Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E01012g5.704ON38638620560.0
Kwal_55.196885.704ON39338511811e-161
SAKL0E14960g5.704ON3843868921e-117
ZYRO0G06556g5.704ON3793737821e-101
NCAS0A031905.704ON3984007481e-95
TDEL0B021605.704ON3753637242e-92
KNAG0C066105.704ON3863897219e-92
KLLA0A00550g5.704ON3803186922e-87
KAFR0H002005.704ON3893856871e-86
AFR288C5.704ON4653376913e-86
CAGL0G02519g5.704ON3783226843e-86
TPHA0D046205.704ON4063976412e-79
NDAI0E050505.704ON4513605702e-68
Kpol_YGOB_Anc_5.7045.704ON2072054265e-50
Ecym_31386.48ON588230930.007
KNAG0M011106.48ON598132820.12
SAKL0H18986g8.188ON89389760.78
KLLA0F00660g8.599ON137497713.2
Kwal_14.23134.45ON151734704.1
Suva_12.1211.463ON110853704.3
SAKL0E02068g6.48ON558113686.3
KLTH0H07678g8.188ON86182686.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E01012g
         (386 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   796   0.0  
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   459   e-161
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   348   e-117
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   305   e-101
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    292   1e-95
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    283   2e-92
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   282   9e-92
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   271   2e-87
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      269   1e-86
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   270   3e-86
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   268   3e-86
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   251   2e-79
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   224   2e-68
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   168   5e-50
Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}...    40   0.007
KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {...    36   0.12 
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    34   0.78 
KLLA0F00660g Chr6 (54232..58356) [4125 bp, 1374 aa] {ON} similar...    32   3.2  
Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310...    32   4.1  
Suva_12.121 Chr12 (178103..181429) [3327 bp, 1108 aa] {ON} YJR03...    32   4.3  
SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} simila...    31   6.3  
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    31   6.9  

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/386 (100%), Positives = 386/386 (100%)

Query: 1   MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQLTRGQKDILIVD 60
           MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQLTRGQKDILIVD
Sbjct: 1   MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQLTRGQKDILIVD 60

Query: 61  SIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFL 120
           SIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFL
Sbjct: 61  SIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFL 120

Query: 121 SGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLT 180
           SGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLT
Sbjct: 121 SGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLT 180

Query: 181 PRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYP 240
           PRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYP
Sbjct: 181 PRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYP 240

Query: 241 LEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSK 300
           LEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSK
Sbjct: 241 LEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSK 300

Query: 301 IMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQPQ 360
           IMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQPQ
Sbjct: 301 IMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQPQ 360

Query: 361 DQKFDGRIRIQFLKNFSSFELNVMVP 386
           DQKFDGRIRIQFLKNFSSFELNVMVP
Sbjct: 361 DQKFDGRIRIQFLKNFSSFELNVMVP 386

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  459 bits (1181), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 292/385 (75%), Gaps = 1/385 (0%)

Query: 1   MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQL-TRGQKDILIV 59
           M Q+VEVPLV +  TQF   VET+ +K  SFSL+  PN+   A+LDP+L +R + DIL+V
Sbjct: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVV 60

Query: 60  DSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIF 119
           DSIKSGTGRD +N+F  NV++P+FT LG+ ++VV+T++ ++  +LG  F+P  +NT +IF
Sbjct: 61  DSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIF 120

Query: 120 LSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQL 179
           LSGDT+ISEF+N L +     +R T++L+ LPLGTGNAWANSLG R  A +L+ FLQG L
Sbjct: 121 LSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFL 180

Query: 180 TPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKY 239
            P+ FPLYKA FPNG+E++FFIILSIGFHANLLHLC Q RF+ LGVERF++AS EI + Y
Sbjct: 181 KPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDY 240

Query: 240 PLEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVS 299
            L+Y LQV+  P   YSYFALINTPNLE +YKPSP+SN L  +LH+LGYSS L Q  L++
Sbjct: 241 ILDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLIN 300

