    K  +H         S 
Sbjct: 388 TINEAKETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKESEK--QHF-----NYHSN 440

Query: 639 RVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQG 698
            V DLE  L      ++  ++ LN +IQ L  ++T + I +EKE++S  LA E+L + Q 
Sbjct: 441 LVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQN 500

Query: 699 SLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLSCLIECQSKLA--------------- 743
           S  L   ENEEL+ +  +++  L +++      L+  I+C++ L                
Sbjct: 501 SYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNNNKLG 560

Query: 744 ------TLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXXXXXXXGERDKL 797
                 +L+ E+KS+  +I+ L S  K   +S+E   ++                     
Sbjct: 561 LEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISK--------------------- 599

Query: 798 LAETEKSYKEKVDALEVEASQLRTQ-------LSRKDEEFNDFIQTNDSRSQWYQEKIDS 850
                  Y +KV  LE+  S+L  Q       L  K+ E +D   +N  +  WYQ+K+D 
Sbjct: 600 -------YTDKVKELELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQ 652

Query: 851 LNETLKVVTSQLESQAQTTRDLESQKKLLEGR 882
             +T+K + S+L +  Q ++ L   K L + R
Sbjct: 653 YEKTIKTLESRLPADTQNSKALVEDKALEDSR 684

 Score =  134 bits (338), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 159/593 (26%), Positives = 271/593 (45%), Gaps = 131/593 (22%)

Query: 1113 RIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRS 1172
            R+++L  QN LLL++L+  A   N E         V ++  SLR ERD L  ++   ++ 
Sbjct: 734  RVQNLATQNRLLLEKLERSA---NLE---------VDDIFVSLRYERDTLSDQVVNYEKD 781

Query: 1173 ETVSLRKLEAIEQELSFAKEEXXXXXXXXXXXXIMADEHNKXXXX--------------- 1217
              V L  LE+++ EL+ A  +             M  +H K                   
Sbjct: 782  MQVILADLESVQSELNAANSQILNFENQRA----MVQDHKKGNVNEETLIEKLTELDELK 837

Query: 1218 ------XXXXXXXRESNITLRSEVQKKTQRCQELEGQIDNXXXXXXXXXXXXXXXKRSVR 1271
                          E+NI L+ ++++  +R + LE +I                    + 
Sbjct: 838  ERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNIL--------------IE 883

Query: 1272 AKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELE 1331
             KD+ I++ +E+   WK R       F  +         E+L   + ++  K+ +N EL 
Sbjct: 884  DKDNIINVSNEKAENWKTR-------FNELTLSAKNNDNEDLINLQKQVEEKSKENEELS 936

Query: 1332 DRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVE 1391
            DRF RLKKQA ERL A+K  QNNL+ +  + +   +++E  L ++ +  K L+ S+   +
Sbjct: 937  DRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKD 996

Query: 1392 SEAKADSTTQPELESALQKLSQAE----KKAQDIESDRAQIEKALQSELEKVKSHXXXXX 1447
             E  +    + +L +AL K  + E    K   + ES  + ++  ++S  EK+KS      
Sbjct: 997  QELGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKS------ 1050

Query: 1448 XXXXXXXXXXXSLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEELRLKE 1507
                        L+E         SE+E  K+        LIAE E ++     EL LK 
Sbjct: 1051 ------KESSVGLQE---------SEIENAKK-------ILIAELEEKLNKTKSELDLKH 1088

Query: 1508 KATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKI 1567
            K                +++ LK ++E D +    KR+ E+ E L+++IRLP+EEKIN I
Sbjct: 1089 KE---------------ELKVLKTEYEGDIQ----KRVAEAEEALKRKIRLPSEEKINTI 1129

Query: 1568 VETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMA 1627
            +E++ ++LE++++ KL+  ++E                    ++EK+K    +E ++ + 
Sbjct: 1130 IESKVADLEEDYKKKLETVSAE------------------STDIEKIK----QEFEDNLV 1167

Query: 1628 QVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEK 1680
              +KKAF+EGKQQASMK+ FLE KIAKLE+Q++ + ++        K +  EK
Sbjct: 1168 NAKKKAFEEGKQQASMKTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEK 1220

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  137 bits (346), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 121/505 (23%), Positives = 253/505 (50%), Gaps = 16/505 (3%)

