Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E01034g5.703ON58358328660.0
Kwal_55.196915.703ON46646818410.0
SAKL0E14938g5.703ON57458614000.0
Smik_9.195.703ON57258511551e-151
Suva_9.385.703ON56958411521e-151
Skud_9.185.703ON57159011201e-146
TDEL0B021705.703ON56758311181e-146
Kpol_1043.715.703ON58559011181e-146
YIL150C (MCM10)5.703ON57158811111e-145
NCAS0G002205.703ON59257710941e-142
AFR287W5.703ON61147810951e-142
TBLA0G010205.703ON59460210931e-142
NDAI0F002805.703ON61049810861e-141
KAFR0D022105.703ON58459910681e-138
TPHA0E002105.703ON54449910551e-137
ZYRO0G06578g5.703ON56958810561e-137
CAGL0H06589g5.703ON58361010211e-131
KNAG0L021505.703ON61662310201e-131
KLLA0A00572g5.703ON5775888611e-107
NDAI0B053001.90ON123561761.3
Suva_16.4383.428ON33563714.1
Kwal_26.95975.17ON287118696.8
TBLA0I035403.581ON486145699.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E01034g
         (583 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...  1108   0.0  
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   713   0.0  
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   543   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   449   e-151
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   448   e-151
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   436   e-146
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   435   e-146
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   435   e-146
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   432   e-145
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   426   e-142
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   426   e-142
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   425   e-142
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   422   e-141
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   416   e-138
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   410   e-137
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   411   e-137
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   397   e-131
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   397   e-131
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   336   e-107
NDAI0B05300 Chr2 (1294623..1298330) [3708 bp, 1235 aa] {ON} Anc_...    34   1.3  
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    32   4.1  
Kwal_26.9597 s26 (1282870..1283733) [864 bp, 287 aa] {ON} YGR277...    31   6.8  
TBLA0I03540 Chr9 complement(847840..849300) [1461 bp, 486 aa] {O...    31   9.0  

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score = 1108 bits (2866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/583 (94%), Positives = 551/583 (94%)

Query: 1   MGQETDPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQS 60
           MGQETDPREVLQLDVHDIVTSDEDEDTKIK                   KASRKKAQRQS
Sbjct: 1   MGQETDPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQS 60

Query: 61  LERVEVPASPKEERXXXXXXXXXXXXXGITLAANSNNDSIEVPWKNGPSNTTSYFVENFV 120
           LERVEVPASPKEER             GITLAANSNNDSIEVPWKNGPSNTTSYFVENFV
Sbjct: 61  LERVEVPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPWKNGPSNTTSYFVENFV 120

Query: 121 NARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELD 180
           NARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELD
Sbjct: 121 NARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELD 180

Query: 181 EIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLT 240
           EIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLT
Sbjct: 181 EIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLT 240

Query: 241 DFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSI 300
           DFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSI
Sbjct: 241 DFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSI 300

Query: 301 RHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVEL 360
           RHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVEL
Sbjct: 301 RHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVEL 360

Query: 361 NGSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGESQNTLFFSNPNYAKAFF 420
           NGSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGESQNTLFFSNPNYAKAFF
Sbjct: 361 NGSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGESQNTLFFSNPNYAKAFF 420

Query: 421 DDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDAT 480
           DDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDAT
Sbjct: 421 DDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDAT 480

Query: 481 EQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNSKSSQVKEIMSFKKSNVSLAPSKA 540
           EQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNSKSSQVKEIMSFKKSNVSLAPSKA
Sbjct: 481 EQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNSKSSQVKEIMSFKKSNVSLAPSKA 540

Query: 541 EQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583
           EQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV
Sbjct: 541 EQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/468 (71%), Positives = 401/468 (85%), Gaps = 2/468 (0%)

Query: 116 VENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMS 175
           +ENF N+RK EE +I+HR  +L  RVHTF+G+ + K  +P+ V+EKE  SG  +SRRY++
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 176 TSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYF 235
           + EL EI+++IK+LRLPKLFSKVRPPKFTEPDYANWVA+GI+  KS VK+TSSSKP+KYF
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 236 KMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKS 295
           KMT+TDFTH+LD+Y+FNN NVEKYYNLRVGDIIAILN DILPWRPSQV NDEFSG  VKS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 296 FNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNA 355
           FNLSIR N+DCVLEIGTS+DLGFC+I NKA  K CGAPINRAA DRC+YHQ++RFR VNA
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 356 QRVELNGSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGESQNTLFFSNPNY 415
           QRVELNGS SLRSPVKNGKKQALYG+SGVKRKL LLPDKHAPQ QD ESQNTL+FSNPNY
Sbjct: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNPNY 300

Query: 416 AKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQ 475
           AKAFFDD+YQNPD+L NL++KRRK++D+E ER LQ QL+ A+GK G Q F+ K+K+EQKQ
Sbjct: 301 AKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQEQKQ 360

Query: 476 MKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNSKSSQVKEIMSFKKSNVSL 535
           MK ATEQ ++SGLL++IGFDP +GKMR+VLK GKN  +  ++KS QV+EI+  +K+NVSL
Sbjct: 361 MKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQVREIIETRKTNVSL 420

Query: 536 APSKAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583
           APSKA+QKKRLLRREQVW+EHF+T K       + P S+SSDSDLEIV
Sbjct: 421 APSKADQKKRLLRREQVWKEHFET-KTDPTANNQIP-SDSSDSDLEIV 466

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/586 (48%), Positives = 385/586 (65%), Gaps = 22/586 (3%)

Query: 6   DPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLERVE 65
           DPRE  ++D+ D ++ DED+D  +                     + RKK    +   VE
Sbjct: 3   DPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSGVE 60

Query: 66  VPASP-KEERXXXXXXXXXXXXXGITLAANSNNDSIEVPWKNGPSN-TTSYFVENFVNAR 123
           VP SP K +                   A+ N + ++V  K   S+ +T YF +NF +++
Sbjct: 61  VPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFSSSK 120

Query: 124 KVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIM 183
           K +E + + +  +L+CRVHTF G D ++   P+ V+E+E +SG  IS+RY++  +  +I+
Sbjct: 121 KAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQARKIL 180

Query: 184 REIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFT 243
           RE KVLRLPKLF+KVRPP FTEP Y+NWV IGIIS KS VK+T+ +KPS+YF +TLTDF 
Sbjct: 181 RETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLTDFK 240