Query: 300 KIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQP 359
           +IMKGYSN+   DI+ +GV Y+ +++ L+VVF Q PE V  + F+ICCDGHLLNMLS QP
Sbjct: 301 RIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQQP 360

Query: 360 QDQKFDGRIRIQFLKNFSSFELNVM 384
               FDGRI ++FLK  SSF L V+
Sbjct: 361 AHGSFDGRIHVKFLKEHSSFHLKVL 385

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  348 bits (892), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 169/386 (43%), Positives = 244/386 (63%), Gaps = 3/386 (0%)

Query: 1   MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQLTRGQKDILIVD 60
           M + V  PL+    T +   +E D + Y+SF L +       +SL   L     +++I+D
Sbjct: 1   MAKAVNKPLLQIGSTLYSVDIEKDGSVYSSFVLKAEKLSTVSSSL-ISLPSANSELIILD 59

Query: 61  SIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFL 120
           S+ SG GR ++ +F   V++P+   LG  HK+++TQ S +  +     +PS   TI IFL
Sbjct: 60  SVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTI-IFL 118

Query: 121 SGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLT 180
           SGDT+ISEFLN +  +     +H L++ P+P+GTGNAWA+SL L+CP  S   FL+  L 
Sbjct: 119 SGDTSISEFLNHIPTQNSNS-KHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLI 177

Query: 181 PRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYP 240
             KFPLY+A+FPNG+  IFFIILSIGFHANLLHLC   +++ +GVERFK AS +I + Y 
Sbjct: 178 ASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYD 237

Query: 241 LEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSK 300
           L+Y++ +    +  Y+YFA+INTPNLE +YKPSP S+ L   LH+LG+ S L+ + L+ +
Sbjct: 238 LKYKVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKR 297

Query: 301 IMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQPQ 360
           I +G + + GDDI   GVIYE      ++V +  P       FEICCDG LLN+L +Q  
Sbjct: 298 ITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGT 357

Query: 361 DQKFDGRIRIQFLKNFSSFELNVMVP 386
           +  FDG I++ FL+++S F L V+ P
Sbjct: 358 EGSFDGTIKVSFLQDYSPFNLKVLSP 383

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  305 bits (782), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 167/373 (44%), Positives = 226/373 (60%), Gaps = 15/373 (4%)

Query: 16  QFWACVETDDNKYTSFSL-VSRPNEYGDASLDPQLTRGQKDILIV-DSIKSGTGRDSRNN 73
           +++     D +KYTSF L  S   +   AS     TR     LIV DS+KSG GR   N+
Sbjct: 14  EYYVTFAKDGSKYTSFQLEKSHAKQSSRAS-----TRSDDSTLIVLDSLKSGIGRTENND 68

Query: 74  FGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFLSGDTTISEFLNGL 133
           F   V+ P+   L   H  ++T   D+  Q   +  P  +  I I +SGDTTISEF N L
Sbjct: 69  FYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWI-ISGDTTISEFCNNL 127

Query: 134 -NRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLTPRKFPLYKATFP 192
            N+++    R+ L ++PLP+GTGNAWANSLG   P  +   +L   L PR  PLY+A  P
Sbjct: 128 PNKKI---TRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALP 184

Query: 193 NGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYPLEYRLQVSGLPT 252
           NG+ +IFF+I S+GFHANLLH C+  ++  +G ERF+IA+  IL+ Y L+  + + GL  
Sbjct: 185 NGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLDGL-R 243

Query: 253 RDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSKIMKGYSNRAGDD 312
           R Y+YFALINTPNLEA+YKPSP+SN L  +L +LGYSS L +  LV KIM+GY N+   D
Sbjct: 244 RSYAYFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLGRQELVEKIMQGYQNKPNGD 303

Query: 313 I-SGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQ-PQDQKFDGRIRI 370
           + + + +IY+   H   +V +   E+ S   FEICCDG LLN+L  Q P   K    IR 
Sbjct: 304 LPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRF 363

Query: 371 QFLKNFSSFELNV 383
           QFL ++S F+L V
Sbjct: 364 QFLNDYSGFQLQV 376

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  292 bits (748), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 156/400 (39%), Positives = 238/400 (59%), Gaps = 19/400 (4%)

