Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E00990g5.705ON89894641e-61
Kwal_YGOB_Anc_5.7055.705ON88883851e-49
SAKL0E14982g5.705ON89873164e-39
NCAS0A031805.705ON88873043e-37
Kpol_YGOB_1043.725.705ON88882992e-36
TBLA0G010305.705ON89792773e-33
Smik_11.3595.705ON88882774e-33
Skud_11.3355.705ON94942767e-33
KAFR0H001905.705ON82812722e-32
YKR095W-A (PCC1)5.705ON88882722e-32
TDEL0B021505.705ON91802705e-32
ZYRO0B16368g5.705ON85812635e-31
TPHA0E002005.705ON85732592e-30
Suva_11.3325.705ON111772594e-30
KLLA0A00539g5.705ON87772565e-30
KNAG0C066205.705ON101882472e-28
Ecym_40165.705ON125742371e-26
NDAI0E050605.705ON86832322e-26
AFR289W5.705ON81771975e-21
CAGL0G02535g5.705ON140531694e-16
ADL298C3.321ON147662650.76
KAFR0A051206.29ON147927621.9
ADR051C8.520ON181954612.6
Kpol_1024.288.563ON55945612.9
Kwal_55.212785.472ON60026612.9
NDAI0C056308.563ON56049604.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E00990g
         (89 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   183   1e-61
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   152   1e-49
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   126   4e-39
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   121   3e-37
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   119   2e-36
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   111   3e-33
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   111   4e-33
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   110   7e-33
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   109   2e-32
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   109   2e-32
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   108   5e-32
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   105   5e-31
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   104   2e-30
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   104   4e-30
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   103   5e-30
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   100   2e-28
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    96   1e-26
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...    94   2e-26
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    80   5e-21
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    70   4e-16
ADL298C Chr4 complement(174374..178804) [4431 bp, 1476 aa] {ON} ...    30   0.76 
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...    28   1.9  
ADR051C Chr4 complement(796211..801670) [5460 bp, 1819 aa] {ON} ...    28   2.6  
Kpol_1024.28 s1024 complement(79631..81310) [1680 bp, 559 aa] {O...    28   2.9  
Kwal_55.21278 s55 (764480..766282) [1803 bp, 600 aa] {ON} YDR390...    28   2.9  
NDAI0C05630 Chr3 (1300874..1302556) [1683 bp, 560 aa] {ON} Anc_8...    28   4.1  

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  183 bits (464), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 89/89 (100%), Positives = 89/89 (100%)

Query: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60
          MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG
Sbjct: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60

Query: 61 VDDRVLRVGVSSVIESIKTIIETIDEFSH 89
          VDDRVLRVGVSSVIESIKTIIETIDEFSH
Sbjct: 61 VDDRVLRVGVSSVIESIKTIIETIDEFSH 89

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  152 bits (385), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 73/88 (82%), Positives = 80/88 (90%)

Query: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60
          MK +R  +LAYTLYLEVPF+  KQA TAV+VLKPDPILKPQDFHVEY+S A+NLCV FEG
Sbjct: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60

Query: 61 VDDRVLRVGVSSVIESIKTIIETIDEFS 88
          VDDRVLRVGVSSVIESIKTI+ETIDEFS
Sbjct: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  126 bits (316), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 59/87 (67%), Positives = 71/87 (81%)

Query: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60
          MK TRQ  L + LYLE+P +T  QA  A+K LKPDP+LKP+DF VEYS+  + LCVSF+ 
Sbjct: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60

Query: 61 VDDRVLRVGVSSVIESIKTIIETIDEF 87
          +DDRVLRVGVSSVIES+KTIIET+DEF
Sbjct: 61 IDDRVLRVGVSSVIESVKTIIETMDEF 87

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  121 bits (304), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 59/87 (67%), Positives = 68/87 (78%)

Query: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60
          MK  R+  L Y L LE+PF T++QA+ A KVL PDPILKPQDF VEY S+ + L V F G
Sbjct: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60

Query: 61 VDDRVLRVGVSSVIESIKTIIETIDEF 87
          +DDRVLRVGVSSVI+SIKTIIETIDE 
Sbjct: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 57/88 (64%), Positives = 71/88 (80%)

Query: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60
          MK  R  ++ +TL  E+PF+TA+QAE AV+VLKPDPILKPQDF V YSS  + L + F+ 
Sbjct: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60

Query: 61 VDDRVLRVGVSSVIESIKTIIETIDEFS 88
          +DDRVLRVGVSSVI+S+KTIIET+DE S
Sbjct: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  111 bits (277), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 65/79 (82%)

Query: 9  LAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRV 68
          + +TL L +PF T+KQA+ A +VL+PDPIL+PQDF V+Y+SK + L + F+ +DDRVLRV
Sbjct: 10 MEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVLRV 69