Query: 244 HNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHN 303
           H ++IY+F NKNVEKYYNL+VGDIIA+LNP+I PWRPS+V +++ S  V+KSFNL I+HN
Sbjct: 241 HTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIKHN 300

Query: 304 FDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGS 363
           F+ +LEIGTS+D GFC I NK   K CG PIN++  DRC YHQ+V+FR VNA+R+ELNG+
Sbjct: 301 FNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLELNGN 360

Query: 364 TSLRSPVKNGKKQALYG--TSGVKRKLQLLPDKHAPQAQDGESQNTLFFSNPNYAKAFFD 421
            SLRSP KNG K  LYG   SG   K  LLPD++APQ Q  +SQN L+FSNPN A+AFFD
Sbjct: 361 KSLRSPTKNGVKHILYGKNKSG---KYDLLPDRYAPQTQSKDSQNVLYFSNPNAARAFFD 417

Query: 422 DSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDATE 481
           D YQNPD LNNL++KRRKL+  +KE+ LQ QL   IGK+    F N++  +Q +++ AT+
Sbjct: 418 DDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQDEIRRATK 477

Query: 482 QVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGL--NSKSSQVKEIMSFKKSNVSLAPSK 539
             L SGL++ IGFDP  G+M  VL   KN + GL   +K+S V+EI+  KK  + L PSK
Sbjct: 478 NALESGLIKKIGFDPTSGRMSSVL---KNNSKGLKEQAKNSAVEEILQIKKEKIELKPSK 534

Query: 540 AEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSD--LEIV 583
              +++  +RE+VW  HF  E+  N      P  ESSD D  LEIV
Sbjct: 535 EALRQKFKKREEVWNHHFKKEENPN------PGVESSDGDSELEIV 574

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  449 bits (1155), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 244/585 (41%), Positives = 357/585 (61%), Gaps = 22/585 (3%)

Query: 6   DPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLERVE 65
           DPRE+L +D ++ VTSDE+++  I                    K + KK    + E +E
Sbjct: 3   DPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIE 62

Query: 66  VPASPKEERXXXXXXXXXXXXXGI-TLAANSNNDSIEVPWKNGPSNTTSYFVENFVNARK 124
           VP SP + R              + T  AN +N S        P NTT+YF++ F NA+K
Sbjct: 63  VPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAKK 122

Query: 125 VEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIMR 184
            E+++I    S++  RVHTF G D+ K  +P+  +E E +S   + +RY+   +L   + 
Sbjct: 123 DEDRQIAKFESMMDARVHTF-GTDN-KKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180

Query: 185 EIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFTH 244
           EIK+LRL KLF+KVRPPKF  P+YANW  +G+IS KS++K TSS KP K+F  T+TDF H
Sbjct: 181 EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 245 NLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHNF 304
            LD+YIF  K VE+YYNLR+GDIIAILNP++LPWRPS        G  +KSFNL I H+F
Sbjct: 241 TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSG------RGNFIKSFNLRISHDF 294

Query: 305 DCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGST 364
            C+LEIG+S+DLG+C I N  T K CG+PIN +    C+YH++V+FR  +A+R+ELNG  
Sbjct: 295 KCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGY 354

Query: 365 SLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGE--SQNTLFFSNPNYAKAFFDD 422
           +L +P K   + +LY   G  R   ++ D     +++ E   +++  F+N N AKAFFD+
Sbjct: 355 ALGAPTKVNSQPSLYKAKGENR-FNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDE 413

Query: 423 SYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDATEQ 482
            +QNPDML NL+NKRRK+ D++K + L  +L   + +       +KS  E+++MK  TE 
Sbjct: 414 KFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTEN 473

Query: 483 VLNSGLLRDIGFDPFRGKMREVLK----FGKNVNSGLNSKSSQVKEIMSFKKSNVSLAPS 538
            L +GL++ +GFDP  G++ +VLK     G++ N+ LN K + + +++ +KK  V LAPS
Sbjct: 474 ALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPS 533

Query: 539 KAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583
           K E  K+   RE+VW+ HF  +  A +      +S++S SDLEI+
Sbjct: 534 KNEWFKKRNHREEVWQRHFGPKGEAEE------ASDASASDLEII 572

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  448 bits (1152), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 238/584 (40%), Positives = 360/584 (61%), Gaps = 23/584 (3%)

Query: 6   DPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLERVE 65
           DPRE+L +D ++ VTSDE+++  I                    K   KK +  + E VE
Sbjct: 3   DPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVE 62

Query: 66  VPASPKEERXXXXXXXXXXXXXGITLAANSNNDSIEVPWKNGPSNTTSYFVENFVNARKV 125
           VP SP ++                 +A+N N   +    +  PSNTT+YF++ F +A++ 
Sbjct: 63  VPQSPAKKSIVKKSQDALKQAIR-PVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRN 121

Query: 126 EEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIMRE 185
           E+++I     +++ RVHTF G D+ K  +P+  +E E +S   + +RY+   +L   + E
Sbjct: 122 EDKQIAKYEGMMNARVHTF-GTDN-KEYKPIITNELESFSNLWVKKRYIPEEDLKRALHE 179

Query: 186 IKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFTHN 245
           IK+LRL KLF+K+RPPKF EPDYANW  +G+IS KS++K TSS KP K+F  T+TDF H+
Sbjct: 180 IKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHS 239

Query: 246 LDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHNFD 305
           LD+YIF  K VE+YYNLR+GD+IAILNP++LPWRPS   N       +KSFNL I H+F 
Sbjct: 240 LDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGN------FIKSFNLRISHDFK 293

Query: 306 CVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGSTS 365
           C+LEIG+S+DLG+C I NK T K+CG+PIN      C+YH++V+FR   A+R+ELNG  +
Sbjct: 294 CILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYA 353

Query: 366 LRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGE--SQNTLFFSNPNYAKAFFDDS 423
           L +P K   + +LY   G + +  ++       +++ E   +N+  F+N N AKAFFD+ 
Sbjct: 354 LGAPTKVDSQPSLYRAKG-ENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEK 412

Query: 424 YQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDATEQV 483
           +QNPDML NL++KRRK+ D++K   L  +L   + +       +KS+ E+++MK  TE  
Sbjct: 413 FQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESA 472

Query: 484 LNSGLLRDIGFDPFRGKMREVLK----FGKNVNSGLNSKSSQVKEIMSFKKSNVSLAPSK 539
           L +GL++ +GFDP  GK+ +VLK     G+++ + +N K + + +++ +KK  V LAPSK
Sbjct: 473 LQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSK 532