Query: 1   MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQLT----RGQKDI 56
           M + ++  L++     ++     + + Y SF+L+    +    S+D +L     +    +
Sbjct: 1   MSKSIKQYLLTIDHDHYYVETVLEGSAYKSFNLLIE--DSTPLSVDRKLQFVPLKDTAQL 58

Query: 57  LIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTI 116
           +++DSI SG GR S N+F +NV+EP+F  L + H +V+T   D+           T++  
Sbjct: 59  IVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLD-LTKHYE 117

Query: 117 LIFLSGDTTISEFLNGLNRRVFE--GLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCF 174
           + FLSGDTTISEF+NGL ++  +    +++LS++P P GTGNA ANSLGL CP    S +
Sbjct: 118 IFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNY 177

Query: 175 LQGQLTPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLE 234
           L    +   FPLYKA FPNG E++FF+ILS+GFHANLLH C+   ++ LGVERF+IAS +
Sbjct: 178 LTSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASED 237

Query: 235 ILQKYPLEYRLQVSG-------LPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLG 287
           IL  Y L+  + +         +P+R+YSYF ++NTP LEA Y PSPQSN L  QLH++ 
Sbjct: 238 ILANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIA 297

Query: 288 YSSKLQQASLVSKIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICC 347
           YSS L +  L+++I+KGY N  GD ++  GV Y P      +  +   E   ++ F++CC
Sbjct: 298 YSSSLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCC 357

Query: 348 DGHLLNMLSLQPQDQK---FDGRIRIQFLKNFSSFELNVM 384
           DG L N+     ++      +  I I+FL  +S F+L++M
Sbjct: 358 DGLLFNLNDFIHKNDNGPCKNNEILIEFLSTYSPFQLSLM 397

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  283 bits (724), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 146/363 (40%), Positives = 227/363 (62%), Gaps = 16/363 (4%)

Query: 31  FSLVSRPNE-------YGDASLDPQLTRGQKDILIVDSIKSGTGRDSRNNFGKNVLEPLF 83
           +S++S P+E           + D +  + Q +++++DS+ SG GR ++N+    V++P+F
Sbjct: 17  YSVISEPSESRFQLVKTATTTEDDRTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIF 76

Query: 84  TLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFLSGDTTISEFLNGLNRRVFEGLRH 143
             + I H++++T   D       T   S  +T+L FLSGDT+ISEF+N L +        
Sbjct: 77  EAVNIDHRLIKTTSRDTIASYASTLDISQSHTVL-FLSGDTSISEFINNLPQGAPSA--- 132

Query: 144 TLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLTPRKFPLYKATFPNGFEMIFFIIL 203
            LS++  P+G+GNAWA+SLG+ CP  +   F++G+++   FPLYKA FPNG+ ++FFIIL
Sbjct: 133 NLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVFPNGYSIVFFIIL 192

Query: 204 SIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYPLEYRLQVSGLPTRDYSYFALINT 263
           S+GFHANL+H C++  +Q +G+E+F++A   IL++Y L+ ++ V+ L    YSYFALINT
Sbjct: 193 SMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVNSL-AASYSYFALINT 251

Query: 264 PNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSKIMKGYSNRAGDDISGDG-VIYEP 322
           PNLE +Y+PSP+S+ L  +L++LGYSS L +   ++K+MKGY     D +  D   IY P
Sbjct: 252 PNLEPAYRPSPESDPLKEELYLLGYSSGLSKDQFLTKVMKGYELGPSDKLPLDSDTIYVP 311

Query: 323 YNHALEVVFDQVPENVSNTY-FEICCDGHLLNMLSLQPQDQKFDGRIRIQFLKNFSSFEL 381
           +    +V  D  P   S  Y  EICCDG LLN+  LQ  D +   +  I+FL ++S F +
Sbjct: 312 FTKGFDVTLD-FPLLESPRYKSEICCDGVLLNLQDLQ-ADLEVSNKFSIEFLNHYSKFNI 369