Query: 366 KESRLKSSAHEYPASV------TDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESK 419
           K +RL ++ +E+ +        TD + D  +LK+++   + Q++ LQ ++E  + ELE+ 
Sbjct: 270 KVARLTATVNEFQSKTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENH 329

Query: 420 VPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQR 479
            P L++  D+ + LE  L++     E      + +  + +   +++   + +I  L  + 
Sbjct: 330 APELNNQYDKINELELLLSKEKNTSEHFKTTIKEIENEKKNIISRLKLSDDKIETLREEN 389

Query: 480 SDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQG---DLSLERDTQKVISERLVE 536
           +DL  Q+Q++LI  S+++D  G LT  EI F++ + E+G     +   ++Q +IS+RL+ 
Sbjct: 390 NDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIR 449

Query: 537 FRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQE 596
           F  ++ LQ KN +L++T+R +  KL+++E + + + +   +D + EAKE I+ +   + +
Sbjct: 450 FESVISLQQKNMELIKTLRLITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDK 509

Query: 597 LESRIEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSAR---VDDLERSLVTEREE 653
           L+ +I  L ++ +A + +    N      E  LA +K         +D+L+ ++    ++
Sbjct: 510 LKEKISELQQQLNANRPVSHEKNGH----ESVLAENKLYTEGDRLILDELKNNIPEFTKQ 565

Query: 654 AEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKR 713
           A   + M   ++  L  +  +L  +  K   S+ + +++L + Q         NE+L + 
Sbjct: 566 ASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEH 625

Query: 714 YHIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQL 773
             +I+D + ++D     T++  ++C++ L ++ +++ S + K + L   + + +    +L
Sbjct: 626 MEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNEL 685

Query: 774 TAERNNXXXXXXXXXXXXGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDF 833
             ER               + D   AE + S   K++ LE+  S L   L  K++E  DF
Sbjct: 686 KMEREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDF 745

Query: 834 IQTNDSRSQWYQEKIDSLNETLKVV 858
           I T +    WYQ+K D  +  LK V
Sbjct: 746 ISTKNRELDWYQKKFDIFSTMLKRV 770

 Score = 42.0 bits (97), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 8/93 (8%)

Query: 1314 SQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAR----EAQSNM 1369
            S  K +   K+ +N E  DRF RLKKQA  RL ++K  QN L+ +++  +    E QS +
Sbjct: 971  SDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKL 1030

Query: 1370 ELQLRKEQDVNKALQESLQRVESEAKADSTTQP 1402
            E+Q +  Q+    L+  ++  E+++++ ST+ P
Sbjct: 1031 EVQSKTVQE----LETQIKSTEADSRSRSTSIP 1059

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score =  127 bits (318), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 130/514 (25%), Positives = 260/514 (50%), Gaps = 37/514 (7%)

Query: 386 GDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLE 445
            +I  +K ++I EK +K  L+ +   F+ ++ESK+P L     +N+ +E +      + E
Sbjct: 281 NNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYL-----QNNSVENETNNGNKIEE 335

Query: 446 -SISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLI-QASVRSDSKGPL 503
             I  + +S+ L+ +  K +++DFE  +  L +QRSDL  Q+ YLLI Q+ +  D+   L
Sbjct: 336 QKIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKIL 395

Query: 504 TTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLES 563
           T  E+ F+R ++ Q   +   +TQ +ISERL++F ++ +L +KN  L+  +R L +K+ES
Sbjct: 396 TENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMES 455

Query: 564 EEEQSKMRSKTVEND--AIREAKEAIITLQEHAQELESRIEVLTKERDAYKAIQPSTNNG 621
            E+Q+  +   +E D  +I EAK+ +I L+E             K +D    I       
Sbjct: 456 IEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEEN----------VKNKDIINQI------- 498

Query: 622 NKITEHALANSK-GKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIE 680
             I+E  L   K   +++ V +L +S+  +RE   KN+++  +  Q LL +  +L+IEI 
Sbjct: 499 --ISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKTN-QSLLEKNNQLSIEIS 555

Query: 681 KERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLSCLIECQS 740
                  + +E+  +   S    K+   E++      + +++ +D      +S L++ ++
Sbjct: 556 NASNENKILKEKFDLLIKSYTELKELKSEIST---YTKSSVISKDGNETAKISELVDLKA 612