Query: 540 AEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583
            E  K+   RE+VW+ HF +       ++   +S++S SDLEIV
Sbjct: 533 NEWFKKRSHREEVWQRHFGS-------KETEVASDASGSDLEIV 569

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  436 bits (1120), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 245/590 (41%), Positives = 354/590 (60%), Gaps = 33/590 (5%)

Query: 6   DPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLERVE 65
           DPRE L  D ++ VTSDED++  I                    K   K+A+  + E +E
Sbjct: 3   DPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEAIE 62

Query: 66  VPASPKEERXXXXXXXXXXXXXGITLAANSNND---SIEVPWKNGPSNTTSYFVENFVNA 122
           VP SP + R              +  AA++ ND   S     +  PSNTT YF++ F NA
Sbjct: 63  VPQSPAKNRNIMKSQNTMKRD--MRPAASNINDLKLSQLQQKQELPSNTTGYFMQKFQNA 120

Query: 123 RKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEI 182
           ++ EE++     ++++ RVHTF G D  K  +    +E E +S   + +RY+   +L   
Sbjct: 121 KRNEEKQRAKYENMMNARVHTF-GTDK-KEYRATIANELEEFSNIWVKKRYIPEDDLKRA 178

Query: 183 MREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDF 242
           + EIK+LRL KLF+K+RPPKF EPDYANW  +G+IS KS+VK TSS KP+K+F  T+TDF
Sbjct: 179 LHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDF 238

Query: 243 THNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRH 302
            H LD+YIF  K VE+YYNLR+GD+IAILNP++LPWRPS        G  +KSFNL I H
Sbjct: 239 QHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSG------QGNFIKSFNLRISH 292

Query: 303 NFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNG 362
           +F C+LEIG+S+DLG+C I N+   + CG+PIN A    C+YH++V+FR  +A+R+ELNG
Sbjct: 293 DFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNG 352

Query: 363 STSLRSPVKNGKKQALYGTSGVKRKLQLLPD--KHAPQAQDGESQNTLFFSNPNYAKAFF 420
             +L +P K   +  LY   G +    L+    K   + ++   +N+  F N N AKAFF
Sbjct: 353 GYALGAPTKVDAQPTLYRAKG-ENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFF 411

Query: 421 DDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDAT 480
           D+ +QNPDML NL++KRRK+ DS+K   L  +L   + + G     +K  EE++++K  T
Sbjct: 412 DEKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTT 471

Query: 481 EQVLNSGLLRDIGFDPFRGKMREVLK----FGKNVNSGLNSKSSQVKEIMSFKKSNVSLA 536
           E  L +GLL+ +GFDP  GK+ +VLK     G+  N  +  K + + +++++KK  V LA
Sbjct: 472 ESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILA 531

Query: 537 PSKAEQKKRLLRREQVWREHF---DTEKLANQKQKKTPSSESSDSDLEIV 583
           PSK E  K+   RE+VW++HF   DT+++          S++S SDLEIV
Sbjct: 532 PSKNEWFKKRSHREEVWQKHFGSKDTDEV----------SDASTSDLEIV 571

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  435 bits (1118), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 240/583 (41%), Positives = 350/583 (60%), Gaps = 23/583 (3%)

Query: 6   DPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLERVE 65
           DPREV+Q D    +TSDE++  +++                   K  + K++  + + ++
Sbjct: 3   DPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSK-RQLKSKDPNFDAIQ 61

Query: 66  VPASPKEERXXXXXXXXXXXXXGITLAANSNNDSIEVPWKNGPSNTTSYFVENFVNARKV 125
           V +SP ++               + +  N N   +E      P+NTTSYF++NF N++K 
Sbjct: 62  VESSPVKKPAESIKVEPSRTKRVLDIE-NLNEKKVE-SRSQIPANTTSYFIDNFRNSKKE 119

Query: 126 EEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIMRE 185
           E++  Q R  LLS RVHTF+GID     + V V+E E YS   + +RY+S  +L +++ E
Sbjct: 120 EQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLRKVLHE 179

Query: 186 IKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFTHN 245
           +K+LRL KLF+K++PPKF EP Y+NW  IGIIS K +VK +SS KP KYFK TLTDF +N
Sbjct: 180 VKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDFQYN 239

Query: 246 LDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHNFD 305
           LD+Y+F  K VE+YYNLRVGDI+AILNP++LPWRPS+       G  +KSFNL I H+F 
Sbjct: 240 LDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSE------KGNFIKSFNLRISHDFP 293

Query: 306 CVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGSTS 365
           C+LEIG S+D+ +C+  NK+  KACG PIN+     C++H++++FR  +A+R+ELNGS +
Sbjct: 294 CILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFA 353

Query: 366 LRSPVKNGKKQALY--GTSGVKRKLQLLPDKHAPQAQDGESQNTLFFSNPNYAKAFFDDS 423
           L +P K     ALY   ++G  R  ++LP+ +            + FSN N AKAFF+D 
Sbjct: 354 LGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKAFFNDE 413

Query: 424 YQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDATEQV 483
           +QNPD+LNNL++KRRK +D +K   LQ QL     +         SK+ + ++ + TE  
Sbjct: 414 FQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIEKGSKKYE-EICETTEAT 472

Query: 484 LNSGLLRDIGFDPFRGKMREVLKFG---KNVNSGLNSKSSQVKEIMSFKKSNVSLAPSKA 540
           L SGL++++GFDP  G++  VLK     K+ N  LN K  +V  ++ FKK +V L P+K 
Sbjct: 473 LQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKE 532

Query: 541 EQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583
              +R   RE+ W+E+F          K    S  SDSD+EIV
Sbjct: 533 VLLQRKRDRERAWQENFG--------DKSVNLSSDSDSDIEIV 567

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  435 bits (1118), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 245/590 (41%), Positives = 354/590 (60%), Gaps = 31/590 (5%)

Query: 6   DPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLERVE 65
           DPRE  + D++  ++SDE E  +I                    K  RK     +   V+
Sbjct: 3   DPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF--VQ 60

Query: 66  VPASPKEERXXXXXXXXXXXXXGITLAANSNNDSIEVPWKNGPSNTTSYFVENFVNARKV 125
           VP+SPK+ R                    + N+   +   +    TTSYF+E F N++K 
Sbjct: 61  VPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFMEKFYNSKKD 120