Query: 382 NVM 384
             M
Sbjct: 370 KAM 372

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  282 bits (721), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 155/389 (39%), Positives = 241/389 (61%), Gaps = 11/389 (2%)

Query: 1   MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQL-TRGQKDILIV 59
           M   V   LV     +    ++ D +KYT F+L+S P     A   PQL TR  ++++++
Sbjct: 1   MITTVRKHLVDFCGERISVEIDKDGSKYTKFALLSEPCPQECAP--PQLFTR--ENLIVL 56

Query: 60  DSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIF 119
           DS+ SGTGR S N+   NV+EP+   L   ++VV++Q+S +  + G+   P+   TIL F
Sbjct: 57  DSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTIL-F 115

Query: 120 LSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQL 179
           +SGDT++SEF NG+   V    R +L+++P+ +GTGNA ANSL L CP  + + FL+G+L
Sbjct: 116 VSGDTSVSEFFNGVGAGV-PSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGEL 174

Query: 180 TPRKFPLYKATFPNG-FEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQK 238
              +FPLY+A  P+G   ++FFI+LS+GFHANLLH  + ++++S+GVERF+ AS +ILQ 
Sbjct: 175 VTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQN 234

Query: 239 YPLEYRLQVSGLPTR-DYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASL 297
           Y L+ ++ +        Y+YFAL+N PNLEASY PSPQS+    +LH+L YSS L +  L
Sbjct: 235 YKLQEQITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQL 294

Query: 298 VSKIMKGYSNRAGDDISGDG-VIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLS 356
           + +IM GY NR GD+++ D    Y+  +   E+      E  ++  FE+C DG L N+L 
Sbjct: 295 LERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQ 354

Query: 357 LQPQDQKFDGRIRIQFLKN-FSSFELNVM 384
            +    + +  I+++ + +   SF++ VM
Sbjct: 355 YKSDQHQEELTIQVELIDSALGSFDILVM 383

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  271 bits (692), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 200/318 (62%), Gaps = 11/318 (3%)

Query: 55  DILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTEN 114
           ++LIVDS+ SG+GRD   +F  NV+   F  + +P+++++T    +  +L  +   + + 
Sbjct: 60  ELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQY 119

Query: 115 TILIFLSGDTTISEFLNGLNRRVFEGLRH-TLSLVPLPLGTGNAWANSLGLRCPAASLSC 173
           T+L FLSGDT+ISEF+N L       L H  +S++P P+GTGNAWA+SL L  PA   S 
Sbjct: 120 TVL-FLSGDTSISEFVNNL------PLNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQ 172

Query: 174 FLQGQLTPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASL 233
           F+ G+L+   FPLY+ATF NG+ + FFIILS+GFHANLLHLC++  +Q +G+ERF++AS 
Sbjct: 173 FVNGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQ 232

Query: 234 EILQKYPLEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQ 293
            IL++Y LE R+ +  +    +SYFALINT NLE +Y PSP S+ L  QLHVL Y S L 
Sbjct: 233 RILREYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLD 292

Query: 294 QASLVSKIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLN 353
           +     ++  GYSN    +I  +G  Y P      V     P   SN  FE+CCDG LLN
Sbjct: 293 RVEFQKRVFMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDPSQKSN--FEVCCDGQLLN 350

Query: 354 MLSLQPQDQKFDGRIRIQ 371
           +L L+ ++      IRI+
Sbjct: 351 LLELEGKNTP-PSTIRIE 367

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  269 bits (687), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 153/385 (39%), Positives = 233/385 (60%), Gaps = 14/385 (3%)

Query: 8   PLVSTAKTQ-FWACVETDDNKYTSFSLVSRPNEYGDASLDPQLTRGQKDILIVDSIKSGT 66
           PL +   +Q F   +  D +KY +F LV++  E  D    P      ++++++DS+ SGT
Sbjct: 10  PLCTVNGSQSFEVKITKDGSKYHAFKLVAK--EVKDDK--PCSPPHYENVVVIDSVSSGT 65