Query: 741 KLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNXXXXXXXXXXXXGERDKLLAE 800
           K   LE   K   +K + L        + ++++ +E N               ++ +   
Sbjct: 613 KCKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGIN 672

Query: 801 ---TEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKV 857
               ++  KE+++ ++     L  ++  ++ +    I+   S+ +WYQ+KID +N T++V
Sbjct: 673 ENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMNTTMEV 732

Query: 858 VTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQ 891
             S L S A++   L+++ ++ E + K++ETK++
Sbjct: 733 KISNLASSAESAAMLKNKNEIDELK-KQIETKSK 765

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 94/355 (26%), Positives = 165/355 (46%), Gaps = 53/355 (14%)

Query: 1312 ELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMEL 1371
            E+ + K ++  K+ + +E  DRF RLKKQA+++L+  K  +N L  +     ++++ +E 
Sbjct: 752  EIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKNELEQ 811

Query: 1372 QLRKEQDVNKALQESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKA 1431
            +L   +   K+LQE + +++ E     T+  EL++   + SQ E         R + EK 
Sbjct: 812  RLLLLESSEKSLQEEIVKMKDEL---MTSNNELDN--NQRSQEEL--------RNEYEK- 857

Query: 1432 LQSELEKVKSHXXXXXXXXXXXXXXXXS---LEEVKQGAFTDSSELEKMKRDLEEHSNTL 1488
             Q++L K+K                  S   LE +         E+  +K+D+E  ++ +
Sbjct: 858  -QNKLYKIKEEELESALNQLMLKENQNSALDLESLPDDVMLKLKEM--VKKDIEIENDII 914

Query: 1489 IAEKEAEIRSHYEELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEES 1548
            +  K  EI    E+   K+  T   EL ++       I T+K+ WE++Y+          
Sbjct: 915  LKAKLKEI----EKNSAKDVNTDSIELSDDN------ISTMKEAWEKEYQH--------- 955

Query: 1549 NEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELA---NEKPQPASFTEVMK 1605
              IL+ RI    E+  N+ +   + ELE+E+E +L K + +L+   N K +     E++K
Sbjct: 956  --ILKIRI----EDAENQAMARTRKELEKEYEERLSKESEKLSDQYNNKLKDDLSEELLK 1009

Query: 1606 RHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVK 1660
              K+   +L+  L  E DE      KK F +       K+  L KKI  LE Q+K
Sbjct: 1010 IDKKYAMELETKLKNETDE-----SKKEFQDALGTEQTKNKILSKKIEFLETQIK 1059

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1608

 Score =  115 bits (287), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 96/321 (29%), Positives = 182/321 (56%), Gaps = 41/321 (12%)

Query: 253 KSLREHNARITNDLETQLRNV-------KKLTDNLNSEKQEFTREMSLKERLVDLLEGQV 305
           K+LR+ N+ + + LE   R +       K L+D L+S++ +F RE++ +++L  +L+ QV
Sbjct: 170 KALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLKKQV 229

Query: 306 QSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTD 365
            SL S+L        G+  + + P    +++ A+++ Q EE   ++   ++ V++L+   
Sbjct: 230 NSLHSEL-----GNGGETPAHAEP----NDQFAKQSSQHEE---EISNYKEQVEELLGI- 276

Query: 366 KESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSS 425
               L   A   P+        I+ L++ ++ E+++   L+ Q+E+FV+ELE ++P L  
Sbjct: 277 ----LGQGA---PS--------IAHLRKLLLKERKENVSLKKQMESFVIELEHRLPGLQI 321

Query: 426 FKDRNDMLEEQL-AETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLAR 484
            + +N  ++++L A T  M+E  SK K     +L  ++ ++        +L  QRSDLA 
Sbjct: 322 LEKQNKEVQQKLHAATNKMIEE-SKAKIRTQRELSSSRQKVDHLNQIFHKLRVQRSDLAH 380

Query: 485 QVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQ 544
           Q+Q+LL   S  SD+  P +  E++F++ I+E  +    +D+Q+++S+RL+ F +I ELQ
Sbjct: 381 QIQFLLTVNS--SDTVLPPS--ELSFIKTIIENENWDAYKDSQRIVSDRLLRFDNIPELQ 436