Query: 126 EEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIMRE 185
            E+K+   SS++S RVHTF G  S K  +P +VDE + YS   +  RY+   EL+ ++ +
Sbjct: 121 HERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLMLLD 180

Query: 186 IKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFTHN 245
           IK+LRLPKLF+KVRPPKFTEP Y+NWV  GII+ K ++K TSSSKP+KYFK T++DF HN
Sbjct: 181 IKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDFQHN 240

Query: 246 LDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHNFD 305
           LD++IF  K VEKYYNLRVGD++AILNP+ILPWRPS+  N   SG  +KSFNL I H FD
Sbjct: 241 LDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSE--NSGGSGSTIKSFNLRISHKFD 298

Query: 306 CVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGSTS 365
           C+LEIG S+DLG+C IPN +    C  PIN++  D+C+YH++++FR   + RVEL+G+ +
Sbjct: 299 CILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTYA 358

Query: 366 LRSPVKNGKKQALY---GTSG---VKRKLQLLPDKHAPQAQDGESQNTLF--FSNPNYAK 417
           L +P K   + ALY   GTS    V++   ++ D H  + +D     T    FS  N AK
Sbjct: 359 LGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSAK 418

Query: 418 AFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMK 477
           AFFD+ +QNPD+LNNL++KRRK+KDS+ ER L   L + + K   ++F N        +K
Sbjct: 419 AFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDKES-KNFKN--------LK 469

Query: 478 DATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNSKSSQVKE----IMSFKKSNV 533
           +AT+  L +G+L+ +GFDP  GK+  V++   +     N    + KE    +M+F+K  V
Sbjct: 470 NATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDTV 529

Query: 534 SLAPSKAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583
           +L PSK +  KR + R++ W+      KL  ++Q    +++ S SDL+I+
Sbjct: 530 NLKPSKDDLIKRRIDRQRNWK------KLFGKQQSSIDNNDDSGSDLKIL 573

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  432 bits (1111), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 235/588 (39%), Positives = 352/588 (59%), Gaps = 29/588 (4%)

Query: 6   DPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLERVE 65
           DPRE+L +D ++ +TSDE+++  I                    K   KK Q  + E +E
Sbjct: 3   DPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIE 62

Query: 66  VPASPKEERXXXXXXXXXXXXXGITLAANSNNDSIEVPW----KNGPSNTTSYFVENFVN 121
           VP SP + R               T    SN + + +         P++TT+YF+E F N
Sbjct: 63  VPQSPTKNRVKVGSHNATQQG---TKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQN 119

Query: 122 ARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDE 181
           A+K E+++I    S+++ RVHTF   +  K   P+  +E E +S   + +RY+   +L  
Sbjct: 120 AKKNEDKQIAKFESMMNARVHTFSTDE--KKYVPIITNELESFSNLWVKKRYIPEDDLKR 177

Query: 182 IMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTD 241
            + EIK+LRL KLF+K+RPPKF EP+YANW  +G+IS KS++K TSS KP K+F  T+TD
Sbjct: 178 ALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITD 237

Query: 242 FTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIR 301
           F H LD+YIF  K VE+YYNLR+GD+IAILNP++LPWRPS   N       +KSFNL I 
Sbjct: 238 FQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGN------FIKSFNLRIS 291

Query: 302 HNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELN 361
           H+F C+LEIG+S+DLG+C I NK T K CG+PIN +    C+YH++V+FR  +A+R+ELN
Sbjct: 292 HDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELN 351

Query: 362 GSTSLRSPVKNGKKQALYGTSGVKRKLQLLPD--KHAPQAQDGESQNTLFFSNPNYAKAF 419
           G  +L +P K   + +LY   G +    ++    K   + ++   +++  F+N N AKAF
Sbjct: 352 GGYALGAPTKVDSQPSLYKAKG-ENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAF 410

Query: 420 FDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDA 479
           FD+ +QNPDML NL+NKRRK+ +++K   L  +L   + +       +KS  E+++MK  
Sbjct: 411 FDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRT 470

Query: 480 TEQVLNSGLLRDIGFDPFRGKMREVLK----FGKNVNSGLNSKSSQVKEIMSFKKSNVSL 535
           TE  L +GL++ +GFDP  GK+ +VLK      +  N+ L  K + + +++ +KK  V L
Sbjct: 471 TESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVIL 530

Query: 536 APSKAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583
           APSK E  K+   RE+VW++HF +++          +S+ S SDLEI+
Sbjct: 531 APSKNEWFKKRSHREEVWQKHFGSKETKE-------TSDGSASDLEII 571

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  426 bits (1094), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 236/577 (40%), Positives = 339/577 (58%), Gaps = 43/577 (7%)

Query: 6   DPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLERVE 65
           DPREVL  D +D V+SDE ++  I                    K   KK    + ++++
Sbjct: 3   DPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQLQ 62

Query: 66  VPASPKEERXXXXXXXXXXXXXGITLAANSNNDSIEVPWKNG------------PSNTTS 113
           VP SP                  + +A   + + +E+P +N             PSNTT+
Sbjct: 63  VPCSP-----------VKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTT 111

Query: 114 YFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRY 173
           YF+E F  ++K EE KIQ   ++++ RVHTF+     +  +P+ V+E E YS   + +RY
Sbjct: 112 YFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRY 171

Query: 174 MSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSK 233
           +  SEL +++  IK+LRL KLF+KVRPPKF+EP Y+NW A+GIIS K + K T++ KP K
Sbjct: 172 IPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKK 231

Query: 234 YFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVV 293
           Y K T+TDF H LD+YIF    VE+YYNLRVGD+IAILNP++ PWRPS        G  +
Sbjct: 232 YLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSG------KGQFI 285

Query: 294 KSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHV 353
           KSFNL I H+F C+LEIG+SKDLGFC++ ++     C  PIN +  DRC+YHQ++RFR  
Sbjct: 286 KSFNLRINHDFKCILEIGSSKDLGFCKVTSR-NGTLCNTPINMSKEDRCDYHQEIRFRDN 344

Query: 354 NAQRVELNGSTSLRSPVKNGKKQALY-GTSGVKRKLQLLPDKHAPQAQDGESQNTLF--- 409
           N++R+ELNGS +L +P K      LY   +G  R  +      +  A  G      F   
Sbjct: 345 NSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLR 404