Query: 67  GRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFLSGDTTI 126
           GR+  N+F   V++P+F +  I H   +T    +      +   S   T+ IF+SGDT+I
Sbjct: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTV-IFISGDTSI 124

Query: 127 SEFLNGLNR--RVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLTPRKF 184
           SEF+N L        GL+HT+S++PLP+GTGNA+++S+G +CP  +LS FL  +  P  F
Sbjct: 125 SEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHF 184

Query: 185 PLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQ-RFQSLGVERFKIASLEILQKYPLEY 243
           PLY+  FPNG  +IFFIILS+G HAN+LHLC+   +++  G ERFK+A  +++  Y L  
Sbjct: 185 PLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNV 244

Query: 244 RLQVSGLP-TRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSKIM 302
           RLQ+  L  +  +SYF LINTPNLE+SY PSP S+    QLHVLGYSS L    L++ + 
Sbjct: 245 RLQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVT 304

Query: 303 KGYSNRAGDD-ISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQPQD 361
           +GYSN+ GD+ +    ++Y+P +  + +V  +  E+    Y +ICCDG L N+  + P++
Sbjct: 305 QGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEESEKYKY-DICCDGLLFNLRDMLPEN 363

Query: 362 -QKFDGRIRIQFLKNFS-SFELNVM 384
             K D  ++  F    S  FE+ V+
Sbjct: 364 PTKEDYVLKTNFKSRDSLPFEVQVL 388

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  270 bits (691), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 141/337 (41%), Positives = 209/337 (62%), Gaps = 18/337 (5%)

Query: 56  ILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENT 115
           ++++DS++SG GR+   +F   V+ P+  +L + H+ VRT  + +  +L  TF  ++E T
Sbjct: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196

Query: 116 ILIFLSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFL 175
           +L+ +SGDTTISEF+N L      G    +++  LPLGT NAWA+S+GL  PA +L  F+
Sbjct: 197 VLV-MSGDTTISEFVNAL------GSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAFV 249

Query: 176 QGQLTPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEI 235
           QG++    FPLY+A FP+G+ + FFI+LS GFHANLLHLC  +R+Q LGVERF+ AS EI
Sbjct: 250 QGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEI 309

Query: 236 LQKYPLEYRLQVSGLPTRD-----YSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSS 290
           L +Y L   ++V      +     Y+YFAL+NTP+LE +Y PSP S+ L  QLHVL + +
Sbjct: 310 LDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEA 369

Query: 291 KLQQASLVSKIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQ-VPENVSNTYFEICCDG 349
           +L +  L   +M GYS   G  +S  G++Y     +  +  +    + V+N   E+C DG
Sbjct: 370 ELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN---ELCVDG 426

Query: 350 HLLNMLSLQPQDQKFDGRIRIQFLKNFSSFELNVMVP 386
           HLLN++ LQ     FDG I +  +   +SF L  +VP
Sbjct: 427 HLLNLVDLQAPGDVFDGSIEVGVVP--ASFGLKALVP 461

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  268 bits (684), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 133/322 (41%), Positives = 205/322 (63%), Gaps = 6/322 (1%)

Query: 56  ILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGH--TFQPSTE 113
           I+++DS+KSGT R+ R++  K V+EPLF  LG+ +K ++T+  ++        +FQ   +
Sbjct: 51  IIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFK 110

Query: 114 NTILIFLSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSC 173
             IL FLSGDT+ISEF+N L+  +    ++ +S++P+PLG+GNA A SLG + P  +L  
Sbjct: 111 YDIL-FLSGDTSISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALIT 169

Query: 174 FLQGQLTPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASL 233
           +L         PLY A  PN   MIFFIILS+GFHANLLH  +  +++S+GVERF++AS 
Sbjct: 170 YLNSNKKCSPLPLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASK 229

Query: 234 EILQKYPLEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQ 293
            + + Y L   + V+GL ++ YSYFA+I  PNLE +YKPSP+S+ L  +LH+LGY + + 
Sbjct: 230 TVFESYDLNVGIAVNGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGIC 289