Query: 545 SKNSDLLRTIRNLADKLESEE 565
            +N  L+ T+R+L DK+ES E
Sbjct: 437 EQNMKLVSTVRSLVDKVESWE 457

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 56.2 bits (134), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 180/778 (23%), Positives = 326/778 (41%), Gaps = 119/778 (15%)

Query: 189 KAELHRLSQELSLCRSNSEWLESQL--GQKNAEFNAYRHTTQSQLAAXXXXXXXXXXXXX 246
           K E+ RLS + +L  +N +WL  +L   QKN     Y   T     +             
Sbjct: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKN-----YLIDTHDVKYSSKNDNKLYNSHNK 75

Query: 247 ASTRTNKSLREHNARIT-----NDLETQLRNVKKLTDNLNSEKQE--FTREMSL-KERLV 298
                 + L  HN +++     N +E   +    + DNLN+EK    F ++++L  ER  
Sbjct: 76  LLELQKEFLISHNEKLSDRLNENSIEFNDKFNSVVIDNLNNEKNLILFEKKLNLLNERYS 135

Query: 299 DLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTV 358
            +++ Q   + +D+          + S      +L+E++ ++   ++  E K++KL   +
Sbjct: 136 IIIKDQKDVIDNDI----------NNSKYLEFKSLNEKIIKQNSNMKSMESKIEKLNAII 185

Query: 359 QDLVSTDKESRLKSSAHEYPASVTDLY----GDISLLKRQVIHEKRQKEHLQNQVEAFVV 414
            + +  +          E+    T+ Y     D  +LK+ ++HEK     LQ ++ + ++
Sbjct: 186 HNFIDIN----------EFDNENTNKYSLDLNDNKVLKKLLVHEKNSNLKLQEELNSILL 235

Query: 415 ELESKVPMLSSFKDRN----DMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEI 470
           EL  K+P L+S K++N     + E  ++    +L+    + + +A        +I D+E 
Sbjct: 236 ELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIA----SMNNKIVDYEQ 291

Query: 471 QISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVI 530
            + +L  QR++L   + Y+L   +V + +   L   E         +G L      Q + 
Sbjct: 292 SLKQLLSQRTNL---ISYILNLLNVINLNSKYLNLSE--------SEGCL-----IQNLF 335

Query: 531 -SERLVEFRDIVELQSKNSDLLRTIRNL--ADKLESEEEQSKMRSKTVENDAIREAKEAI 587
            +ER+  F     LQ KN  L     NL   D   +   +S ++       A   +KE I
Sbjct: 336 NNERIQRF-----LQEKNLTLTEIFDNLNTVDITFNNFNRSDIKVLPPTESA---SKEEI 387

Query: 588 ITLQEHAQELESRIEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSL 647
           I  +       + I +L    DAYK I    NNG  ITE      K + S+R        
Sbjct: 388 INYK-------NEIILLENNCDAYKMIL--YNNG--ITEDLDEKLKIESSSR-------- 428

Query: 648 VTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQEN 707
           +TE  E    ++ML S+I EL    TKL      E+ S+ +A      S  S  L K   
Sbjct: 429 MTELNEKNSRIQMLESKIDELNSIVTKL-----NEKNSRFMASINKNNSSESTILEKY-- 481

Query: 708 EELNKRYHII-----------QDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKI 756
             LN+ Y  +            DN     T T +    ++E +S +  L S +KS  AK+
Sbjct: 482 NLLNQSYKTLLEAYKSLKSNATDNKKAVLTSTLDDTKKIVEFKSTINYLNSTIKSLSAKL 541

Query: 757 ESLSSCQKKNTESIEQLTAERNNXXXXXXXXXXXXGERDKLLAETEKSYKEKVDALEVEA 816
            S+        +  +++  E +N             +++ +  E    + +++  LE E 
Sbjct: 542 VSIQESNDLLADENQKIKMENSN---LSSLLNKINTDKNSISNELSDLHSKEILELETEK 598

Query: 817 SQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQK 876
           ++L  QL   + +  +  + ++ + +W+Q KID+ NE     T++ +       D E+ K
Sbjct: 599 TKLLEQLEEGERKLKETNEKHNEQIKWFQNKIDNFNEE----TTKNQFNNALKNDYENLK 654