Query: 410 ---FSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFN 466
              FSN N AKAFFD+ +QNPDMLNNL +KRRK++D +K   +  +L+ AIG        
Sbjct: 405 NRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLG 464

Query: 467 NKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKN------VNSGLNSKSS 520
            +S  E KQMK ATE  L SG+++ +GFDP  GK+  VL+   +      ++  ++ K  
Sbjct: 465 ERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKD 524

Query: 521 QVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHF 557
           +V +++ F+KS+V LAP++ E  +R  RRE++W+E+F
Sbjct: 525 KVNDLLHFRKSHVILAPTRNELIERRDRRERIWQENF 561

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  426 bits (1095), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 219/478 (45%), Positives = 305/478 (63%), Gaps = 6/478 (1%)

Query: 111 TTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNIS 170
           TTSYF E F  AR      ++ +  LL  RV+TF   D+        VDE E YS   I+
Sbjct: 134 TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEVETYSNMRIN 193

Query: 171 RRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSK 230
           +RY+   +L  I+ +IKVLRLPKLF+KVRPPKF+EPDYANWV +G IS+KS+VK TS  K
Sbjct: 194 KRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEK 253

Query: 231 PSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSG 290
           P+KYF + +TDF +++ I +F  KNVEKYY LRVGD+IAILNP+I PW+ S     E + 
Sbjct: 254 PAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETAR 313

Query: 291 PVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRF 350
              +SF LSI+HN +C+LEIG SK+LGFC   NK     CGAPIN+     C YHQ+   
Sbjct: 314 TTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQVCSYHQETHL 373

Query: 351 RHVNAQRVELNGSTSLRSPVKNGKKQALYGT-SGVKRKLQLLPDKHAPQAQDGESQNTLF 409
           R VNA+RVELNG+ SLR+P ++G +QA Y T +    K+ LLPD +AP+A   E +    
Sbjct: 374 RSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPRAPGAEQKFREH 433

Query: 410 FSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKS 469
           F++ N  +A+FD  Y NPD+L NLE+KRRK++ S+K++ +  QL+  +GK   Q  +  S
Sbjct: 434 FASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLVLGKNHTQVKDRVS 493

Query: 470 KEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNSKSSQVKEIMSFK 529
           +E  +Q + AT+ V+ +G+LR IGFDP  G+M  VL  G +       +   + EI++ K
Sbjct: 494 EESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDH-GPADTVREPSISEILANK 552

Query: 530 KSNVSLAPSKAEQKKRLLRREQVWREHFDTEKLANQK----QKKTPSSESSDSDLEIV 583
           K N+ L PSK  ++KR+ +R +V+   F  E +A  +      +  S++SSD +LEIV
Sbjct: 553 KRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCETAQLSSADSSDEELEIV 610

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  425 bits (1093), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 239/602 (39%), Positives = 362/602 (60%), Gaps = 34/602 (5%)

Query: 6   DPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKA--------- 56
           DPREV + D+ D ++ DEDE+ +++                   K    +A         
Sbjct: 3   DPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFISTE 62

Query: 57  ---QRQSLERVEVPASP---KEERXXXXXXXXXXXXXGITLAANSNNDSIEVPWKNGPSN 110
                 S  R++VP SP   K +              GI    N      ++   + P+ 
Sbjct: 63  GNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVPAG 122

Query: 111 TTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSL-KGSQPVNVDEKELYSGFNI 169
           +T+YF+ NF +++KVE QKIQ   +L+S RVH+F    +L K SQ +NV+EKE YSG  I
Sbjct: 123 STAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGLWI 182

Query: 170 SRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSS 229
           SRRY+    +D+++++IK+LRL KLF+K+RPPKF  P Y+NWVA+G+I+ KS  KLTSS+
Sbjct: 183 SRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSN 242

Query: 230 KPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFS 289
            P KYFK T+ DF  N+ I++FN + + KYYNLRVGDII ILNP I PWRPS+ N     
Sbjct: 243 TPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENG---- 298

Query: 290 GPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKAT-RKACGAPINRAATDRCEYHQDV 348
              +KSFNLSI+  +DC++EIG S+DLG+C +P K+   K CG PIN+     CE+H++ 
Sbjct: 299 --YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRET 356

Query: 349 RFRHVNAQRVELNGSTSLRSPVKNGKKQALY--GTSGV--KRKLQLLPDKHAPQAQDGES 404
            FR+  A+R+ELNGS +L +P K     +LY   T+ +  K +  ++  ++A +  D + 
Sbjct: 357 EFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKL 416

Query: 405 QNTLFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQS 464
            N+ F S  N AKAFF+D +QNPD+++NL++KRRKLKD++++  L  +LN  + K    S
Sbjct: 417 HNSNFRST-NIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVS 475

Query: 465 FN--NKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNS-KSSQ 521
            N   KSKE+ K+M++ TE ++  G+L++IG+DP  GKM+ ++K     +    S +S+ 
Sbjct: 476 KNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNA 535

Query: 522 VKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLE 581
           V +++ FKK  V+L P K++   +  +R+++W E+F  +  +N   +    S   DSDLE
Sbjct: 536 VNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSN---RDIILSSGDDSDLE 592

Query: 582 IV 583
           IV
Sbjct: 593 IV 594

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  422 bits (1086), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 230/498 (46%), Positives = 321/498 (64%), Gaps = 30/498 (6%)

Query: 108 PSNTTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGS-------QPVNVDE 160
           PSNTTSYF+E F + +K EE +      +L  RVH F+G++  K S       QP   +E
Sbjct: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLN--KSSKIHKIEYQPEAANE 178

Query: 161 KELYSGFNISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFK 220
            E YS   I +RY+   EL++I + IK+LRL KLF+KVRPPKF EP Y+NWV +GII+ K
Sbjct: 179 VEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQK 238

Query: 221 SEVKLTSSSKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRP 280
             +K TSS KP KYFK T++DF +N+DI+IF+   VE+YYNLR+GDIIAILNP++LPWRP
Sbjct: 239 GSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRP 298

Query: 281 SQVNNDEFSGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKA-CGAPINRAAT 339
           S   N    G  +KSFNL I HN+ C++E+G SKDLGFC IPNK      C  PI+ +  
Sbjct: 299 SNNKN----GTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKE 354

Query: 340 DRCEYHQDVRFRHVNAQRVELNGSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDK----- 394
           DRC YHQ++RFR+  ++R+ELNGS +L +PVK G +  LY  + V  +     ++     
Sbjct: 355 DRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVK 414