Query: 294 QASLVSKIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLN 353
              L  KIM+GY N+ G+DI   G IY+ +   LE+   +   N     +++C DG+LLN
Sbjct: 290 LEDLQDKIMRGYHNKDGEDIQEIGTIYQCFQKNLELSI-KTGHNAPKYRYDMCIDGYLLN 348

Query: 354 MLSLQPQDQKFDGRIRIQFLKN 375
           +     +D ++  +I I+F+ +
Sbjct: 349 LEDCNSKDNEY--KILIRFIDD 368

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  251 bits (641), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 147/397 (37%), Positives = 213/397 (53%), Gaps = 19/397 (4%)

Query: 7   VPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQLTRGQKDILIVDSIKSGT 66
           + LV      +    E   +KY+SF L S       A+L+        +++++DSI SG 
Sbjct: 11  LKLVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGV 70

Query: 67  GRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFLSGDTTI 126
           GR  +N+F  NV++P+F      HK +RT+  D+   L   F+ S + TI IFLSGDT++
Sbjct: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTI-IFLSGDTSV 129

Query: 127 SEFLNGLNRRVFEGL------RHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLT 180
           SEF+N L +   E        +  +++  +PLGTGNA A+S+ L  P      FL  +L 
Sbjct: 130 SEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELI 189

Query: 181 PRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYP 240
            + FPLY  T PN   +IFFII S+GFHANLLH C    +Q +G ERF  AS  I + Y 
Sbjct: 190 IKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNYD 249

Query: 241 LEYRLQV---SGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASL 297
           L   L     S   +R+Y+YFA+INTPNLE +Y PSP S+    +LH+LGY + L    L
Sbjct: 250 LNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKL 309

Query: 298 VSKIMKGYSNRAGDDISGDG--VIYEPYN---HALEVVFDQVPENVSNTY-FEICCDGHL 351
           V+KIM GYS +  + I+       Y P N     L+++ +   +     Y ++ICCDG L
Sbjct: 310 VNKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKYKYDICCDGLL 369

Query: 352 LNMLSLQPQD---QKFDGRIRIQFLKNFSSFELNVMV 385
           LN+  +  Q    +    +I I    N  +F+LN+  
Sbjct: 370 LNLDDINNQHGVAESNKNKITISKFPNDLNFQLNLFA 406

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  224 bits (570), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 191/360 (53%), Gaps = 36/360 (10%)

Query: 42  DASLDPQLTRGQKDILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAA 101
           D  L+    +    ++I+DS  SG GR+  N+F   ++EP+ + L I  ++ +T   D+ 
Sbjct: 70  DLILNSDYEKNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSI 129

Query: 102 GQLGHTFQPSTENTI-----LIFLSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGN 156
               + F   T++T      LIFLSGDTTISEF N L  +  +  +  L+++ +P+GT N
Sbjct: 130 KSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTAN 189

Query: 157 AWANSLGLRCPAASLSCFLQGQLTPRKFPLYKATFPNGF-------------EMIFFIIL 203
           AW+NSL L CP      FL  +LT   FPLY    P+                + FFI+L
Sbjct: 190 AWSNSLNLNCPIDIFQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVL 249

Query: 204 SIGFHANLLHLC-KQQRFQSLGVERFKIASLEILQKYPLEYRLQVSGLPTR-------DY 255
           S+GFHANLLHLC   +++ +LG+ERFK+AS EIL  Y L   + +     +        +
Sbjct: 250 SMGFHANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSF 309

Query: 256 SYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSK-LQQASLVSKIMKGYSNRAG---- 310
           SYF L+NTP LE +Y PSP S+ L   LHVL Y S    +  L+  IMKGYSN  G    
Sbjct: 310 SYFNLMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNI 369

Query: 311 DDISGDGVIYEPYN-HALEVVFDQVPENVSNTY----FEICCDGHLLNMLSLQPQDQKFD 365
            +I  DG+IY P N    ++  +      S+      +E+CCDG L N+L+ Q    K D
Sbjct: 370 QNIDEDGIIYFPINDKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQTNQGKQD 429