Query: 877 KLLEGRLKEVETKAQSYDVLN-QTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSR 933
           K  E + KEVE     +  L  Q ++ L  ++  + EL  +   L+D  +  +EH S+
Sbjct: 655 KSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISK 712

 Score = 38.5 bits (88), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 62/177 (35%), Gaps = 60/177 (33%)

Query: 1524 VDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKL 1583
            VD+E LKK WE++Y     KRIE +                               E +L
Sbjct: 822  VDVEGLKKDWEKEYSHIIEKRIEYA-------------------------------EMQL 850

Query: 1584 QKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASM 1643
            +KR                           LK+++ REMD++M  V  K F+ GK  +  
Sbjct: 851  EKR---------------------------LKSEMEREMDDKMKVVEMKGFESGKASSEK 883

Query: 1644 KSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEK--PVRILEASPLEDALSRND 1698
                LE K++ LE Q      +      +  N+ T+K  P       P    L  ND
Sbjct: 884  TLNLLEHKLSLLEKQNNEKSNKINTLIESENNNKTQKINPFTFSSVEPKISNLVSND 940

 Score = 36.6 bits (83), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 4/68 (5%)

Query: 1329 ELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRK-EQDVNKALQESL 1387
            E  D+F RLK+QA ERL+A+K  Q  LS  +    + ++N +  + K E D+N  L  +L
Sbjct: 666  EANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINN-LNNAL 724

Query: 1388 QRVESEAK 1395
              VE+E K
Sbjct: 725  --VEAEKK 730

>KAFR0D02510 Chr4 (499589..500869) [1281 bp, 426 aa] {ON} Anc_3.393
           YBR130C
          Length = 426

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 78/153 (50%), Gaps = 22/153 (14%)

Query: 792 GERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSL 851
           G R+K+L       KEKV  +  + ++L  +L   + ++N  +++N     +YQ+++  L
Sbjct: 160 GSRNKIL-------KEKVTKVTNDENELANELIFVENQYNSLVESNKFYESYYQDRMSEL 212

Query: 852 NETLKVVTSQLESQ---AQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEA 908
            E LK++ S  E Q   ++   D+ + +KLL G + +     +  + L+ +++   +  A
Sbjct: 213 FEQLKIMES--EDQDILSKFDEDVSNNEKLLNGSVDQFNEYLKELERLDHSNE---EVVA 267

Query: 909 LRMELEKSKIKLQDAYSQIEEHRSRYKSAEEAL 941
           L++    SKI L D +S +      YK ++E L
Sbjct: 268 LKVSEAASKINL-DNWSAL------YKESKEML 293

>KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some
            similarities with uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 950

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 99/204 (48%), Gaps = 17/204 (8%)

Query: 919  KLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDELVGQVEALKH 978
            KLQ+   Q+EE     K A++   +     +R   E +K  G ++ KEDE+V   E    
Sbjct: 249  KLQELQDQVEESAQALKVAQDDRRSEFEGHQRVAEELAKCKGQIRLKEDEIVTVTENADK 308

Query: 979  QISNL-NNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYE---QQLGKLTQDLN 1034
               +L  +  G  KK  + +    E++L  +Q  +  ++ MK+H +   Q +    ++LN
Sbjct: 309  ACQDLRTDNAGLHKKAIEIQSALTESELY-VQQLKSKVDLMKKHNDDLSQTVHDKIEELN 367

Query: 1035 QQAAFANK-AQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDESD 1093
            +     ++  +EN  QE           + LR   ++Y ++ S L++  E+L+K L+  D
Sbjct: 368  ECNTRIDELYKENIAQE-----------NSLRSRVKEYDSELSSLRNRNEELQKKLELQD 416

Query: 1094 GKWLNQKEEYEAQLRSLNQRIEDL 1117
             +++++   YEA++ SL    EDL
Sbjct: 417  HEFISKSSSYEARISSLKSANEDL 440

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 35.4 bits (80), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 124/268 (46%), Gaps = 42/268 (15%)

Query: 941  LSAITNAFERFKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDS---E 997
            + AI   ++  + E SKD  N +K+   L  ++     +I +LN  LG  K Q D    E
Sbjct: 876  MQAIVEKYKSLQKEKSKDDNNHQKEAKLLKEEIARKTTEIKSLNENLGKTKTQHDDLLKE 935