Query: 395 ----HAPQAQDGESQNTLFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQ 450
                  +++  E +   +FS+ N AKAFFD+ +QNPDML NL+ KRRK+ D ++   L 
Sbjct: 415 GSEIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLD 474

Query: 451 NQLNSAI-GKTGYQSFNNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGK 509
            +L+ AI  K+  +   NK+K+E  +MK ATE  L +G+++ +GFDP  GK+ +VL+ GK
Sbjct: 475 QELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGK 534

Query: 510 NV---NSGLNSKSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTEK-LANQ 565
           +    N     K  +VK+++ FKK  V LAP+K E  KR  RRE+VW++HF + K LA  
Sbjct: 535 DSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLA-- 592

Query: 566 KQKKTPSSESSDSDLEIV 583
           +Q      ++S+SDLEIV
Sbjct: 593 EQPLNDDVDTSESDLEIV 610

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  416 bits (1068), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 237/599 (39%), Positives = 344/599 (57%), Gaps = 36/599 (6%)

Query: 5   TDPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLERV 64
           +DPRE+   D++  +T D+++  +I+                   K    + +  +   V
Sbjct: 2   SDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTGV 61

Query: 65  EVPASPKEERXXXXXXXXXXXXXGITLAANSNNDSIEVPWK----------NGPSNTTSY 114
           +VPASP ++               I     SN +  E+  +          N  + +T Y
Sbjct: 62  QVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTEY 121

Query: 115 FVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYM 174
           F+E F +A++ E+  I+   S++  RVHTF GI+     Q V VDE E YS   I++RY 
Sbjct: 122 FMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRYT 181

Query: 175 STSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKY 234
             S L  ++ E+K+LRL KLF+KVRPPKF EP Y+NWV +GI+S KS++K T+S+KP KY
Sbjct: 182 PVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQKY 241

Query: 235 FKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVK 294
            K TLTDF H +D YIF  + VE+YYNLR+GDIIA+LNP+ILPWRPS   N       +K
Sbjct: 242 LKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQN------YIK 295

Query: 295 SFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVN 354
           SFNL I H + C+LEIG S+DL  C I  ++T K CG PIN+     CEYH+++  R   
Sbjct: 296 SFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGP 355

Query: 355 AQRVELNGSTSLRSPVKNGKKQALY-GTSGVKRKLQ---LLP--DKHAPQAQDGESQNTL 408
           ++R++L+G  +L +P K   + ALY G +    K+Q   L P   ++ P   D   + + 
Sbjct: 356 SKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSK 415

Query: 409 FFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNK 468
           FFSN N AKAFFDD +QNPDM++NL+NKRRK+ +  K   L  +L+  + K   Q    K
Sbjct: 416 FFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKD--QDLEGK 473

Query: 469 SKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSG----LNSKSSQVKE 524
           ++EE ++MK  T++ L SGL + +GFDP  GK+  +LK  +    G    L+ K   V +
Sbjct: 474 TREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDD 533

Query: 525 IMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583
           +M+FKK  + LAPSK +   +  +RE+VW+E+F         Q K+  +  SDSDLEIV
Sbjct: 534 LMAFKKEYIILAPSKVDLLNKKNKREKVWQENFG--------QNKSNDNSESDSDLEIV 584

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  410 bits (1055), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 216/499 (43%), Positives = 325/499 (65%), Gaps = 19/499 (3%)

Query: 97  NDSIEVPWKNGPSNTTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPV 156
           N++  V   N P+NTTSYF++NF+ A+K E ++++     +S RVH+F G +  K  Q +
Sbjct: 53  NEAKVVSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSI 112

Query: 157 NVDEKELYSGFNISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGI 216
            V+E E YS FNIS+RY+   E+ + +  IK+LRL KLF+K+RPPKF+EPDYANW   GI
Sbjct: 113 IVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGI 172

Query: 217 ISFKSEVKLTSSSKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDIL 276
           I  K ++KLTSS  P K+FK T+T+F H LDI+IF    VEKYYNLRVGDII ILNP++L
Sbjct: 173 ICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVL 232

Query: 277 PWRPSQVNNDEFSGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINR 336
           PWRP      EF G  +KSFNL I H FDC+LEI  SKD+ +C+  N+ T   C  PIN+
Sbjct: 233 PWRP------EFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINK 286

Query: 337 AATDRCEYHQDVRFRHVNAQRVELNGSTSLRSPVKNGKKQALY---GTSGVK--RKLQLL 391
           +  D C+YH++++FR  NA+RVEL+G+ +L +P +   + ALY    TS +K      ++
Sbjct: 287 SKQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIV 346

Query: 392 PDKHAPQAQDGESQNT--LFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTL 449
            D+   + ++ +  N+    FS+ N AKAFFD+ +QNPDML NLENKRRK+KD +++  L
Sbjct: 347 ADRRYMKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVML 406

Query: 450 QNQLNSAIGKTGYQSFNNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLK--F 507
           Q  L  ++G +      +KS +E + M++ T+  L +G ++ +GFDP  G+++ VL+   
Sbjct: 407 QRALRESVGNSKLL-LKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSA 465

Query: 508 GKNVNSGLN-SKSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTEKLANQK 566
            K+  S L   KS+ ++ +++FKKS+V+L PS+    ++L  REQ + ++  +   A  +
Sbjct: 466 DKSTQSKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENR 525

Query: 567 QKKTPSS--ESSDSDLEIV 583
            +K+ S+  ++   DLEI+
Sbjct: 526 DRKSASTKNDTDSDDLEII 544

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  411 bits (1056), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 238/588 (40%), Positives = 342/588 (58%), Gaps = 32/588 (5%)

Query: 6   DPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLERVE 65
           DPREVL  D++D++TS+ +E+ +I+                   K +  K    +L  ++
Sbjct: 3   DPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSHIQ 62

Query: 66  VPASPKEERXXXXXXXXXXXXXGITLAANSNNDSIEVPWKNGPSNTTSYFVENFVNARKV 125
           V +SPK+                  +   + N+      +  P+NTTS+F+E +  +++ 
Sbjct: 63  VESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTSKRK 122

Query: 126 EEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIMRE 185
           ++ +++ +  LLS RVHTF+G       +P+  +E E +S   IS+RY+   E   I   
Sbjct: 123 QDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSIFAN 182

Query: 186 IKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFTHN 245
           IK+LRL KLF+KV+PPKF EP Y+NW  IG+IS K EVK TS++ P KYFK TLT+F ++
Sbjct: 183 IKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNFQYS 242