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  168 bits (426), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 127/205 (61%), Gaps = 16/205 (7%)

Query: 189 ATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYPLEYRLQVS 248
           ATFP+   + FFIILS+GFHA LLH C +     +G ERF++A+ EIL+ Y L+  ++V+
Sbjct: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61

Query: 249 GLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSKIMKGYSNR 308
              TR Y+YFA+INT NLE +Y PSP+SN L   L +LGYSSKL +A LV KIMKGY  R
Sbjct: 62  K-STRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120

Query: 309 AGDDISGDGVIY----EPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQPQDQKF 364
            GD I  D   Y    +     ++++ D+   N +   FEICCDG LL+++      +K 
Sbjct: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLM------EKS 174

Query: 365 DGR-----IRIQFLKNFSSFELNVM 384
            GR     I I  +K++ SF+L V+
Sbjct: 175 KGRTDNLTIHINSVKDYLSFDLQVL 199

>Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR256W
          Length = 588

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 97/230 (42%), Gaps = 20/230 (8%)

Query: 50  TRGQKDILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQ 109
           T+  K IL++ +   G GR ++    K   +P+    G   +V +T   + A ++  T  
Sbjct: 197 TKRNKSILVIINPHGGRGRANKIYVTK--AKPILIASGCYVEVFQTSYPEHAIEIARTMD 254

Query: 110 PSTENTILIFLSGDTTISEFLNGLNRRVFEGLR-HTLSLVPLPLGTGNAWANSL-GLRCP 167
               + I    SGD    E LNGL RR       + +++  LP G+GNA + S  G   P
Sbjct: 255 IDKYDVIAC-ASGDGIPYEVLNGLYRREDRAKAFNKVAVTQLPCGSGNAMSVSCHGTNNP 313

Query: 168 A-ASLSCFLQGQLTPRKFPLYKATFPNGFEMIFF-----IILSIGFHANLLHLCKQQRFQ 221
           A A+LS     ++        + ++ +G  + F      +I     +   L      RF+
Sbjct: 314 AYAALSLVKAVEVRMDVMCCSQPSYLDGPRLSFLSQTYGVIAESDINTEFLRWIGPARFE 373

Query: 222 SLGVERFKIASLEILQ--KYPLEYRLQVSGLPTRDYSYFALINTPNLEAS 269
            LGV      +L I Q  KYP E  ++ +     +   + L++   ++ S
Sbjct: 374 -LGV------TLNIFQRRKYPCEIYVKYAAKSKNELKDYYLLHKARIKQS 416

>KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {ON}
           Anc_6.48 YOR171C
          Length = 598

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 62/132 (46%), Gaps = 7/132 (5%)

Query: 50  TRGQKDILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQ 109
            R  K +L++ +   G G+ ++N F +    P+    G  + +  T+ S  A ++  +  
Sbjct: 186 ARRNKKMLVIINPFGGKGQ-AKNLFFQRA-APILDASGSDYDIAYTERSRHAVEIAESLD 243

Query: 110 PSTENTILIFLSGDTTISEFLNGLNRRVFE-GLRHTLSLVPLPLGTGNAWANSL--GLRC 166
               +TI +  SGD    E LNGL RR+      + + +  LP G+GNA + S    +  
Sbjct: 244 IDKYDTI-VCASGDGIPYEVLNGLYRRIDRVAAFNKIVVTQLPCGSGNAMSISCHWTMNT 302

Query: 167 PAASLSCFLQGQ 178
             A+L C L+ Q
Sbjct: 303 SYAAL-CLLKSQ 313

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 35/89 (39%), Gaps = 10/89 (11%)

Query: 109 QPSTENTILIFLSGDTTI--SEFLNGLNRR-VFEGLRHTLSLVPLPLGTGNAWANSLGLR 165
           QPST+   +  L  +  I    F N +N+  VF    HTL L P        WAN    R
Sbjct: 760 QPSTKKITITRLPRNLIIHLKRFDNMMNKNNVFVSYPHTLDLTPF-------WANDFDGR 812