Query: 69 GVSSVIESIKTIIETIDEF 87
          GVSSVI+S+KTIIET DE 
Sbjct: 70 GVSSVIDSVKTIIETFDEL 88

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  111 bits (277), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 67/88 (76%)

Query: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60
          M   R+  L +TL L+VPFKT +QA  A +VL PDPILKPQDF ++YSS+ + + V F  
Sbjct: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60

Query: 61 VDDRVLRVGVSSVIESIKTIIETIDEFS 88
          +DDRVLRVGVSSVI+SIKT++E +DE S
Sbjct: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  110 bits (276), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 56/94 (59%), Positives = 67/94 (71%), Gaps = 6/94 (6%)

Query: 1  MKGTRQSDLAYTLY------LEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNL 54
          M   R+  L YTL       L++PF+T  QA  A KVL PDPILKPQDF V+YSS+ + +
Sbjct: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60

Query: 55 CVSFEGVDDRVLRVGVSSVIESIKTIIETIDEFS 88
           V F  +DDRVLRVGVSSVI+SIKTI+ETIDE S
Sbjct: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  109 bits (272), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 51/81 (62%), Positives = 64/81 (79%)

Query: 8  DLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLR 67
          +L +TL LE+PF+ AKQA  AV VLKPDPIL+PQDF V Y ++ +     FE +DDRVLR
Sbjct: 2  NLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLR 61

Query: 68 VGVSSVIESIKTIIETIDEFS 88
          VGVS+VI+S+KTIIET+DE S
Sbjct: 62 VGVSNVIDSLKTIIETMDELS 82

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  109 bits (272), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 51/88 (57%), Positives = 66/88 (75%)

Query: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60
          M   R+  L +TL L++PF+T +QA  A KVL PDPILKPQDF V+YSS+ + + V F  
Sbjct: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60

Query: 61 VDDRVLRVGVSSVIESIKTIIETIDEFS 88
          +DDRVLRVGVSS+I+SIKTI+E +D  S
Sbjct: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  108 bits (270), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 64/80 (80%)

Query: 9  LAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRV 68
          L ++L LE+PF+TA QA  A +VL PDPILKPQDF V+Y++  + L V F+ +DDRVLRV
Sbjct: 3  LNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRV 62

Query: 69 GVSSVIESIKTIIETIDEFS 88
          GVSSVI+SIKTI+ETIDE  
Sbjct: 63 GVSSVIDSIKTIVETIDELG 82

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  105 bits (263), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 64/81 (79%)

Query: 9  LAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRV 68
          L + L+L +PF   + +E AVKVL+PDPIL+P+DF VEY SK + L + F+ VDDRVLRV
Sbjct: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63

Query: 69 GVSSVIESIKTIIETIDEFSH 89
          GVSSVI+S+KTI+ETIDE  +
Sbjct: 64 GVSSVIDSVKTIVETIDELDY 84

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score =  104 bits (259), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 48/73 (65%), Positives = 62/73 (84%)

Query: 15 LEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRVGVSSVI 74
          L +PF+T+KQA  A +VLKPDP L+P++F V+YSS+  +L V+F+ VDDRVLRVGVS+VI
Sbjct: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69

Query: 75 ESIKTIIETIDEF 87
          +SIKTIIETIDE 
Sbjct: 70 DSIKTIIETIDEL 82

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  104 bits (259), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 60/77 (77%)

Query: 12  TLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRVGVS 71
           T  L++PF+T KQA  A +VL PDPILKPQDF  +YSS+ + +   F  +DDRVLRVGVS
Sbjct: 35  TRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVGVS 94

Query: 72  SVIESIKTIIETIDEFS 88
           SVI+SIKTIIET+DE S
Sbjct: 95  SVIDSIKTIIETMDELS 111

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  103 bits (256), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (81%)

Query: 11 YTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRVGV 70
          ++L+LE+PF++ KQA+ A KVL PDPI+KP+DF V YS++   L   FE VD+R+LRVGV
Sbjct: 10 HSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRVGV 69

Query: 71 SSVIESIKTIIETIDEF 87
          +SVIESIKTI+ETIDE 
Sbjct: 70 NSVIESIKTIVETIDEL 86

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score = 99.8 bits (247), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 50/88 (56%), Positives = 63/88 (71%)

Query: 2  KGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGV 61
          K  R + L +TL L VPF+T +QA  A +VL+PDPILKPQDF V Y+++   L   F G 
Sbjct: 4  KTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGR 63

Query: 62 DDRVLRVGVSSVIESIKTIIETIDEFSH 89
          D RVLRVGVSSVI+S+KTIIE++DE   
Sbjct: 64 DARVLRVGVSSVIDSLKTIIESLDELDQ 91