Query: 246 LDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHNFD 305
           +D YIF  + VE+YYNLRVGDIIAILNP +LPWRPS           +KSFNL I H F+
Sbjct: 243 IDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAH------IKSFNLRISHKFE 296

Query: 306 CVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGSTS 365
           C+LEIG S+DLG+C + NK+  + C APIN+   D CEYH++++FR  NA+RVEL+G+ +
Sbjct: 297 CILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYA 356

Query: 366 LRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGESQ--------NTLFFSNPNYAK 417
           L +P +   + ALY     ++ L            DG S         N   FSN N AK
Sbjct: 357 LGAPTRIDAQPALYRGGSSQKNLNY---NIITNGADGGSNKEINPLDINARHFSNRNAAK 413

Query: 418 AFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMK 477
           AFFD+ +QNP+ L NLENKRRKL+D+ K     N LN  + K       +KS EE  ++K
Sbjct: 414 AFFDERFQNPETLRNLENKRRKLRDNRK----SNILNRELKKNSELDIKHKSAEEIDEIK 469

Query: 478 DATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSG--LNSKSSQVKEIMSFKKSNVSL 535
             TE  + SG+++++GFDP +GK+  V K  ++ +    L  K S V  ++SFKK NV L
Sbjct: 470 RTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSSVASLLSFKKDNVKL 529

Query: 536 APSKAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583
            PSK    K+  RRE+VW+EHF +    ++K       + SDSDLEIV
Sbjct: 530 KPSKEILIKQKRRRERVWKEHFGSG--GDEK-------DDSDSDLEIV 568

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  397 bits (1021), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 239/610 (39%), Positives = 340/610 (55%), Gaps = 62/610 (10%)

Query: 4   ETDPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQ---- 59
           + DPREV  LD +  ++ D+ E                        +  RK   +Q    
Sbjct: 6   DNDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPN 65

Query: 60  -----SLERVEVPASPK------EERXXXXXXXXXXXXXGITLAANSNNDSIEVPWKNGP 108
                S  RVEVP SPK      +E                   AN N + I V  +   
Sbjct: 66  MKNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKKANPNEEDI-VRKELDV 124

Query: 109 SNTTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFN 168
             TTSYF   F N++  E + +     ++S R HTF G  SL  ++ +  DE E YS F+
Sbjct: 125 VATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFH 184

Query: 169 ISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSS 228
           I +RY+   E+D+++  IK+LRL KLF+KVRPP F+EP Y+NWVAIG IS K +VKLT++
Sbjct: 185 IKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNA 244

Query: 229 SKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEF 288
           +KP KYFK TLTDF HNLD+Y+F  K VE+YYNLRVGDIIA+LNP+ILPWRPS   N   
Sbjct: 245 AKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNG-- 302

Query: 289 SGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDR-CEYHQD 347
               +KSFNL I H+F+C+LEIG S+DLG+C++ N    K C +PIN   TDR CE+H++
Sbjct: 303 ----IKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPIN-TKTDRCCEFHRE 357

Query: 348 VRFRHVNAQRVELNGSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGESQNT 407
           ++ R   ++R+EL+GS +L +P K G + ++Y  +   R     P KH   +  G     
Sbjct: 358 LQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTN--PAKHKMFSITGHGSKK 415

Query: 408 L-----------FFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSA 456
                        FSN   AKAFFDDS+Q+P +L NLE+KRRK+K S+ +R L   LN  
Sbjct: 416 EQEKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALN-- 473

Query: 457 IGKTGYQSFNNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVL---KFGKNVNS 513
            G+   QS N      ++Q+K+ TE+ L +G+++ +GFDP  G++ +VL   +  K  + 
Sbjct: 474 -GEDASQSKN------KQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDP 526

Query: 514 GLNSKSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSS 573
            ++ K   + +++ FKK  + L PS+  Q ++  RRE +W++HF               +
Sbjct: 527 TISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQ-------------DT 573

Query: 574 ESSDSDLEIV 583
             SDSDLEIV
Sbjct: 574 NDSDSDLEIV 583

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  397 bits (1020), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/623 (36%), Positives = 344/623 (55%), Gaps = 51/623 (8%)

Query: 4   ETDPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLE- 62
           E DPR+V+  D +D +TSDEDE++KI+                   K +  K    +L+ 
Sbjct: 2   ELDPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQL 61

Query: 63  RVEVPASP-----------KEERXXXXXXXXXXXXXGITLAANSNNDSIEVPWKNGPSN- 110
            V+VP+SP           ++ R              +  A   N +       +G    
Sbjct: 62  DVQVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGK 121

Query: 111 -----TTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYS 165
                TTSYF+E F  ++K E+ +I+ + ++LS RVHTF+G+D  K  Q   V+E E +S
Sbjct: 122 QSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVD--KEFQLEAVNELEQFS 179

Query: 166 GFNISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKL 225
              IS+RY+    L+E +R++K+LRL KLF+KVRPPKF EP Y+NW  + IIS KSEVK 
Sbjct: 180 DLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKF 239

Query: 226 TSSSKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNN 285
           T+S  P K+ + TLT+F   LD+++F +  V++YYNLR GDI+A+LNP+ILPWRPS  + 
Sbjct: 240 TTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQ 299

Query: 286 DEFSGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYH 345
              S   +KSFNL I H F C+LEIG S+DLG+C +  K + + CG+ IN A    CEYH
Sbjct: 300 QTTS---IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYH 356

Query: 346 QDVRFRHVNAQRVELNGSTSLRSPVKNGKKQALYGTSGVK-------------RKLQLLP 392
           ++++ R  +++R++LNG  +L +P K G +  L+  +  +             ++    P
Sbjct: 357 RELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEP 416

Query: 393 DKHAPQAQDGESQNTL-----FFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKER 447
             ++   Q G S+        FF++ N AKAFFDD +QNPDML+NL+ KRRKL+DS+K R
Sbjct: 417 SWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSR 476

Query: 448 TLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLK- 506
            L  +L   + K   ++  +K+  E   +K  TE  L++GL++ +GFDP  G+   V+K 
Sbjct: 477 QLDRKLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKK 536

Query: 507 ------FGKNVNSGLNSKSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTE 560
                  G N +  L+ K + V E++ +K+   +L PS+ +   R   R +VWRE F  +
Sbjct: 537 RDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKK 596