Query: 166 CPAASLSCFLQGQLTPRKFPLYKATFPNG 194
            P        +GQ+ P  + LY      G
Sbjct: 813 LPPGVTELPTRGQVPPFSYKLYAVASHTG 841

>KLLA0F00660g Chr6 (54232..58356) [4125 bp, 1374 aa] {ON} similar to
           uniprot|Q02979 Saccharomyces cerevisiae YPL110C
           Hypothetical ORF
          Length = 1374

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 43/97 (44%), Gaps = 12/97 (12%)

Query: 41  GDASLDPQLTRGQKDILIVDSIKSGTGRDSRNNF---GKNVLEP-------LFTLLGIPH 90
           G AS D  +   ++D   VD  K GT   S  +    GK V  P       L T   I  
Sbjct: 678 GGASED--INDKKEDSPTVDFYKQGTTTSSSIDIMTDGKPVTNPRKMLTHSLSTGKAISS 735

Query: 91  KVVRTQDSDAAGQLGHTFQPSTENTILIFLSGDTTIS 127
           K    Q+S+   + GH++  S E+ ILI L G+ T S
Sbjct: 736 KDSSQQESETVKKFGHSYLKSNESIILICLGGNDTRS 772

>Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310C
            (CDC25) - 1:1 [contig 225] FULL
          Length = 1517

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 23/34 (67%)

Query: 284  HVLGYSSKLQQASLVSKIMKGYSNRAGDDISGDG 317
            +VL Y++++ +  L++++MKG  +R  +D   DG
Sbjct: 979  NVLNYAARMMKNDLIAEVMKGEQSRKTEDEKADG 1012

>Suva_12.121 Chr12 (178103..181429) [3327 bp, 1108 aa] {ON} YJR039W
           (REAL)
          Length = 1108

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 231 ASLEILQKYPL-EYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQ 282
           ++LE+L++  + + +LQ  G+P  DY    LI TP+    +KPS Q      Q
Sbjct: 610 STLEVLEEVKICKKKLQFCGVPNSDY---VLIFTPDTIVLFKPSVQKGEFDIQ 659

>SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} similar
           to uniprot|Q12246 Saccharomyces cerevisiae YLR260W LCB5
           Minor sphingoid long-chain base kinase paralog of Lcb4p
           responsible for few percent of the total activity
           possibly involved in synthesis of long-chain base
           phosphates which function as signaling molecules and
           similar to YOR171c
          Length = 558

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 4/113 (3%)

Query: 50  TRGQKDILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQ 109
           T+  K IL++ +   G GR ++    K   +P+        +++ T     A  +     
Sbjct: 176 TKRNKSILVIINPHGGKGRANKLYVSK--AKPILIASQCTVEILETTYHRHAIDIAQNID 233

Query: 110 PSTENTILIFLSGDTTISEFLNGLNRRVFEGLR-HTLSLVPLPLGTGNAWANS 161
               + ++   SGD    E LNGL RR       + +++  LP G+GNA + S
Sbjct: 234 IDKYD-VIACASGDGIPHEVLNGLYRRADRAKAFNKVAITQLPCGSGNAMSVS 285

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 34/82 (41%), Gaps = 10/82 (12%)

Query: 109 QPSTENTILIFLSGDTTI--SEFLNGLNRR-VFEGLRHTLSLVPLPLGTGNAWANSLGLR 165
           QPST+   +  L  +  I    F N L++  +F    HTL L P        WAN    R
Sbjct: 727 QPSTKKITITRLPRNLVIHLKRFDNLLHKNNIFVSYPHTLDLTPF-------WANDFDGR 779

Query: 166 CPAASLSCFLQGQLTPRKFPLY 187
            P        +GQ+ P  + LY
Sbjct: 780 LPPGVAELPTRGQVPPFNYNLY 801

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,562,951
Number of extensions: 1842678
Number of successful extensions: 4089
Number of sequences better than 10.0: 29
Number of HSP's gapped: 4149
Number of HSP's successfully gapped: 29
Length of query: 386
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 275
Effective length of database: 40,753,473
Effective search space: 11207205075
Effective search space used: 11207205075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)