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 95.9 bits (237), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 58/74 (78%)

Query: 15  LEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRVGVSSVI 74
           LEVPF+  KQAE A +VL  DP+L+P+DF V+Y+ +   L V+F  +D R LRVGVSSVI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 75  ESIKTIIETIDEFS 88
           ESIKT++ET+DEFS
Sbjct: 111 ESIKTVVETMDEFS 124

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score = 94.0 bits (232), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 48/83 (57%), Positives = 60/83 (72%), Gaps = 4/83 (4%)

Query: 9  LAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKA--HN--LCVSFEGVDDR 64
          L YTL + +PF   + A  A +VL PDPILKP+DF VEY   A  HN  L V F+ +D+R
Sbjct: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63

Query: 65 VLRVGVSSVIESIKTIIETIDEF 87
          VLRVGVSSV++SIKTI+ET+DE 
Sbjct: 64 VLRVGVSSVLDSIKTILETMDEL 86

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 80.5 bits (197), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 54/77 (70%)

Query: 11 YTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRVGV 70
          +TL+L VPF++A+ A+ A + L PDP+L+P++  V ++S   +L +    +D RVLRV  
Sbjct: 3  HTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRVAT 62

Query: 71 SSVIESIKTIIETIDEF 87
          +S+ E++KT++ET DE 
Sbjct: 63 NSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 69.7 bits (169), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%)

Query: 15 LEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLR 67
          L VPF+TA+ A  A +VL+PDPIL+P+DF VEY +KA  L + F+ +DDRVLR
Sbjct: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83

>ADL298C Chr4 complement(174374..178804) [4431 bp, 1476 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL034C
           (STU1)
          Length = 1476

 Score = 29.6 bits (65), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 4/62 (6%)

Query: 1   MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60
            +G R  DL   + L+   +  K   +AVK L+   + KPQ F  E +S    +C +  G
Sbjct: 86  FQGARIRDLVRVVLLQEQLQERKVWGSAVKSLEAIYLCKPQAFEAELAS----ICAATRG 141

Query: 61  VD 62
            D
Sbjct: 142 SD 143

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 28.5 bits (62), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 16/27 (59%)

Query: 43   FHVEYSSKAHNLCVSFEGVDDRVLRVG 69
            F +EY+    N+C+ +  +DD  L+ G
Sbjct: 1282 FRIEYNKDDRNICIQYIALDDLTLKEG 1308

>ADR051C Chr4 complement(796211..801670) [5460 bp, 1819 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YBR208C
            (DUR1,2)
          Length = 1819

 Score = 28.1 bits (61), Expect = 2.6,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 26   ETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRVGVSSVIESIKT 79
            ETAV+  + +P+  P+D H+ YS  A         V D+V       +IE++KT
Sbjct: 1732 ETAVRK-EAEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKT 1784

>Kpol_1024.28 s1024 complement(79631..81310) [1680 bp, 559 aa] {ON}
           complement(79631..81310) [1680 nt, 560 aa]
          Length = 559

 Score = 28.1 bits (61), Expect = 2.9,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 40  PQDFHVEYSSKAHNLCVSFEGVD-DRVLRVGVSSVIESIKTIIET 83
           P+D+  ++  K HN    F G D D V++    S+ + +   IET
Sbjct: 189 PKDYREDFIVKLHNALSGFNGTDIDEVIQYSQQSLTKCVGITIET 233

>Kwal_55.21278 s55 (764480..766282) [1803 bp, 600 aa] {ON} YDR390C
           (UBA2) - similar to ubiquitin activating enzyme (E1)
           [contig 130] FULL
          Length = 600

 Score = 28.1 bits (61), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 29  VKVLKPDPILKPQDFHVEYSSKAHNL 54
           +K+LK  P  KP D H+ +++KA N+
Sbjct: 383 LKLLKDFPDTKPTDLHMAFTAKASNM 408

>NDAI0C05630 Chr3 (1300874..1302556) [1683 bp, 560 aa] {ON}
           Anc_8.563 YPL086C
          Length = 560

 Score = 27.7 bits (60), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 40  PQDFHVEYSSKAHNLCVSFEGVD-DRVLRVGVSSVIESIKTIIETIDEF 87
           P D+  ++ +K HN    F G D D  ++    S+ + +   IET  ++
Sbjct: 187 PNDYREDFITKLHNALSGFNGNDLDEAIKYSQQSLTKCVGITIETRPDY 235

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,471,879
Number of extensions: 286615
Number of successful extensions: 777
Number of sequences better than 10.0: 30
Number of HSP's gapped: 776
Number of HSP's successfully gapped: 30
Length of query: 89
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 29
Effective length of database: 46,601,439
Effective search space: 1351441731
Effective search space used: 1351441731
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)