Query: 561 KLANQKQKKTPSSESSDSDLEIV 583
                 Q   P       DLEIV
Sbjct: 597 GTPVDSQ---PVDNDDSDDLEIV 616

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  336 bits (861), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/588 (34%), Positives = 312/588 (53%), Gaps = 25/588 (4%)

Query: 5   TDPREVLQLDVHDIVTSDEDEDTKIKXXXXXXXXXXXXXXXXXXXKASRKKAQRQSLERV 64
           TDPRE+   D ++ ++ DE E  ++K                      ++  +  + + +
Sbjct: 6   TDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDSI 65

Query: 65  EVPASPKEERXXXXXXXXXXXXXGIT----LAANSNNDSIEVPWKNGPSNTTSYFVENFV 120
           +VP SPK+                +        N N D +    K     TTSYF E   
Sbjct: 66  DVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKK--LGTTSYFTEKLR 123

Query: 121 NARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELD 180
           +    E + I+ +  LL+ RV+TF G D     +P+ VDEK+  SG  I RRY+  + L 
Sbjct: 124 SINTNEHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVIDRRYVPLAVLR 182

Query: 181 EIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLT 240
           +  + IKVLRLPKLFSKVR PKF+EPDY NW+ +GIIS K+E ++T+S KP K+F +T++
Sbjct: 183 KHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLTIS 242

Query: 241 DFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSI 300
           DF   L++  F    VEKYY LR+GD+IAILNP+I+P +  +      + P   +F+L +
Sbjct: 243 DFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAG----ASPSYATFSLKV 298

Query: 301 RHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVEL 360
             + + +LE+G SK+ G C+   K   K CGAPIN+   + C YH++ + R  +++RVE+
Sbjct: 299 SKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEI 358

Query: 361 NGSTSLRSPVKNGKKQAL----YGTSGVKRKLQLLPDKHAPQAQDGESQNTLFFSNPNYA 416
           + S ++R+PV  G +Q +    +       + Q  PDK   +       N   FS+ N +
Sbjct: 359 SSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANAS 418

Query: 417 KAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQM 476
            AFFDD Y+NPD+L NL+NKRRK+++    R L+ +L     K   +    + +  Q+  
Sbjct: 419 TAFFDDDYENPDILANLDNKRRKIQELRNNRNLEKKLKGLSDKLLSKK---EDRVNQEAK 475

Query: 477 KDATEQVLNSGLLRDIGFDPFRGKMR-EVLKFGKNVNSGLNSKSSQVKEIMSFKKSNVSL 535
           K AT  +   GL   IG+DP +GK   E+L++     +  N K   + +I + KK NVSL
Sbjct: 476 KTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKNDKQLAITDICNIKKDNVSL 535

Query: 536 APSKAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583
            PSK + K+++ +R  ++ E      +    Q++    E S  DLEI+
Sbjct: 536 KPSKKQLKEKIEKRNAIFNE------IMKGSQERLDKDEGSSDDLEII 577

>NDAI0B05300 Chr2 (1294623..1298330) [3708 bp, 1235 aa] {ON} Anc_1.90
            YGL140C
          Length = 1235

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 175  STSELDEIMREIKVLRLPKLFSKVRPPKF---TEPDYANWVAIGIISFKSEVKLTSSSKP 231
            +T E+ E M E+  LRL KL   V   K+   + P Y +W A  +  F + + +TSS+K 
Sbjct: 1041 ATEEIVEYMEEL--LRLTKLLVGVNEFKYGFLSRPLYEDWAAEAVTGFDAFINVTSSNKK 1098

Query: 232  S 232
            S
Sbjct: 1099 S 1099

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 248 IYIFNNKNV--EKYYNLRVGDIIAILNPDILPWRPSQVNNDE-FS--GPVVKSFNLSIRH 302
           +Y FNN +V  ++    R+G +   ++PD+L W  S + +DE F+    VV S N+    
Sbjct: 83  VYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSSLPDDEKFTDENTVVLSLNVKCTR 142

Query: 303 NFD 305
           N D
Sbjct: 143 NLD 145

>Kwal_26.9597 s26 (1282870..1283733) [864 bp, 287 aa] {ON} YGR277C -
           Protein required for cell viability [contig 363] FULL
          Length = 287

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 50/118 (42%), Gaps = 8/118 (6%)

Query: 212 VAIGIISFKSEVKLTSSSKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAIL 271
           +AI + S ++   L    +  K    +LT+   +LDI I +  + ++Y +  +G + +  
Sbjct: 4   IAIALCSLRT-TDLEKLKESLKTVLSSLTEVASSLDIIITDKIHSQEYLDYVLGKLYSTT 62

Query: 272 NPDILPWRPSQVNNDEFSGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKA 329
              +L W       D +  P+   FNLS+        ++    D    R P+K  +K 
Sbjct: 63  REVLLEW-------DLYETPINVMFNLSVSSYMKYEWDLLIVDDQDAKRFPHKQIKKV 113

>TBLA0I03540 Chr9 complement(847840..849300) [1461 bp, 486 aa] {ON}
           Anc_3.581 YGL253W
          Length = 486

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 62/145 (42%), Gaps = 9/145 (6%)

Query: 321 IPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGSTSLRSPVKNGKKQALYG 380
           IP    + A   P N      CEY       HV   R + +     +SP + G++     
Sbjct: 247 IPKLEGKLADDIPANAPFAINCEYGS-FDNEHVALPRTKYDVMVDEQSP-RPGQQTFEKM 304

Query: 381 TSG--VKRKLQL-LPDKHAP----QAQDGESQNTLFFSNPNYAKAFFDDSYQNPDMLNNL 433
           +SG  +   L+L L D HA     + QD    N  +  + +Y   F DD ++N + +  +
Sbjct: 305 SSGYYLGELLRLVLVDLHAQGFILKDQDLTKLNVPYCMDTSYPSRFEDDPFENLENVAEI 364

Query: 434 ENKRRKLKDSEKERTLQNQLNSAIG 458
             K   +K +  ER L  +L+ AIG
Sbjct: 365 FEKDFGIKTTSPERKLIRKLSEAIG 389

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,774,563
Number of extensions: 2860469
Number of successful extensions: 10122
Number of sequences better than 10.0: 174
Number of HSP's gapped: 10586
Number of HSP's successfully gapped: 177
Length of query: 583
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 468
Effective length of database: 40,294,809
Effective search space: 18857970612
Effective search space used: 18857970612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)