Query: 998  KNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADV 1057
            K  +  +LV  +   ++ + +       + KLT+ L   A      Q  +E  +    ++
Sbjct: 936  KEHISKELVECKLRFQSHDIL-------VAKLTEKLKSLANNYRDLQATHESLIASMEEI 988

Query: 1058 SK-----------TISQLREESQKYKNQASVLQSSIEQLEKTL-------DESDGKWLNQ 1099
             K               L +E + ++++  +L+ +I +L++T+       +E+  K+ + 
Sbjct: 989  KKENTMQMSNLESKFDSLSQEKESFQSERELLEENIRKLKETISTLELTKEEAITKFNSS 1048

Query: 1100 KEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKVRELITSLRRER 1159
            KE+YE+Q+  L +++E +  +NG  ++++   + + +   G+ E Q+            +
Sbjct: 1049 KEDYESQIGLLKEQLETVATENGESVNKISELSHNIDDLKGELETQKNF----------K 1098

Query: 1160 DILQTKLEVSKRSETVSLRKLEAIEQEL 1187
            D L+ KLE SK+     L++ +A EQ L
Sbjct: 1099 DDLEAKLEASKK----VLKETQANEQHL 1122

>Smik_13.523 Chr13 (863924..869284) [5361 bp, 1786 aa] {ON} YMR306W
            (REAL)
          Length = 1786

 Score = 34.7 bits (78), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 65/148 (43%), Gaps = 18/148 (12%)

Query: 962  MKKKEDELVGQVEALKHQISNLNNELGHQKKQFDS--EKNELENQLVSLQSTQ---ETMN 1016
            M++  D  V   E    Q S++ N   H   Q DS   +   +N L+SL  +    E  N
Sbjct: 28   MQEIRDVFVQLTEKFGFQKSSMENMYQHLMGQLDSRASRTGAQNALISLHVSYIGGEHAN 87

Query: 1017 SMKEHYEQQLGKLTQDLNQQAAFAN-----KA-QENYEQELQRHADVSKTISQLREESQK 1070
              K ++  QL     DL+++  F N     KA Q N +   +R   + + I Q  E+ Q+
Sbjct: 88   YRKWYFAAQL-----DLDEEIGFQNMQLHGKARQRNVKMAKKRGVSIKEQIKQWNEKEQE 142

Query: 1071 YKNQASVLQSSIEQLE--KTLDESDGKW 1096
            + N    +  + EQLE    L  +D KW
Sbjct: 143  FINNHPKITLTQEQLEDQTNLKSADYKW 170

>KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {ON}
            Anc_8.604 YOR195W
          Length = 732

 Score = 33.1 bits (74), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 91/191 (47%), Gaps = 18/191 (9%)

Query: 983  LNNELGHQKKQFD---SEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDLNQQAAF 1039
            LNNE  +QKK+ D   +EKNE+  +L  +Q     + S  E  + ++ +   ++N   A 
Sbjct: 253  LNNEYVNQKKEIDNLMTEKNEIVTKLNEMQVVNNELVSKNEKLKVKVTEFKNEINTLNAN 312

Query: 1040 ANKAQENYEQELQRHADVSKT---ISQLREESQKYKNQASVLQSSIEQLEKTLDESDGKW 1096
             +  +  Y+  +  +  + K    ++ L  E++K  NQ    ++   +LE   D +D K+
Sbjct: 313  QSLLKSKYDNLISENDALKKNKELLNNLSIENEKLINQGKNWETRFSELENEKDSADEKF 372

Query: 1097 LNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKVRELITSLR 1156
               KE++ ++L S N+ +E+   +   LL     E K  NS+L            + SL+
Sbjct: 373  AQIKEQF-SELTSRNESLENQITELNELLSVAKEENK--NSDLLNE---------VNSLQ 420

Query: 1157 RERDILQTKLE 1167
             ER  LQ KLE
Sbjct: 421  EERKELQKKLE 431

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.122    0.306 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 158,177,157
Number of extensions: 6781991
Number of successful extensions: 65775
Number of sequences better than 10.0: 3197
Number of HSP's gapped: 54703
Number of HSP's successfully gapped: 8284
Length of query: 1771
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1647
Effective length of database: 39,262,815
Effective search space: 64665856305
Effective search space used: 64665856305
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 73 (32.7 bits)